>C1
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C2
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C3
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C4
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C5
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C6
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=317
C1 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C2 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C3 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C4 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C5 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C6 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
**************************************************
C1 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C2 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C3 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C4 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C5 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C6 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
**************************************************
C1 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C2 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C3 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C4 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C5 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C6 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
**************************************************
C1 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C2 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C3 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C4 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C5 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C6 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
**************************************************
C1 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C2 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C3 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C4 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C5 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C6 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
**************************************************
C1 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C2 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C3 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C4 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C5 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C6 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
**************************************************
C1 IVSERDILDGIVLSIAG
C2 IVSERDILDGIVLSIAG
C3 IVSERDILDGIVLSIAG
C4 IVSERDILDGIVLSIAG
C5 IVSERDILDGIVLSIAG
C6 IVSERDILDGIVLSIAG
*****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9510]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9510]--->[9510]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.511 Mb, Max= 30.882 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C2 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C3 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C4 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C5 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C6 VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
**************************************************
C1 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C2 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C3 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C4 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C5 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C6 DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
**************************************************
C1 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C2 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C3 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C4 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C5 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C6 GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
**************************************************
C1 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C2 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C3 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C4 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C5 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C6 GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
**************************************************
C1 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C2 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C3 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C4 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C5 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C6 ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
**************************************************
C1 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C2 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C3 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C4 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C5 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C6 VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
**************************************************
C1 IVSERDILDGIVLSIAG
C2 IVSERDILDGIVLSIAG
C3 IVSERDILDGIVLSIAG
C4 IVSERDILDGIVLSIAG
C5 IVSERDILDGIVLSIAG
C6 IVSERDILDGIVLSIAG
*****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C2 GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C3 GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C4 GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C5 GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C6 GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
**************************************************
C1 GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C2 GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C3 GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C4 GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C5 GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C6 GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
**************************************************
C1 GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C2 GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C3 GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C4 GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C5 GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C6 GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
**************************************************
C1 GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C2 GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C3 GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C4 GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C5 GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C6 GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
**************************************************
C1 AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C2 AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C3 AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C4 AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C5 AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C6 AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
**************************************************
C1 GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C2 GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C3 GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C4 GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C5 GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C6 GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
**************************************************
C1 GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C2 GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C3 GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C4 GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C5 GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C6 GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
**************************************************
C1 AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C2 AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C3 AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C4 AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C5 AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C6 AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
**************************************************
C1 CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C2 CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C3 CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C4 CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C5 CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C6 CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
**************************************************
C1 GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C2 GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C3 GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C4 GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C5 GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C6 GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
**************************************************
C1 CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C2 CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C3 CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C4 CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C5 CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C6 CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
**************************************************
C1 CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C2 CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C3 CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C4 CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C5 CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C6 CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
**************************************************
C1 GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C2 GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C3 GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C4 GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C5 GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C6 GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
**************************************************
C1 TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C2 TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C3 TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C4 TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C5 TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C6 TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
**************************************************
C1 ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C2 ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C3 ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C4 ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C5 ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C6 ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
**************************************************
C1 GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C2 GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C3 GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C4 GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C5 GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C6 GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
**************************************************
C1 GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C2 GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C3 GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C4 GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C5 GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C6 GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
**************************************************
C1 TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C2 TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C3 TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C4 TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C5 TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C6 TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
**************************************************
C1 ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C2 ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C3 ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C4 ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C5 ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C6 ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
**************************************************
C1 G
C2 G
C3 G
C4 G
C5 G
C6 G
*
>C1
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C2
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C3
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C4
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C5
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C6
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C1
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C2
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C3
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C4
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C5
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C6
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 951 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579796664
Setting output file names to "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 933870158
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0833317088
Seed = 1003864462
Swapseed = 1579796664
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2128.383458 -- -24.965149
Chain 2 -- -2128.383259 -- -24.965149
Chain 3 -- -2128.383458 -- -24.965149
Chain 4 -- -2128.383259 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2128.383582 -- -24.965149
Chain 2 -- -2128.383582 -- -24.965149
Chain 3 -- -2128.383582 -- -24.965149
Chain 4 -- -2128.383458 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2128.383] (-2128.383) (-2128.383) (-2128.383) * [-2128.384] (-2128.384) (-2128.384) (-2128.383)
500 -- [-1293.132] (-1289.797) (-1291.381) (-1291.746) * (-1298.160) (-1312.843) (-1291.354) [-1304.538] -- 0:00:00
1000 -- (-1288.354) (-1296.128) [-1284.822] (-1288.648) * (-1300.945) (-1288.129) [-1296.510] (-1287.299) -- 0:00:00
1500 -- [-1285.762] (-1296.058) (-1289.401) (-1283.474) * (-1292.326) [-1286.193] (-1289.021) (-1293.383) -- 0:00:00
2000 -- [-1289.840] (-1297.911) (-1286.842) (-1290.105) * [-1284.734] (-1287.934) (-1291.624) (-1290.243) -- 0:00:00
2500 -- (-1286.727) (-1293.541) [-1283.673] (-1302.506) * [-1289.686] (-1288.700) (-1293.878) (-1298.710) -- 0:00:00
3000 -- [-1286.918] (-1286.017) (-1290.765) (-1291.522) * [-1285.894] (-1296.216) (-1286.707) (-1306.821) -- 0:00:00
3500 -- (-1289.278) [-1287.039] (-1291.040) (-1295.220) * [-1291.091] (-1291.804) (-1292.411) (-1294.366) -- 0:00:00
4000 -- (-1292.527) [-1286.919] (-1282.426) (-1288.585) * [-1284.992] (-1288.883) (-1289.507) (-1293.455) -- 0:00:00
4500 -- (-1283.000) [-1287.513] (-1288.136) (-1296.143) * [-1285.391] (-1296.913) (-1289.925) (-1294.317) -- 0:00:00
5000 -- (-1300.502) (-1286.362) (-1290.364) [-1291.191] * [-1292.711] (-1295.984) (-1290.224) (-1286.765) -- 0:00:00
Average standard deviation of split frequencies: 0.085710
5500 -- (-1294.680) (-1296.531) [-1285.916] (-1293.313) * (-1294.239) [-1291.858] (-1296.358) (-1284.750) -- 0:03:00
6000 -- (-1289.939) (-1293.227) (-1286.864) [-1282.907] * (-1288.229) (-1301.584) [-1285.893] (-1296.913) -- 0:02:45
6500 -- [-1294.373] (-1296.763) (-1291.636) (-1291.174) * [-1287.983] (-1290.112) (-1291.614) (-1292.027) -- 0:02:32
7000 -- (-1290.625) [-1284.945] (-1295.656) (-1283.176) * (-1288.892) [-1291.485] (-1285.000) (-1291.181) -- 0:02:21
7500 -- (-1300.504) [-1289.203] (-1294.286) (-1285.578) * [-1296.043] (-1286.650) (-1289.455) (-1284.992) -- 0:02:12
8000 -- [-1288.257] (-1290.128) (-1298.185) (-1290.313) * (-1295.296) (-1284.480) [-1286.716] (-1292.896) -- 0:02:04
8500 -- (-1292.531) [-1287.362] (-1288.412) (-1292.270) * (-1293.017) (-1292.284) [-1291.562] (-1285.546) -- 0:01:56
9000 -- (-1294.481) (-1289.910) (-1290.961) [-1294.817] * [-1290.729] (-1290.634) (-1294.604) (-1290.403) -- 0:01:50
9500 -- (-1290.277) [-1292.711] (-1288.927) (-1291.647) * (-1288.091) (-1293.038) [-1289.085] (-1290.598) -- 0:01:44
10000 -- [-1293.116] (-1291.423) (-1298.176) (-1297.093) * (-1297.897) [-1293.078] (-1288.505) (-1285.383) -- 0:01:39
Average standard deviation of split frequencies: 0.059662
10500 -- [-1288.934] (-1290.684) (-1301.611) (-1290.456) * (-1287.798) (-1298.821) (-1296.692) [-1288.186] -- 0:01:34
11000 -- [-1289.410] (-1291.673) (-1292.320) (-1286.605) * [-1283.882] (-1288.688) (-1290.070) (-1291.660) -- 0:01:29
11500 -- [-1295.890] (-1290.687) (-1292.622) (-1295.323) * (-1297.855) [-1283.728] (-1286.525) (-1290.628) -- 0:01:25
12000 -- (-1292.884) (-1291.826) (-1288.528) [-1288.854] * (-1287.821) [-1289.030] (-1297.199) (-1294.570) -- 0:01:22
12500 -- (-1286.339) (-1289.948) (-1289.729) [-1289.060] * (-1288.334) (-1291.395) (-1289.037) [-1289.844] -- 0:01:19
13000 -- [-1287.471] (-1286.746) (-1293.529) (-1289.873) * (-1289.783) (-1297.218) (-1296.965) [-1287.163] -- 0:01:15
13500 -- (-1286.645) (-1289.646) (-1286.589) [-1295.254] * (-1286.657) [-1287.821] (-1288.763) (-1287.339) -- 0:01:13
14000 -- (-1295.850) (-1295.029) (-1294.065) [-1290.989] * (-1294.322) (-1292.092) (-1290.550) [-1292.149] -- 0:01:10
14500 -- (-1288.056) [-1289.090] (-1288.221) (-1281.288) * (-1289.703) [-1288.835] (-1294.135) (-1291.941) -- 0:01:07
15000 -- (-1291.976) (-1299.478) [-1285.600] (-1288.649) * (-1287.214) (-1296.973) [-1286.731] (-1289.464) -- 0:01:05
Average standard deviation of split frequencies: 0.065941
15500 -- (-1289.080) [-1285.505] (-1288.830) (-1283.387) * (-1291.967) [-1282.538] (-1300.030) (-1297.029) -- 0:01:03
16000 -- (-1288.942) (-1297.053) (-1284.871) [-1279.502] * (-1294.431) (-1282.993) [-1289.585] (-1289.343) -- 0:01:01
16500 -- (-1288.417) (-1286.426) (-1290.510) [-1279.825] * [-1289.843] (-1282.908) (-1296.543) (-1291.296) -- 0:00:59
17000 -- [-1296.402] (-1290.451) (-1286.581) (-1281.749) * (-1294.710) (-1282.334) [-1299.164] (-1294.454) -- 0:00:57
17500 -- (-1292.537) (-1297.352) (-1293.925) [-1280.797] * (-1287.056) (-1285.917) [-1283.749] (-1296.608) -- 0:00:56
18000 -- (-1297.356) [-1288.210] (-1288.555) (-1279.826) * [-1287.836] (-1284.409) (-1291.082) (-1292.440) -- 0:00:54
18500 -- [-1290.063] (-1290.372) (-1291.135) (-1281.601) * (-1302.005) (-1284.734) (-1293.353) [-1283.701] -- 0:00:53
19000 -- (-1294.657) (-1288.554) (-1289.554) [-1280.666] * (-1287.150) (-1281.565) [-1295.423] (-1297.198) -- 0:00:51
19500 -- [-1290.477] (-1290.519) (-1287.875) (-1280.708) * (-1293.489) (-1278.963) [-1288.570] (-1285.286) -- 0:00:50
20000 -- (-1287.756) (-1289.855) [-1289.701] (-1280.734) * (-1290.214) (-1282.783) [-1288.018] (-1287.685) -- 0:00:49
Average standard deviation of split frequencies: 0.063361
20500 -- (-1302.093) (-1296.845) (-1292.142) [-1279.852] * [-1291.116] (-1281.755) (-1286.943) (-1289.013) -- 0:00:47
21000 -- (-1291.701) (-1289.850) (-1289.890) [-1283.452] * [-1292.706] (-1283.407) (-1291.740) (-1294.416) -- 0:01:33
21500 -- (-1281.106) [-1292.005] (-1299.119) (-1281.545) * [-1287.901] (-1283.034) (-1288.586) (-1285.663) -- 0:01:31
22000 -- (-1281.383) (-1293.311) (-1297.119) [-1282.212] * [-1289.312] (-1281.730) (-1289.084) (-1300.512) -- 0:01:28
22500 -- (-1282.296) (-1290.762) [-1288.644] (-1286.896) * [-1287.445] (-1282.738) (-1292.863) (-1290.493) -- 0:01:26
23000 -- (-1289.102) [-1286.147] (-1289.415) (-1280.933) * [-1294.858] (-1284.198) (-1296.214) (-1287.457) -- 0:01:24
23500 -- (-1282.437) (-1289.718) (-1289.076) [-1280.445] * (-1291.246) (-1284.026) (-1289.623) [-1293.741] -- 0:01:23
24000 -- (-1283.240) (-1287.417) (-1292.094) [-1282.336] * [-1291.867] (-1281.672) (-1293.128) (-1299.004) -- 0:01:21
24500 -- (-1282.816) (-1285.120) (-1289.362) [-1280.094] * (-1290.481) [-1283.532] (-1291.572) (-1289.974) -- 0:01:19
25000 -- (-1283.659) (-1284.550) (-1287.884) [-1280.376] * (-1290.176) (-1284.978) [-1290.680] (-1293.208) -- 0:01:18
Average standard deviation of split frequencies: 0.050939
25500 -- (-1280.410) (-1290.010) (-1288.215) [-1280.450] * (-1296.754) (-1282.299) (-1290.821) [-1292.130] -- 0:01:16
26000 -- (-1280.262) (-1288.651) [-1286.496] (-1282.997) * (-1294.856) (-1290.016) [-1292.298] (-1289.273) -- 0:01:14
26500 -- [-1280.991] (-1293.934) (-1286.113) (-1279.412) * (-1295.616) (-1284.814) [-1295.253] (-1292.970) -- 0:01:13
27000 -- (-1280.627) (-1294.086) (-1288.197) [-1279.504] * (-1300.877) [-1284.671] (-1293.130) (-1288.908) -- 0:01:12
27500 -- (-1281.212) (-1290.051) (-1289.042) [-1280.922] * (-1292.700) (-1280.731) [-1291.970] (-1293.412) -- 0:01:10
28000 -- [-1280.529] (-1290.310) (-1288.883) (-1280.630) * [-1290.537] (-1281.258) (-1290.508) (-1288.713) -- 0:01:09
28500 -- (-1280.254) (-1293.882) [-1285.101] (-1280.890) * (-1290.112) [-1281.171] (-1281.637) (-1291.089) -- 0:01:08
29000 -- [-1282.626] (-1288.858) (-1294.411) (-1280.914) * (-1289.918) [-1282.843] (-1282.187) (-1286.088) -- 0:01:06
29500 -- (-1284.845) (-1286.881) (-1291.038) [-1279.766] * (-1294.838) (-1281.256) (-1283.934) [-1287.412] -- 0:01:05
30000 -- (-1278.941) [-1289.858] (-1291.623) (-1280.546) * [-1290.873] (-1281.327) (-1283.877) (-1290.601) -- 0:01:04
Average standard deviation of split frequencies: 0.042070
30500 -- (-1279.889) (-1288.961) [-1286.432] (-1281.290) * (-1292.790) [-1281.907] (-1279.532) (-1307.602) -- 0:01:03
31000 -- (-1279.915) (-1297.183) [-1299.598] (-1282.110) * (-1291.766) (-1280.661) [-1279.284] (-1285.716) -- 0:01:02
31500 -- (-1283.605) (-1293.251) (-1291.622) [-1283.574] * (-1288.212) [-1284.341] (-1279.333) (-1286.445) -- 0:01:01
32000 -- (-1279.464) (-1289.310) [-1290.906] (-1281.152) * [-1288.480] (-1285.208) (-1280.236) (-1282.406) -- 0:01:00
32500 -- (-1280.786) (-1293.533) (-1291.645) [-1280.145] * (-1289.971) (-1283.869) (-1282.611) [-1282.896] -- 0:00:59
33000 -- [-1280.588] (-1287.045) (-1292.827) (-1280.876) * (-1288.148) (-1283.453) [-1281.035] (-1288.873) -- 0:00:58
33500 -- (-1282.958) [-1292.738] (-1307.782) (-1283.180) * (-1287.138) (-1279.335) [-1280.985] (-1284.699) -- 0:00:57
34000 -- (-1279.396) (-1291.032) (-1279.509) [-1283.297] * (-1290.089) (-1281.105) (-1282.287) [-1281.602] -- 0:00:56
34500 -- (-1280.472) (-1284.644) [-1281.431] (-1280.030) * (-1297.314) (-1281.110) [-1282.921] (-1283.304) -- 0:00:55
35000 -- [-1279.500] (-1287.424) (-1287.978) (-1279.597) * (-1285.451) (-1279.825) (-1281.563) [-1283.126] -- 0:00:55
Average standard deviation of split frequencies: 0.041778
35500 -- (-1279.571) [-1288.901] (-1282.682) (-1282.062) * [-1293.561] (-1280.506) (-1281.790) (-1281.204) -- 0:00:54
36000 -- (-1279.732) (-1291.369) [-1281.308] (-1283.201) * (-1292.440) (-1280.687) (-1283.125) [-1283.353] -- 0:00:53
36500 -- (-1282.831) (-1290.303) [-1280.169] (-1281.677) * [-1299.733] (-1282.472) (-1280.673) (-1280.368) -- 0:01:19
37000 -- (-1280.612) (-1294.439) [-1283.087] (-1280.407) * (-1286.242) [-1281.039] (-1282.339) (-1286.962) -- 0:01:18
37500 -- (-1282.418) [-1290.973] (-1279.930) (-1280.976) * (-1292.478) [-1282.036] (-1283.983) (-1286.822) -- 0:01:17
38000 -- (-1281.292) [-1286.044] (-1279.984) (-1280.346) * (-1291.403) (-1281.650) (-1281.157) [-1286.536] -- 0:01:15
38500 -- (-1282.669) [-1285.615] (-1280.960) (-1280.366) * (-1289.834) [-1282.778] (-1282.351) (-1281.668) -- 0:01:14
39000 -- (-1279.779) (-1288.933) [-1281.353] (-1281.740) * (-1290.252) (-1283.755) (-1280.576) [-1284.974] -- 0:01:13
39500 -- (-1280.244) (-1287.043) [-1283.211] (-1281.861) * (-1289.686) (-1284.061) (-1283.824) [-1281.637] -- 0:01:12
40000 -- (-1281.741) [-1296.347] (-1282.496) (-1282.269) * (-1296.454) (-1284.347) [-1280.170] (-1281.638) -- 0:01:12
Average standard deviation of split frequencies: 0.045816
40500 -- (-1281.649) (-1292.479) (-1281.730) [-1281.080] * (-1307.487) (-1284.411) (-1279.988) [-1280.575] -- 0:01:11
41000 -- (-1284.090) [-1294.950] (-1286.336) (-1280.705) * (-1292.462) (-1287.999) (-1281.577) [-1280.698] -- 0:01:10
41500 -- (-1282.908) (-1290.743) [-1280.208] (-1280.370) * (-1295.022) [-1281.420] (-1280.099) (-1280.581) -- 0:01:09
42000 -- (-1282.697) (-1284.471) (-1280.644) [-1280.376] * [-1287.305] (-1282.889) (-1281.573) (-1283.401) -- 0:01:08
42500 -- (-1286.722) [-1287.899] (-1282.336) (-1280.127) * [-1286.398] (-1282.068) (-1280.649) (-1282.965) -- 0:01:07
43000 -- (-1281.178) (-1290.430) (-1281.958) [-1281.550] * (-1299.888) (-1281.839) (-1283.740) [-1283.371] -- 0:01:06
43500 -- (-1280.855) [-1286.432] (-1284.373) (-1279.998) * (-1288.296) (-1283.229) (-1282.014) [-1280.576] -- 0:01:05
44000 -- (-1281.025) (-1292.137) [-1282.728] (-1279.839) * [-1287.155] (-1285.482) (-1281.352) (-1282.255) -- 0:01:05
44500 -- (-1282.806) (-1287.712) (-1284.992) [-1280.425] * (-1294.625) (-1285.045) (-1282.760) [-1282.751] -- 0:01:04
45000 -- (-1280.048) (-1292.910) (-1281.327) [-1282.389] * (-1290.112) [-1286.098] (-1282.826) (-1280.789) -- 0:01:03
Average standard deviation of split frequencies: 0.036982
45500 -- (-1282.869) (-1293.262) (-1283.064) [-1281.013] * [-1295.967] (-1288.681) (-1281.541) (-1280.597) -- 0:01:02
46000 -- (-1280.917) [-1289.796] (-1279.370) (-1280.263) * (-1292.597) (-1287.125) [-1283.682] (-1281.454) -- 0:01:02
46500 -- (-1281.111) [-1289.085] (-1284.080) (-1280.531) * [-1289.418] (-1283.487) (-1281.763) (-1281.961) -- 0:01:01
47000 -- (-1281.787) (-1291.510) [-1281.534] (-1281.076) * (-1288.896) [-1282.176] (-1281.217) (-1283.777) -- 0:01:00
47500 -- (-1281.181) (-1288.635) (-1285.709) [-1284.023] * [-1289.504] (-1281.082) (-1281.042) (-1281.729) -- 0:01:00
48000 -- (-1281.574) (-1296.033) [-1287.763] (-1280.708) * [-1292.986] (-1283.776) (-1280.926) (-1280.659) -- 0:00:59
48500 -- (-1284.300) [-1287.601] (-1284.093) (-1282.690) * [-1293.143] (-1282.580) (-1282.757) (-1280.593) -- 0:00:58
49000 -- [-1279.908] (-1291.269) (-1283.229) (-1279.789) * (-1293.572) [-1280.658] (-1280.994) (-1281.583) -- 0:00:58
49500 -- (-1283.956) (-1287.062) (-1283.925) [-1283.010] * [-1283.790] (-1281.949) (-1281.829) (-1283.706) -- 0:00:57
50000 -- (-1281.730) [-1290.035] (-1281.655) (-1280.205) * (-1285.944) (-1282.561) [-1282.549] (-1281.521) -- 0:00:57
Average standard deviation of split frequencies: 0.032141
50500 -- (-1279.812) (-1291.218) [-1281.170] (-1279.643) * (-1291.150) (-1281.684) (-1281.867) [-1284.550] -- 0:00:56
51000 -- (-1281.509) (-1288.101) [-1281.675] (-1283.958) * [-1288.639] (-1284.791) (-1281.055) (-1282.424) -- 0:00:55
51500 -- (-1282.195) (-1284.855) (-1280.780) [-1279.513] * (-1289.710) (-1282.726) [-1281.115] (-1283.060) -- 0:00:55
52000 -- [-1280.194] (-1290.437) (-1281.415) (-1281.964) * [-1288.308] (-1283.045) (-1281.098) (-1283.142) -- 0:00:54
52500 -- (-1280.833) [-1288.890] (-1282.702) (-1280.759) * (-1288.009) (-1285.860) (-1281.483) [-1281.982] -- 0:01:12
53000 -- (-1278.952) [-1287.902] (-1283.873) (-1281.253) * (-1292.778) (-1284.187) (-1281.387) [-1280.510] -- 0:01:11
53500 -- (-1279.009) [-1287.446] (-1280.225) (-1282.040) * (-1286.174) (-1281.669) [-1284.178] (-1280.898) -- 0:01:10
54000 -- (-1280.332) [-1295.498] (-1280.133) (-1281.240) * [-1286.298] (-1279.808) (-1286.786) (-1285.202) -- 0:01:10
54500 -- [-1283.036] (-1299.264) (-1281.106) (-1279.629) * (-1299.254) [-1280.082] (-1285.808) (-1283.154) -- 0:01:09
55000 -- [-1283.161] (-1301.340) (-1282.283) (-1279.631) * (-1294.220) (-1280.511) [-1280.265] (-1281.376) -- 0:01:08
Average standard deviation of split frequencies: 0.029262
55500 -- (-1280.422) (-1287.842) (-1282.863) [-1279.345] * (-1285.864) [-1280.241] (-1280.474) (-1283.287) -- 0:01:08
56000 -- (-1281.206) (-1300.123) [-1280.709] (-1280.425) * [-1290.826] (-1279.415) (-1279.495) (-1284.819) -- 0:01:07
56500 -- (-1280.443) (-1287.321) (-1280.676) [-1281.895] * (-1288.485) (-1280.963) (-1280.053) [-1285.339] -- 0:01:06
57000 -- (-1282.444) (-1285.910) [-1280.900] (-1282.874) * [-1283.886] (-1280.495) (-1283.142) (-1285.725) -- 0:01:06
57500 -- (-1280.837) (-1291.447) (-1281.655) [-1280.163] * (-1282.666) [-1280.180] (-1283.113) (-1281.011) -- 0:01:05
58000 -- (-1283.415) (-1288.231) (-1282.887) [-1280.646] * (-1281.503) (-1279.818) (-1281.879) [-1279.853] -- 0:01:04
58500 -- [-1282.268] (-1293.193) (-1282.888) (-1284.160) * (-1288.232) (-1280.665) (-1281.876) [-1280.388] -- 0:01:04
59000 -- (-1282.226) (-1290.559) [-1281.328] (-1280.618) * (-1286.580) (-1280.815) (-1280.468) [-1282.401] -- 0:01:03
59500 -- (-1281.606) (-1284.454) [-1280.459] (-1280.304) * (-1288.125) (-1280.003) (-1282.524) [-1281.313] -- 0:01:03
60000 -- (-1281.227) (-1285.502) [-1281.767] (-1286.978) * (-1284.245) (-1279.568) [-1281.461] (-1280.954) -- 0:01:02
Average standard deviation of split frequencies: 0.029916
60500 -- [-1281.252] (-1289.061) (-1281.527) (-1291.677) * (-1284.607) (-1281.195) (-1281.195) [-1279.813] -- 0:01:02
61000 -- (-1280.082) [-1288.440] (-1281.756) (-1284.018) * (-1283.819) (-1284.578) [-1280.428] (-1283.803) -- 0:01:01
61500 -- (-1281.910) (-1294.510) [-1281.561] (-1280.224) * (-1283.738) (-1284.531) (-1280.773) [-1281.247] -- 0:01:01
62000 -- [-1280.471] (-1296.504) (-1283.417) (-1279.583) * [-1287.548] (-1280.248) (-1280.673) (-1282.144) -- 0:01:00
62500 -- [-1279.775] (-1295.691) (-1282.528) (-1282.367) * (-1284.213) (-1282.503) [-1280.630] (-1280.075) -- 0:01:00
63000 -- (-1284.557) [-1287.349] (-1282.357) (-1281.405) * [-1287.678] (-1286.930) (-1281.199) (-1281.177) -- 0:00:59
63500 -- (-1284.482) (-1285.800) [-1281.500] (-1281.683) * (-1280.974) (-1285.627) [-1280.336] (-1283.023) -- 0:00:58
64000 -- (-1283.330) (-1293.212) (-1279.425) [-1279.855] * (-1282.672) (-1279.495) (-1280.588) [-1280.584] -- 0:00:58
64500 -- (-1284.732) (-1292.299) [-1283.158] (-1281.675) * [-1280.770] (-1279.477) (-1280.554) (-1282.359) -- 0:00:58
65000 -- [-1280.418] (-1291.599) (-1280.713) (-1279.332) * [-1282.087] (-1279.866) (-1281.640) (-1280.460) -- 0:00:57
Average standard deviation of split frequencies: 0.025849
65500 -- (-1282.754) [-1283.352] (-1280.141) (-1280.846) * (-1282.797) (-1281.552) [-1280.118] (-1281.062) -- 0:00:57
66000 -- (-1282.377) [-1291.414] (-1280.673) (-1281.260) * [-1285.167] (-1281.943) (-1282.093) (-1281.884) -- 0:00:56
66500 -- (-1280.154) [-1286.122] (-1283.680) (-1279.941) * [-1281.358] (-1282.341) (-1284.612) (-1280.342) -- 0:00:56
67000 -- (-1281.805) [-1290.476] (-1282.614) (-1280.424) * (-1281.868) [-1284.179] (-1283.259) (-1281.911) -- 0:00:55
67500 -- [-1281.104] (-1294.614) (-1282.153) (-1280.134) * (-1282.280) (-1286.479) [-1279.983] (-1284.811) -- 0:00:55
68000 -- (-1282.129) [-1288.987] (-1286.532) (-1281.462) * (-1281.782) (-1282.501) (-1280.877) [-1279.857] -- 0:00:54
68500 -- [-1280.706] (-1285.723) (-1282.918) (-1279.521) * (-1280.957) (-1282.656) [-1280.176] (-1280.223) -- 0:01:07
69000 -- (-1280.197) (-1295.030) (-1282.238) [-1279.360] * (-1282.418) (-1281.635) [-1285.258] (-1279.494) -- 0:01:07
69500 -- (-1281.572) (-1285.239) (-1284.935) [-1284.051] * (-1281.442) (-1281.569) [-1280.312] (-1281.970) -- 0:01:06
70000 -- (-1286.171) (-1290.225) (-1284.219) [-1279.241] * (-1280.755) (-1282.947) (-1281.831) [-1281.494] -- 0:01:06
Average standard deviation of split frequencies: 0.021529
70500 -- [-1280.196] (-1287.810) (-1283.783) (-1280.245) * (-1282.177) (-1282.283) [-1281.346] (-1282.222) -- 0:01:05
71000 -- (-1280.409) [-1292.143] (-1281.110) (-1280.497) * (-1279.980) (-1284.716) (-1281.301) [-1280.836] -- 0:01:05
71500 -- (-1279.874) (-1290.355) (-1281.688) [-1281.081] * (-1282.393) [-1283.173] (-1279.400) (-1279.730) -- 0:01:04
72000 -- (-1280.299) [-1285.391] (-1284.043) (-1282.341) * [-1281.813] (-1293.224) (-1279.460) (-1281.700) -- 0:01:04
72500 -- [-1279.995] (-1290.993) (-1284.543) (-1283.071) * (-1281.634) (-1285.144) [-1279.708] (-1284.406) -- 0:01:03
73000 -- (-1281.872) (-1288.894) (-1282.850) [-1281.384] * [-1283.683] (-1284.789) (-1279.550) (-1282.683) -- 0:01:03
73500 -- (-1279.652) (-1290.598) (-1281.048) [-1282.584] * [-1281.370] (-1282.807) (-1282.573) (-1283.254) -- 0:01:03
74000 -- [-1281.393] (-1293.114) (-1279.392) (-1282.342) * (-1281.587) (-1283.991) [-1281.217] (-1282.057) -- 0:01:02
74500 -- (-1284.482) (-1292.634) (-1279.121) [-1284.578] * [-1281.798] (-1286.485) (-1279.056) (-1280.127) -- 0:01:02
75000 -- (-1281.023) (-1295.484) [-1280.479] (-1287.536) * [-1283.490] (-1281.073) (-1281.936) (-1280.113) -- 0:01:01
Average standard deviation of split frequencies: 0.021709
75500 -- (-1283.000) [-1303.168] (-1280.066) (-1285.951) * (-1281.168) (-1282.024) [-1282.310] (-1279.855) -- 0:01:01
76000 -- (-1281.873) [-1287.689] (-1281.848) (-1280.364) * (-1281.448) (-1282.644) [-1279.507] (-1285.366) -- 0:01:00
76500 -- (-1280.374) (-1290.876) (-1281.740) [-1280.610] * (-1283.229) (-1286.844) [-1279.974] (-1283.165) -- 0:01:00
77000 -- (-1281.039) (-1295.054) [-1282.121] (-1280.524) * (-1282.741) (-1287.130) [-1282.626] (-1281.552) -- 0:00:59
77500 -- (-1280.060) (-1286.791) (-1284.018) [-1279.056] * (-1281.997) (-1286.365) (-1282.425) [-1282.602] -- 0:00:59
78000 -- (-1280.048) (-1283.809) (-1285.155) [-1279.466] * [-1279.711] (-1286.757) (-1281.226) (-1281.740) -- 0:00:59
78500 -- (-1281.967) (-1291.908) (-1281.999) [-1280.422] * (-1279.951) (-1281.647) [-1280.591] (-1282.404) -- 0:00:58
79000 -- (-1280.504) (-1300.424) (-1281.200) [-1279.328] * (-1284.114) (-1284.164) [-1281.113] (-1281.941) -- 0:00:58
79500 -- (-1283.164) (-1291.670) [-1284.344] (-1285.025) * (-1285.187) (-1281.715) (-1281.097) [-1280.690] -- 0:00:57
80000 -- [-1288.005] (-1284.175) (-1281.782) (-1280.087) * (-1282.366) (-1282.323) [-1279.799] (-1283.404) -- 0:00:57
Average standard deviation of split frequencies: 0.025528
80500 -- (-1289.311) [-1287.581] (-1281.951) (-1280.143) * (-1284.544) [-1280.563] (-1280.339) (-1282.586) -- 0:00:57
81000 -- (-1280.939) [-1292.611] (-1284.746) (-1279.189) * (-1281.522) [-1279.793] (-1279.371) (-1280.936) -- 0:00:56
81500 -- (-1280.616) [-1290.194] (-1283.768) (-1279.558) * (-1284.011) [-1280.268] (-1281.761) (-1283.096) -- 0:00:56
82000 -- [-1280.798] (-1288.785) (-1286.547) (-1282.113) * (-1286.023) [-1280.041] (-1282.618) (-1286.630) -- 0:00:55
82500 -- (-1282.571) (-1287.680) [-1284.712] (-1281.503) * [-1282.058] (-1281.720) (-1279.398) (-1279.795) -- 0:00:55
83000 -- [-1281.176] (-1296.870) (-1284.932) (-1281.503) * (-1282.141) [-1281.855] (-1279.932) (-1282.798) -- 0:00:55
83500 -- (-1282.417) (-1292.944) (-1285.377) [-1281.044] * (-1281.634) [-1288.117] (-1281.749) (-1280.905) -- 0:00:54
84000 -- (-1285.032) (-1288.073) (-1285.378) [-1282.455] * (-1283.214) (-1287.870) (-1285.130) [-1279.719] -- 0:00:54
84500 -- (-1281.569) (-1293.097) (-1285.862) [-1280.012] * (-1283.101) [-1280.110] (-1284.955) (-1280.358) -- 0:01:05
85000 -- [-1280.585] (-1291.156) (-1285.120) (-1280.116) * [-1280.309] (-1282.535) (-1279.539) (-1279.494) -- 0:01:04
Average standard deviation of split frequencies: 0.025489
85500 -- (-1281.233) [-1287.936] (-1283.389) (-1281.383) * (-1280.630) (-1282.413) (-1281.766) [-1280.748] -- 0:01:04
86000 -- (-1281.830) (-1291.950) (-1282.334) [-1281.079] * (-1281.724) [-1284.184] (-1282.841) (-1280.284) -- 0:01:03
86500 -- [-1281.351] (-1296.544) (-1280.617) (-1280.417) * (-1281.402) (-1284.815) [-1283.971] (-1280.488) -- 0:01:03
87000 -- (-1279.931) (-1291.785) (-1280.117) [-1279.805] * (-1280.949) [-1281.127] (-1282.406) (-1279.690) -- 0:01:02
87500 -- (-1280.486) [-1294.602] (-1281.140) (-1281.432) * (-1280.868) (-1280.849) (-1280.181) [-1282.007] -- 0:01:02
88000 -- (-1280.131) (-1290.370) (-1280.597) [-1282.077] * [-1280.517] (-1282.169) (-1280.722) (-1280.052) -- 0:01:02
88500 -- (-1282.229) [-1293.782] (-1284.258) (-1282.732) * [-1280.199] (-1282.506) (-1280.031) (-1279.666) -- 0:01:01
89000 -- [-1283.025] (-1293.948) (-1282.838) (-1284.668) * (-1283.098) (-1282.315) [-1281.310] (-1279.784) -- 0:01:01
89500 -- (-1280.378) (-1288.283) [-1281.989] (-1281.437) * (-1281.652) (-1281.997) (-1283.536) [-1279.432] -- 0:01:01
90000 -- [-1279.153] (-1291.394) (-1280.558) (-1280.365) * (-1281.989) [-1280.288] (-1283.475) (-1279.418) -- 0:01:00
Average standard deviation of split frequencies: 0.029636
90500 -- (-1279.115) [-1288.146] (-1282.788) (-1280.683) * (-1281.356) (-1281.258) [-1284.385] (-1279.983) -- 0:01:00
91000 -- (-1282.491) (-1290.247) [-1280.794] (-1280.538) * (-1279.465) (-1282.469) (-1283.450) [-1284.142] -- 0:00:59
91500 -- (-1281.590) (-1285.749) (-1280.451) [-1279.757] * (-1285.091) [-1280.311] (-1279.821) (-1280.695) -- 0:00:59
92000 -- (-1281.160) (-1288.563) [-1280.972] (-1281.127) * [-1286.440] (-1280.710) (-1279.338) (-1281.831) -- 0:00:59
92500 -- [-1279.415] (-1286.542) (-1281.238) (-1280.438) * [-1280.151] (-1280.418) (-1280.673) (-1281.496) -- 0:00:58
93000 -- [-1279.386] (-1285.574) (-1280.894) (-1281.515) * (-1280.395) (-1280.517) [-1283.659] (-1281.277) -- 0:00:58
93500 -- [-1281.524] (-1289.473) (-1280.900) (-1282.553) * (-1281.508) [-1282.211] (-1283.882) (-1280.253) -- 0:00:58
94000 -- (-1283.109) [-1284.535] (-1283.337) (-1281.851) * (-1280.343) (-1281.883) [-1282.099] (-1282.129) -- 0:00:57
94500 -- (-1283.317) [-1287.774] (-1280.418) (-1282.630) * (-1281.607) (-1279.364) (-1284.677) [-1282.151] -- 0:00:57
95000 -- (-1280.829) (-1289.943) (-1280.197) [-1281.126] * [-1281.607] (-1280.578) (-1284.978) (-1282.134) -- 0:00:57
Average standard deviation of split frequencies: 0.027008
95500 -- (-1279.727) (-1293.619) (-1282.718) [-1281.107] * (-1281.293) [-1280.457] (-1284.280) (-1283.280) -- 0:00:56
96000 -- (-1282.547) (-1286.432) [-1280.005] (-1280.782) * [-1281.075] (-1281.196) (-1281.166) (-1284.580) -- 0:00:56
96500 -- (-1280.854) [-1293.896] (-1282.323) (-1287.219) * (-1283.295) (-1279.613) [-1279.665] (-1288.400) -- 0:00:56
97000 -- (-1280.540) [-1284.438] (-1283.550) (-1287.060) * (-1282.128) [-1283.217] (-1280.461) (-1283.821) -- 0:00:55
97500 -- [-1281.882] (-1289.883) (-1286.657) (-1283.816) * [-1282.303] (-1281.493) (-1280.725) (-1279.833) -- 0:00:55
98000 -- (-1282.244) (-1293.442) [-1281.427] (-1281.761) * (-1282.650) (-1285.956) [-1279.779] (-1280.759) -- 0:00:55
98500 -- [-1281.403] (-1292.495) (-1279.871) (-1283.401) * (-1280.317) (-1280.244) (-1280.151) [-1281.177] -- 0:00:54
99000 -- [-1280.723] (-1287.280) (-1281.656) (-1283.033) * (-1282.066) [-1279.554] (-1280.569) (-1283.233) -- 0:00:54
99500 -- (-1280.113) (-1290.071) (-1280.551) [-1283.264] * (-1283.244) [-1279.603] (-1283.459) (-1281.936) -- 0:00:54
100000 -- (-1279.776) [-1288.516] (-1283.460) (-1282.051) * (-1281.649) (-1280.764) (-1279.933) [-1280.400] -- 0:00:54
Average standard deviation of split frequencies: 0.026865
100500 -- (-1280.070) (-1289.621) (-1283.544) [-1282.427] * (-1283.857) (-1282.131) (-1281.435) [-1281.413] -- 0:01:02
101000 -- (-1282.955) (-1291.106) (-1280.468) [-1281.004] * (-1283.638) [-1284.224] (-1280.235) (-1279.778) -- 0:01:02
101500 -- (-1284.404) (-1287.540) (-1282.787) [-1280.650] * (-1280.662) (-1283.696) (-1279.808) [-1281.718] -- 0:01:01
102000 -- [-1279.620] (-1294.389) (-1279.517) (-1280.395) * (-1282.477) (-1282.075) (-1283.198) [-1283.828] -- 0:01:01
102500 -- (-1282.312) (-1296.518) (-1279.573) [-1280.317] * (-1281.751) (-1281.615) [-1282.555] (-1279.752) -- 0:01:01
103000 -- (-1281.432) (-1295.297) (-1279.539) [-1281.712] * (-1281.921) (-1280.078) (-1280.620) [-1279.742] -- 0:01:00
103500 -- [-1281.178] (-1286.931) (-1279.984) (-1279.118) * (-1286.329) [-1280.110] (-1283.055) (-1279.938) -- 0:01:00
104000 -- (-1279.423) [-1293.567] (-1283.561) (-1279.146) * (-1284.092) [-1280.088] (-1284.409) (-1284.635) -- 0:01:00
104500 -- (-1279.435) (-1292.787) (-1279.129) [-1279.146] * (-1283.176) [-1280.460] (-1284.751) (-1279.980) -- 0:00:59
105000 -- (-1280.479) (-1288.876) [-1281.517] (-1281.573) * (-1282.880) [-1283.505] (-1282.829) (-1280.604) -- 0:00:59
Average standard deviation of split frequencies: 0.024460
105500 -- (-1284.423) (-1290.584) [-1279.103] (-1281.977) * (-1283.900) [-1282.341] (-1281.387) (-1281.400) -- 0:00:59
106000 -- (-1283.769) (-1290.554) (-1284.704) [-1280.600] * (-1284.661) (-1282.084) [-1280.128] (-1283.327) -- 0:00:59
106500 -- (-1283.543) [-1283.395] (-1281.480) (-1279.451) * [-1285.253] (-1284.663) (-1279.903) (-1280.155) -- 0:00:58
107000 -- [-1283.030] (-1293.404) (-1281.442) (-1279.212) * (-1282.726) [-1281.666] (-1280.181) (-1282.435) -- 0:00:58
107500 -- (-1281.332) (-1290.687) (-1279.733) [-1279.811] * (-1280.093) [-1280.574] (-1279.650) (-1280.622) -- 0:00:58
108000 -- (-1281.479) [-1285.605] (-1280.638) (-1279.357) * (-1280.046) (-1280.987) (-1279.648) [-1284.153] -- 0:00:57
108500 -- (-1280.116) (-1294.791) (-1281.435) [-1279.161] * (-1280.382) (-1280.323) [-1279.487] (-1283.642) -- 0:00:57
109000 -- [-1280.952] (-1293.637) (-1282.671) (-1279.762) * (-1281.536) (-1279.441) [-1280.558] (-1284.160) -- 0:00:57
109500 -- (-1280.506) (-1288.853) (-1282.176) [-1279.702] * [-1280.419] (-1280.372) (-1280.541) (-1281.705) -- 0:00:56
110000 -- (-1280.482) (-1289.489) [-1282.968] (-1279.618) * (-1279.788) [-1279.286] (-1281.465) (-1283.118) -- 0:00:56
Average standard deviation of split frequencies: 0.024784
110500 -- (-1280.668) (-1290.393) [-1280.612] (-1279.214) * [-1279.592] (-1281.790) (-1281.465) (-1281.760) -- 0:00:56
111000 -- (-1280.381) (-1286.051) [-1280.290] (-1279.159) * (-1280.537) (-1284.185) [-1282.298] (-1281.608) -- 0:00:56
111500 -- (-1280.527) (-1296.257) [-1280.837] (-1279.275) * [-1281.163] (-1283.453) (-1281.448) (-1283.815) -- 0:00:55
112000 -- [-1280.544] (-1289.915) (-1280.247) (-1279.670) * [-1283.984] (-1280.992) (-1284.045) (-1283.175) -- 0:00:55
112500 -- [-1280.731] (-1289.807) (-1280.876) (-1282.838) * (-1280.422) [-1283.883] (-1285.772) (-1281.687) -- 0:00:55
113000 -- [-1282.897] (-1297.192) (-1280.737) (-1280.839) * [-1280.606] (-1284.626) (-1283.704) (-1279.683) -- 0:00:54
113500 -- [-1281.215] (-1286.497) (-1280.708) (-1281.471) * [-1279.997] (-1282.679) (-1281.125) (-1279.729) -- 0:00:54
114000 -- [-1282.621] (-1295.501) (-1283.826) (-1280.980) * (-1282.131) (-1281.209) [-1282.913] (-1281.812) -- 0:00:54
114500 -- (-1280.722) (-1289.385) (-1284.566) [-1280.160] * [-1281.649] (-1281.804) (-1282.215) (-1281.861) -- 0:00:54
115000 -- [-1280.750] (-1295.675) (-1282.519) (-1280.082) * (-1281.273) (-1282.369) (-1281.320) [-1280.851] -- 0:00:53
Average standard deviation of split frequencies: 0.026009
115500 -- (-1280.747) (-1287.573) [-1282.720] (-1279.972) * (-1281.659) [-1279.468] (-1280.784) (-1281.332) -- 0:00:53
116000 -- (-1283.159) (-1286.109) (-1279.707) [-1279.752] * (-1287.889) (-1279.939) [-1279.947] (-1280.124) -- 0:00:53
116500 -- (-1281.867) (-1288.977) (-1282.833) [-1279.502] * [-1279.986] (-1279.508) (-1280.981) (-1280.830) -- 0:01:00
117000 -- [-1281.828] (-1292.031) (-1280.177) (-1280.022) * (-1281.509) [-1280.239] (-1282.041) (-1280.162) -- 0:01:00
117500 -- (-1280.849) (-1287.647) (-1279.907) [-1281.426] * (-1280.632) (-1281.224) [-1280.475] (-1281.012) -- 0:01:00
118000 -- (-1280.833) [-1290.502] (-1279.891) (-1281.356) * (-1281.988) [-1279.861] (-1279.696) (-1281.217) -- 0:00:59
118500 -- (-1281.106) [-1290.593] (-1279.586) (-1280.096) * (-1282.373) (-1280.358) [-1281.555] (-1280.644) -- 0:00:59
119000 -- (-1280.710) [-1290.313] (-1279.583) (-1281.773) * (-1284.416) [-1279.950] (-1281.248) (-1280.126) -- 0:00:59
119500 -- [-1279.750] (-1293.436) (-1280.854) (-1285.585) * (-1281.580) [-1280.449] (-1280.531) (-1281.500) -- 0:00:58
120000 -- (-1279.837) (-1296.098) [-1281.622] (-1286.214) * (-1281.082) (-1281.436) [-1282.048] (-1280.779) -- 0:00:58
Average standard deviation of split frequencies: 0.024417
120500 -- (-1280.295) [-1288.538] (-1282.150) (-1283.765) * [-1281.802] (-1281.335) (-1286.085) (-1280.862) -- 0:00:58
121000 -- [-1279.397] (-1290.797) (-1279.600) (-1284.848) * (-1282.171) [-1285.806] (-1282.050) (-1284.481) -- 0:00:58
121500 -- (-1281.075) (-1287.330) [-1279.854] (-1283.195) * (-1281.282) (-1282.916) (-1281.140) [-1281.700] -- 0:00:57
122000 -- [-1282.737] (-1289.081) (-1280.717) (-1281.168) * [-1279.586] (-1281.859) (-1280.848) (-1283.099) -- 0:00:57
122500 -- (-1284.470) [-1286.679] (-1279.540) (-1279.594) * [-1279.747] (-1280.850) (-1280.698) (-1281.849) -- 0:00:57
123000 -- (-1281.677) [-1282.541] (-1282.485) (-1279.528) * (-1280.738) (-1282.592) [-1280.265] (-1281.776) -- 0:00:57
123500 -- (-1282.487) (-1295.295) [-1279.742] (-1279.967) * (-1281.897) [-1279.597] (-1283.410) (-1280.279) -- 0:00:56
124000 -- [-1280.224] (-1290.702) (-1280.131) (-1279.580) * [-1280.935] (-1281.903) (-1280.914) (-1281.196) -- 0:00:56
124500 -- (-1282.406) [-1291.400] (-1285.235) (-1280.855) * (-1283.958) [-1280.914] (-1279.654) (-1280.392) -- 0:00:56
125000 -- (-1279.437) [-1287.461] (-1279.753) (-1281.527) * (-1280.285) (-1280.313) [-1279.656] (-1285.774) -- 0:00:56
Average standard deviation of split frequencies: 0.019954
125500 -- (-1280.162) (-1290.208) [-1280.852] (-1280.493) * [-1279.943] (-1279.422) (-1282.006) (-1287.561) -- 0:00:55
126000 -- (-1280.237) (-1290.657) (-1280.139) [-1281.579] * [-1279.693] (-1279.497) (-1282.905) (-1287.800) -- 0:00:55
126500 -- (-1279.661) [-1292.284] (-1280.026) (-1280.460) * (-1280.822) (-1281.021) [-1282.176] (-1289.710) -- 0:00:55
127000 -- (-1280.932) (-1300.265) (-1285.348) [-1280.002] * (-1283.134) (-1281.853) (-1287.304) [-1282.163] -- 0:00:54
127500 -- (-1279.385) (-1293.944) (-1283.214) [-1281.096] * (-1282.608) (-1281.518) [-1283.456] (-1282.740) -- 0:00:54
128000 -- (-1281.113) (-1288.455) [-1284.184] (-1284.010) * (-1280.272) (-1280.904) [-1279.213] (-1281.986) -- 0:00:54
128500 -- (-1283.169) (-1290.007) [-1283.722] (-1283.405) * (-1281.743) (-1281.839) (-1281.186) [-1284.029] -- 0:00:54
129000 -- (-1282.593) (-1290.566) [-1282.972] (-1284.119) * (-1279.271) (-1281.379) (-1281.114) [-1280.379] -- 0:00:54
129500 -- [-1279.958] (-1289.109) (-1281.558) (-1283.158) * (-1280.599) (-1281.780) (-1280.948) [-1280.966] -- 0:00:53
130000 -- [-1279.905] (-1291.642) (-1283.191) (-1282.458) * (-1279.444) [-1282.919] (-1282.659) (-1279.772) -- 0:00:53
Average standard deviation of split frequencies: 0.017179
130500 -- (-1279.344) [-1295.068] (-1280.862) (-1281.267) * (-1279.589) [-1280.838] (-1280.745) (-1280.243) -- 0:00:53
131000 -- (-1279.495) (-1288.617) (-1280.464) [-1280.970] * [-1279.881] (-1283.562) (-1281.737) (-1281.007) -- 0:00:53
131500 -- (-1279.462) (-1292.638) (-1282.155) [-1280.701] * (-1281.484) (-1280.653) (-1281.937) [-1281.516] -- 0:00:52
132000 -- (-1283.260) (-1295.045) (-1279.894) [-1280.911] * (-1283.996) (-1282.132) [-1279.514] (-1281.496) -- 0:00:59
132500 -- (-1281.298) (-1290.507) [-1280.976] (-1280.562) * (-1288.442) (-1280.808) (-1281.280) [-1283.859] -- 0:00:58
133000 -- (-1281.913) (-1287.254) [-1280.317] (-1280.128) * (-1284.837) (-1282.050) (-1279.438) [-1283.359] -- 0:00:58
133500 -- (-1283.654) [-1288.181] (-1281.202) (-1283.199) * [-1282.127] (-1281.588) (-1281.909) (-1281.045) -- 0:00:58
134000 -- (-1280.597) [-1286.982] (-1281.926) (-1281.621) * [-1280.423] (-1279.678) (-1280.389) (-1281.243) -- 0:00:58
134500 -- (-1282.007) (-1283.767) [-1281.451] (-1281.820) * [-1283.819] (-1279.781) (-1280.687) (-1281.125) -- 0:00:57
135000 -- [-1282.033] (-1296.256) (-1280.544) (-1280.948) * (-1283.345) (-1279.452) (-1281.312) [-1283.943] -- 0:00:57
Average standard deviation of split frequencies: 0.018426
135500 -- (-1282.642) (-1288.740) [-1280.816] (-1283.218) * [-1283.151] (-1279.710) (-1283.076) (-1284.513) -- 0:00:57
136000 -- (-1282.818) (-1288.448) (-1280.093) [-1281.161] * (-1283.415) (-1281.816) (-1284.194) [-1283.024] -- 0:00:57
136500 -- (-1284.246) [-1287.406] (-1279.149) (-1282.034) * [-1282.566] (-1280.787) (-1280.683) (-1280.511) -- 0:00:56
137000 -- [-1280.851] (-1291.991) (-1279.686) (-1286.142) * (-1281.760) (-1280.029) [-1280.274] (-1280.064) -- 0:00:56
137500 -- (-1280.238) (-1286.537) [-1282.437] (-1287.104) * (-1282.237) [-1280.029] (-1279.597) (-1279.990) -- 0:00:56
138000 -- [-1280.240] (-1290.917) (-1282.418) (-1284.917) * [-1281.046] (-1279.188) (-1284.332) (-1281.238) -- 0:00:56
138500 -- (-1279.088) (-1288.771) [-1281.689] (-1281.733) * (-1280.907) (-1280.707) [-1278.994] (-1282.002) -- 0:00:55
139000 -- [-1280.048] (-1286.333) (-1280.926) (-1281.140) * [-1280.961] (-1282.608) (-1283.955) (-1281.390) -- 0:00:55
139500 -- (-1280.816) (-1289.929) [-1279.844] (-1283.541) * [-1281.192] (-1281.244) (-1282.963) (-1281.688) -- 0:00:55
140000 -- [-1279.194] (-1293.791) (-1282.931) (-1281.443) * [-1283.835] (-1279.761) (-1283.062) (-1280.564) -- 0:00:55
Average standard deviation of split frequencies: 0.018873
140500 -- (-1279.411) [-1286.077] (-1282.679) (-1281.595) * [-1280.683] (-1281.279) (-1284.662) (-1280.565) -- 0:00:55
141000 -- [-1279.499] (-1309.696) (-1280.290) (-1281.005) * (-1283.010) [-1279.459] (-1283.991) (-1281.087) -- 0:00:54
141500 -- (-1279.538) [-1295.087] (-1280.069) (-1281.139) * (-1282.125) (-1280.045) (-1281.090) [-1280.478] -- 0:00:54
142000 -- [-1283.271] (-1279.157) (-1279.412) (-1280.302) * (-1284.102) [-1282.349] (-1280.816) (-1281.085) -- 0:00:54
142500 -- (-1285.459) [-1279.682] (-1282.245) (-1281.389) * (-1281.291) [-1280.804] (-1280.983) (-1281.016) -- 0:00:54
143000 -- (-1282.967) (-1281.147) [-1280.286] (-1280.548) * [-1281.664] (-1281.071) (-1282.489) (-1282.668) -- 0:00:53
143500 -- (-1284.845) (-1280.140) (-1279.754) [-1281.247] * (-1280.563) (-1281.131) (-1281.879) [-1282.814] -- 0:00:53
144000 -- (-1283.349) (-1280.106) (-1284.588) [-1282.727] * (-1280.183) (-1283.660) (-1280.335) [-1282.342] -- 0:00:53
144500 -- (-1282.312) (-1282.290) (-1280.762) [-1281.059] * [-1280.065] (-1283.652) (-1279.945) (-1292.832) -- 0:00:53
145000 -- (-1283.862) [-1282.118] (-1281.448) (-1284.471) * [-1279.553] (-1281.466) (-1281.825) (-1286.211) -- 0:00:53
Average standard deviation of split frequencies: 0.019834
145500 -- (-1284.895) (-1280.042) (-1283.847) [-1279.431] * [-1279.733] (-1283.223) (-1281.089) (-1282.194) -- 0:00:52
146000 -- (-1281.819) (-1280.530) (-1280.472) [-1281.180] * (-1280.944) (-1283.856) (-1280.406) [-1281.744] -- 0:00:52
146500 -- [-1283.982] (-1286.111) (-1280.870) (-1281.397) * (-1279.559) (-1281.783) (-1280.174) [-1279.463] -- 0:00:52
147000 -- (-1281.516) (-1285.953) [-1280.810] (-1279.926) * (-1282.642) (-1282.630) (-1281.059) [-1279.777] -- 0:00:52
147500 -- (-1282.925) (-1281.547) (-1280.273) [-1279.283] * (-1283.252) (-1281.217) [-1280.164] (-1282.870) -- 0:00:52
148000 -- (-1281.726) [-1280.249] (-1286.090) (-1280.320) * (-1282.363) (-1281.771) [-1281.260] (-1289.489) -- 0:00:57
148500 -- (-1281.289) [-1280.173] (-1286.186) (-1279.230) * (-1280.073) (-1281.498) [-1280.430] (-1282.303) -- 0:00:57
149000 -- [-1280.302] (-1280.779) (-1280.964) (-1281.601) * (-1281.953) (-1281.448) [-1280.430] (-1282.573) -- 0:00:57
149500 -- (-1280.995) [-1279.343] (-1280.948) (-1282.359) * (-1282.919) (-1283.561) (-1280.171) [-1281.144] -- 0:00:56
150000 -- [-1282.074] (-1279.337) (-1279.947) (-1283.382) * (-1284.441) (-1283.755) [-1281.458] (-1283.183) -- 0:00:56
Average standard deviation of split frequencies: 0.018303
150500 -- [-1281.492] (-1281.857) (-1280.506) (-1280.245) * (-1284.759) (-1283.248) (-1280.086) [-1281.582] -- 0:00:56
151000 -- (-1280.197) (-1281.076) [-1280.164] (-1281.812) * [-1280.472] (-1283.088) (-1281.724) (-1281.028) -- 0:00:56
151500 -- (-1287.269) [-1279.684] (-1279.712) (-1280.275) * (-1288.887) (-1282.314) (-1282.207) [-1280.731] -- 0:00:56
152000 -- (-1283.390) (-1281.136) (-1282.895) [-1281.066] * [-1283.573] (-1280.279) (-1282.781) (-1283.117) -- 0:00:55
152500 -- (-1282.642) (-1286.463) [-1284.657] (-1281.862) * (-1279.777) (-1279.831) (-1280.087) [-1283.068] -- 0:00:55
153000 -- (-1282.342) (-1285.420) [-1285.362] (-1280.511) * (-1282.362) (-1288.521) (-1280.087) [-1282.812] -- 0:00:55
153500 -- (-1281.632) (-1284.841) (-1281.453) [-1280.087] * [-1281.533] (-1289.473) (-1282.035) (-1285.922) -- 0:00:55
154000 -- (-1280.356) (-1280.939) [-1281.992] (-1280.974) * (-1283.550) (-1283.305) (-1289.736) [-1280.613] -- 0:00:54
154500 -- (-1281.217) (-1281.254) [-1279.552] (-1280.840) * (-1283.792) (-1283.180) [-1290.682] (-1280.123) -- 0:00:54
155000 -- (-1280.863) (-1281.536) [-1280.809] (-1283.088) * (-1280.430) [-1280.087] (-1283.512) (-1280.241) -- 0:00:54
Average standard deviation of split frequencies: 0.018994
155500 -- (-1287.628) [-1283.034] (-1280.544) (-1281.999) * (-1280.860) (-1280.087) (-1285.869) [-1280.123] -- 0:00:54
156000 -- (-1284.078) (-1279.768) (-1282.779) [-1281.108] * (-1282.311) [-1280.087] (-1281.472) (-1279.378) -- 0:00:54
156500 -- [-1283.809] (-1279.624) (-1281.675) (-1281.494) * (-1283.036) [-1281.940] (-1279.529) (-1281.505) -- 0:00:53
157000 -- [-1283.912] (-1280.276) (-1282.344) (-1281.119) * [-1282.513] (-1282.257) (-1280.117) (-1282.498) -- 0:00:53
157500 -- (-1283.965) (-1280.939) (-1281.905) [-1281.553] * (-1281.844) [-1282.295] (-1281.190) (-1281.683) -- 0:00:53
158000 -- (-1281.022) (-1281.087) [-1281.850] (-1282.918) * [-1281.760] (-1281.729) (-1281.216) (-1281.488) -- 0:00:53
158500 -- [-1283.971] (-1280.537) (-1282.165) (-1284.283) * (-1282.907) (-1280.904) [-1280.201] (-1282.668) -- 0:00:53
159000 -- (-1280.885) [-1281.114] (-1282.385) (-1283.557) * (-1282.920) [-1281.221] (-1282.266) (-1283.008) -- 0:00:52
159500 -- (-1280.143) (-1282.758) (-1281.867) [-1283.719] * [-1282.491] (-1280.484) (-1279.733) (-1286.325) -- 0:00:52
160000 -- [-1279.657] (-1282.523) (-1285.153) (-1282.574) * (-1281.177) (-1282.207) (-1280.523) [-1286.679] -- 0:00:52
Average standard deviation of split frequencies: 0.018338
160500 -- (-1279.737) [-1281.066] (-1284.889) (-1282.888) * (-1282.195) [-1281.559] (-1286.082) (-1284.538) -- 0:00:52
161000 -- (-1282.604) [-1280.379] (-1284.391) (-1281.693) * [-1282.392] (-1280.611) (-1286.104) (-1287.654) -- 0:00:52
161500 -- (-1281.914) [-1281.387] (-1285.806) (-1281.749) * (-1280.747) (-1282.881) [-1281.089] (-1290.976) -- 0:00:51
162000 -- (-1281.128) [-1280.197] (-1284.835) (-1281.674) * [-1281.705] (-1281.342) (-1281.542) (-1284.941) -- 0:00:51
162500 -- [-1280.699] (-1282.672) (-1283.954) (-1283.452) * (-1283.976) (-1281.067) (-1279.382) [-1280.434] -- 0:00:51
163000 -- [-1279.850] (-1282.784) (-1282.070) (-1281.259) * (-1284.359) (-1281.819) (-1279.157) [-1282.381] -- 0:00:51
163500 -- (-1281.005) (-1281.673) (-1279.996) [-1282.086] * (-1284.064) (-1284.925) (-1279.252) [-1284.037] -- 0:00:51
164000 -- (-1280.680) (-1280.818) (-1279.302) [-1279.997] * (-1282.182) (-1282.226) (-1281.467) [-1281.775] -- 0:00:56
164500 -- [-1282.895] (-1279.696) (-1278.941) (-1280.235) * (-1282.378) [-1282.131] (-1279.582) (-1282.164) -- 0:00:55
165000 -- [-1282.113] (-1281.858) (-1279.841) (-1284.796) * (-1284.918) (-1280.377) (-1280.054) [-1281.187] -- 0:00:55
Average standard deviation of split frequencies: 0.017309
165500 -- (-1281.714) (-1282.074) (-1280.297) [-1281.954] * (-1282.319) (-1280.814) [-1281.525] (-1282.718) -- 0:00:55
166000 -- (-1283.008) (-1279.859) (-1279.371) [-1280.645] * (-1283.238) (-1281.703) [-1282.247] (-1287.549) -- 0:00:55
166500 -- (-1283.181) (-1280.477) [-1279.543] (-1281.239) * (-1284.048) (-1282.519) [-1283.145] (-1282.829) -- 0:00:55
167000 -- (-1282.244) [-1279.285] (-1281.793) (-1284.179) * (-1284.274) [-1287.808] (-1283.381) (-1281.296) -- 0:00:54
167500 -- [-1281.749] (-1279.260) (-1279.697) (-1284.664) * (-1287.744) (-1280.878) [-1283.797] (-1283.524) -- 0:00:54
168000 -- (-1280.649) [-1279.507] (-1280.097) (-1283.054) * (-1280.295) [-1280.852] (-1285.140) (-1281.037) -- 0:00:54
168500 -- (-1281.477) [-1279.326] (-1284.295) (-1284.444) * (-1280.884) (-1280.242) [-1279.014] (-1282.690) -- 0:00:54
169000 -- (-1280.969) (-1279.777) (-1280.838) [-1281.300] * (-1280.631) [-1281.767] (-1279.395) (-1281.203) -- 0:00:54
169500 -- [-1282.525] (-1286.557) (-1283.350) (-1283.062) * (-1280.746) (-1281.209) (-1279.441) [-1280.581] -- 0:00:53
170000 -- (-1283.192) [-1279.277] (-1281.952) (-1280.339) * (-1280.873) (-1282.359) [-1280.126] (-1282.400) -- 0:00:53
Average standard deviation of split frequencies: 0.017540
170500 -- (-1282.907) [-1280.086] (-1282.088) (-1281.805) * (-1281.712) (-1280.862) (-1280.834) [-1284.893] -- 0:00:53
171000 -- (-1283.256) [-1279.074] (-1280.176) (-1283.571) * (-1281.792) (-1279.681) [-1279.884] (-1283.965) -- 0:00:53
171500 -- (-1281.021) (-1283.825) [-1281.384] (-1279.561) * [-1281.980] (-1279.700) (-1280.356) (-1282.076) -- 0:00:53
172000 -- (-1280.344) (-1281.257) (-1280.702) [-1279.914] * [-1283.579] (-1283.635) (-1280.057) (-1281.820) -- 0:00:52
172500 -- (-1281.499) [-1280.172] (-1283.462) (-1282.037) * (-1285.403) (-1283.604) [-1281.175] (-1279.985) -- 0:00:52
173000 -- (-1280.693) (-1280.284) [-1282.047] (-1280.955) * (-1282.642) (-1282.526) [-1282.664] (-1281.473) -- 0:00:52
173500 -- (-1284.050) [-1279.945] (-1282.300) (-1282.223) * (-1281.221) [-1280.244] (-1284.974) (-1281.551) -- 0:00:52
174000 -- [-1281.906] (-1279.894) (-1285.668) (-1283.779) * (-1282.399) (-1281.284) [-1279.738] (-1280.353) -- 0:00:52
174500 -- (-1282.159) (-1280.135) [-1285.222] (-1281.310) * (-1280.864) (-1280.649) (-1279.503) [-1280.708] -- 0:00:52
175000 -- (-1284.347) (-1279.352) [-1282.243] (-1283.245) * (-1279.472) [-1282.208] (-1279.820) (-1280.788) -- 0:00:51
Average standard deviation of split frequencies: 0.017812
175500 -- (-1282.112) [-1280.292] (-1279.177) (-1283.695) * [-1280.901] (-1280.756) (-1279.839) (-1281.406) -- 0:00:51
176000 -- [-1280.890] (-1282.516) (-1279.171) (-1282.980) * (-1280.851) (-1279.847) (-1279.833) [-1281.406] -- 0:00:51
176500 -- (-1280.877) [-1281.435] (-1279.964) (-1282.065) * (-1282.323) (-1281.682) [-1282.186] (-1284.657) -- 0:00:51
177000 -- (-1280.456) (-1282.196) (-1279.951) [-1282.440] * [-1281.345] (-1281.090) (-1281.707) (-1281.298) -- 0:00:51
177500 -- (-1280.893) (-1279.524) [-1279.246] (-1283.394) * [-1289.810] (-1282.375) (-1285.409) (-1280.582) -- 0:00:50
178000 -- (-1285.167) (-1280.086) (-1279.108) [-1280.644] * (-1280.778) [-1279.950] (-1281.857) (-1283.445) -- 0:00:50
178500 -- (-1284.422) (-1280.798) (-1280.953) [-1288.868] * (-1280.043) (-1282.684) (-1280.607) [-1280.149] -- 0:00:50
179000 -- [-1281.593] (-1279.679) (-1279.168) (-1286.652) * (-1281.509) (-1280.552) (-1282.621) [-1279.797] -- 0:00:50
179500 -- (-1282.019) (-1283.191) (-1280.809) [-1283.872] * (-1282.462) (-1282.766) [-1283.219] (-1281.981) -- 0:00:54
180000 -- (-1280.922) (-1279.804) [-1280.766] (-1281.759) * (-1281.958) [-1279.406] (-1282.292) (-1283.921) -- 0:00:54
Average standard deviation of split frequencies: 0.018265
180500 -- [-1280.621] (-1279.937) (-1280.715) (-1281.514) * (-1280.503) [-1279.418] (-1280.778) (-1281.208) -- 0:00:54
181000 -- [-1281.553] (-1280.682) (-1280.960) (-1280.110) * (-1280.402) [-1279.312] (-1283.025) (-1280.664) -- 0:00:54
181500 -- (-1282.758) [-1280.749] (-1280.768) (-1281.462) * [-1280.839] (-1279.505) (-1280.248) (-1281.191) -- 0:00:54
182000 -- (-1286.295) (-1284.717) (-1281.356) [-1280.172] * (-1279.796) [-1280.700] (-1280.518) (-1281.263) -- 0:00:53
182500 -- (-1284.010) [-1284.915] (-1281.434) (-1280.910) * [-1279.212] (-1282.997) (-1281.724) (-1280.240) -- 0:00:53
183000 -- [-1279.911] (-1281.697) (-1281.602) (-1282.106) * (-1279.429) (-1282.958) (-1283.177) [-1282.799] -- 0:00:53
183500 -- (-1284.288) (-1280.206) [-1284.110] (-1284.876) * (-1279.429) (-1284.659) (-1280.342) [-1282.210] -- 0:00:53
184000 -- [-1280.530] (-1279.581) (-1281.307) (-1283.061) * [-1281.447] (-1282.514) (-1280.302) (-1284.507) -- 0:00:53
184500 -- (-1282.873) (-1282.750) (-1280.003) [-1281.761] * (-1281.193) [-1282.392] (-1281.037) (-1281.076) -- 0:00:53
185000 -- (-1281.178) [-1280.020] (-1281.820) (-1283.823) * [-1283.351] (-1284.272) (-1279.106) (-1280.399) -- 0:00:52
Average standard deviation of split frequencies: 0.017361
185500 -- (-1283.093) [-1282.677] (-1281.659) (-1286.190) * (-1280.980) (-1282.674) [-1280.835] (-1282.806) -- 0:00:52
186000 -- (-1283.614) (-1283.348) (-1282.261) [-1285.525] * [-1283.725] (-1280.955) (-1280.332) (-1283.454) -- 0:00:52
186500 -- [-1280.522] (-1282.239) (-1283.416) (-1282.234) * [-1281.425] (-1279.735) (-1280.628) (-1288.483) -- 0:00:52
187000 -- (-1284.518) [-1281.368] (-1282.784) (-1282.132) * (-1280.048) (-1280.609) [-1281.818] (-1281.719) -- 0:00:52
187500 -- (-1281.308) (-1281.286) (-1282.063) [-1281.902] * (-1280.899) (-1280.886) (-1281.657) [-1281.114] -- 0:00:52
188000 -- [-1281.647] (-1282.552) (-1279.852) (-1283.094) * [-1279.961] (-1281.406) (-1283.865) (-1282.121) -- 0:00:51
188500 -- (-1282.032) [-1280.964] (-1279.650) (-1282.200) * [-1279.298] (-1281.816) (-1281.201) (-1282.190) -- 0:00:51
189000 -- (-1283.302) (-1282.991) (-1280.626) [-1283.939] * (-1283.792) (-1283.311) (-1281.868) [-1280.707] -- 0:00:51
189500 -- [-1285.189] (-1284.409) (-1282.689) (-1283.243) * (-1283.094) (-1279.666) (-1282.810) [-1282.331] -- 0:00:51
190000 -- [-1280.367] (-1283.529) (-1282.439) (-1280.035) * (-1280.307) (-1279.813) (-1281.122) [-1279.592] -- 0:00:51
Average standard deviation of split frequencies: 0.016936
190500 -- (-1283.772) (-1285.379) [-1281.363] (-1279.804) * (-1279.843) [-1281.173] (-1281.618) (-1280.587) -- 0:00:50
191000 -- (-1283.227) (-1289.460) (-1281.025) [-1280.102] * (-1281.874) (-1281.119) (-1283.187) [-1281.471] -- 0:00:50
191500 -- [-1284.451] (-1282.387) (-1280.952) (-1281.119) * [-1280.701] (-1279.788) (-1282.763) (-1283.000) -- 0:00:50
192000 -- (-1281.705) (-1282.563) (-1280.773) [-1281.561] * (-1280.251) [-1281.499] (-1283.507) (-1281.775) -- 0:00:50
192500 -- [-1281.244] (-1282.490) (-1281.680) (-1285.950) * [-1281.455] (-1283.778) (-1281.352) (-1280.693) -- 0:00:50
193000 -- [-1281.096] (-1279.443) (-1282.834) (-1282.593) * (-1280.274) [-1283.928] (-1280.422) (-1281.367) -- 0:00:50
193500 -- [-1278.973] (-1280.092) (-1282.713) (-1282.657) * [-1280.549] (-1282.666) (-1279.400) (-1279.698) -- 0:00:50
194000 -- [-1279.213] (-1281.698) (-1280.980) (-1280.266) * (-1281.175) [-1281.907] (-1285.079) (-1283.405) -- 0:00:49
194500 -- (-1279.741) [-1281.386] (-1281.318) (-1280.266) * (-1280.141) (-1281.461) (-1285.079) [-1283.148] -- 0:00:49
195000 -- (-1281.219) (-1281.205) (-1281.233) [-1280.455] * (-1281.862) (-1280.094) (-1283.049) [-1279.695] -- 0:00:49
Average standard deviation of split frequencies: 0.016168
195500 -- (-1282.366) [-1280.731] (-1282.519) (-1279.848) * (-1281.333) (-1281.307) (-1287.024) [-1279.651] -- 0:00:53
196000 -- (-1283.646) [-1281.505] (-1279.307) (-1280.561) * (-1280.430) (-1279.857) (-1287.352) [-1280.222] -- 0:00:53
196500 -- (-1284.008) [-1280.605] (-1281.579) (-1280.374) * (-1280.699) (-1281.404) (-1281.203) [-1280.316] -- 0:00:53
197000 -- (-1284.322) [-1280.130] (-1280.212) (-1279.968) * (-1281.392) (-1283.651) (-1280.445) [-1280.244] -- 0:00:52
197500 -- (-1281.197) [-1279.728] (-1281.022) (-1280.339) * [-1279.421] (-1281.309) (-1280.938) (-1282.496) -- 0:00:52
198000 -- [-1280.732] (-1282.704) (-1280.564) (-1280.117) * (-1279.925) [-1280.724] (-1280.828) (-1280.583) -- 0:00:52
198500 -- [-1283.185] (-1281.698) (-1282.805) (-1280.570) * (-1281.439) [-1280.723] (-1281.229) (-1283.255) -- 0:00:52
199000 -- (-1282.287) (-1281.268) [-1282.754] (-1280.128) * (-1280.748) [-1287.731] (-1285.875) (-1279.858) -- 0:00:52
199500 -- (-1280.809) (-1283.994) [-1281.430] (-1281.850) * [-1281.196] (-1282.729) (-1285.521) (-1283.721) -- 0:00:52
200000 -- (-1279.429) (-1281.468) [-1281.776] (-1282.137) * (-1281.849) [-1281.493] (-1281.277) (-1281.712) -- 0:00:51
Average standard deviation of split frequencies: 0.015975
200500 -- (-1279.266) [-1281.468] (-1283.239) (-1280.473) * [-1282.269] (-1283.418) (-1281.917) (-1287.570) -- 0:00:51
201000 -- (-1282.845) (-1284.884) [-1280.100] (-1281.118) * (-1287.912) (-1281.611) [-1282.834] (-1281.977) -- 0:00:51
201500 -- (-1283.382) (-1284.770) [-1285.131] (-1281.084) * (-1287.443) (-1287.361) (-1280.962) [-1286.860] -- 0:00:51
202000 -- [-1283.007] (-1282.958) (-1281.248) (-1281.364) * (-1285.125) (-1284.101) (-1280.446) [-1281.044] -- 0:00:51
202500 -- (-1280.653) [-1280.902] (-1283.630) (-1283.961) * (-1284.646) [-1282.514] (-1280.487) (-1281.484) -- 0:00:51
203000 -- (-1281.326) (-1282.343) (-1283.258) [-1280.000] * (-1283.610) (-1279.259) (-1280.280) [-1281.746] -- 0:00:51
203500 -- [-1281.229] (-1280.468) (-1284.268) (-1280.336) * (-1281.109) (-1281.561) (-1280.367) [-1282.589] -- 0:00:50
204000 -- (-1280.102) [-1280.243] (-1279.821) (-1280.214) * (-1280.193) (-1283.443) [-1279.888] (-1282.452) -- 0:00:50
204500 -- (-1280.015) (-1280.945) [-1281.849] (-1282.388) * (-1280.406) [-1283.609] (-1280.280) (-1283.080) -- 0:00:50
205000 -- (-1279.664) [-1280.223] (-1284.984) (-1280.139) * [-1282.337] (-1284.144) (-1280.068) (-1281.735) -- 0:00:50
Average standard deviation of split frequencies: 0.016133
205500 -- (-1287.251) (-1279.729) [-1281.093] (-1279.675) * (-1282.720) (-1282.539) (-1282.154) [-1281.383] -- 0:00:50
206000 -- (-1284.549) [-1280.173] (-1282.119) (-1281.085) * (-1280.480) (-1283.750) [-1280.873] (-1280.968) -- 0:00:50
206500 -- (-1279.450) (-1280.372) (-1282.086) [-1280.734] * (-1280.955) (-1279.921) (-1281.951) [-1280.674] -- 0:00:49
207000 -- (-1283.584) (-1280.006) [-1281.357] (-1281.021) * (-1280.204) (-1280.335) (-1280.070) [-1282.260] -- 0:00:49
207500 -- (-1284.374) (-1281.214) [-1280.412] (-1282.637) * [-1281.161] (-1282.937) (-1280.033) (-1279.812) -- 0:00:49
208000 -- (-1282.399) [-1279.794] (-1280.909) (-1282.074) * [-1281.651] (-1282.659) (-1281.719) (-1279.726) -- 0:00:49
208500 -- (-1282.326) [-1279.508] (-1280.169) (-1283.714) * (-1282.174) [-1281.014] (-1286.336) (-1282.546) -- 0:00:49
209000 -- (-1279.238) (-1279.451) [-1281.631] (-1285.258) * (-1283.360) (-1279.288) [-1280.712] (-1285.441) -- 0:00:49
209500 -- (-1283.413) (-1279.881) [-1281.629] (-1280.600) * (-1281.431) (-1279.571) (-1280.729) [-1281.354] -- 0:00:49
210000 -- (-1280.207) (-1281.454) (-1285.900) [-1281.029] * (-1280.794) [-1279.664] (-1281.106) (-1281.893) -- 0:00:48
Average standard deviation of split frequencies: 0.016447
210500 -- (-1280.732) (-1281.809) (-1281.317) [-1280.437] * (-1281.563) [-1279.621] (-1279.292) (-1280.148) -- 0:00:48
211000 -- (-1281.291) (-1281.590) [-1279.654] (-1279.931) * (-1281.084) (-1279.421) [-1280.638] (-1279.728) -- 0:00:48
211500 -- (-1281.189) [-1281.390] (-1283.034) (-1279.686) * (-1280.937) (-1280.539) [-1281.011] (-1283.036) -- 0:00:52
212000 -- [-1283.735] (-1281.529) (-1281.493) (-1280.381) * [-1281.247] (-1287.126) (-1280.650) (-1279.094) -- 0:00:52
212500 -- (-1283.046) [-1281.822] (-1280.720) (-1281.621) * (-1283.641) (-1281.815) [-1280.595] (-1280.203) -- 0:00:51
213000 -- (-1280.076) (-1280.033) (-1280.062) [-1280.328] * (-1281.496) (-1282.520) [-1280.877] (-1281.321) -- 0:00:51
213500 -- [-1279.373] (-1279.888) (-1279.204) (-1280.284) * (-1283.823) [-1280.939] (-1281.144) (-1281.231) -- 0:00:51
214000 -- (-1279.484) [-1280.190] (-1279.468) (-1283.580) * (-1284.927) (-1279.209) (-1279.958) [-1282.093] -- 0:00:51
214500 -- (-1279.666) (-1280.799) [-1281.168] (-1283.931) * (-1287.149) (-1281.961) [-1279.316] (-1284.206) -- 0:00:51
215000 -- (-1283.072) (-1279.449) [-1281.618] (-1281.060) * (-1284.910) (-1283.334) [-1280.795] (-1282.799) -- 0:00:51
Average standard deviation of split frequencies: 0.015713
215500 -- (-1279.274) (-1282.598) (-1279.243) [-1283.000] * (-1280.817) [-1281.565] (-1280.260) (-1279.807) -- 0:00:50
216000 -- (-1280.417) (-1280.946) [-1279.384] (-1282.644) * (-1281.536) (-1284.619) (-1282.434) [-1279.763] -- 0:00:50
216500 -- (-1285.801) (-1280.592) (-1279.622) [-1281.974] * (-1280.349) (-1280.589) [-1282.018] (-1279.693) -- 0:00:50
217000 -- [-1283.460] (-1287.628) (-1281.388) (-1281.902) * [-1282.859] (-1283.785) (-1284.723) (-1279.704) -- 0:00:50
217500 -- (-1284.449) (-1281.291) [-1279.119] (-1283.157) * (-1281.112) (-1286.247) (-1281.997) [-1282.532] -- 0:00:50
218000 -- [-1284.549] (-1281.839) (-1286.685) (-1283.552) * [-1281.642] (-1280.205) (-1280.269) (-1283.456) -- 0:00:50
218500 -- (-1282.978) (-1286.808) (-1281.742) [-1279.936] * (-1287.293) [-1280.515] (-1281.121) (-1281.050) -- 0:00:50
219000 -- [-1280.976] (-1292.764) (-1283.692) (-1282.135) * (-1281.952) (-1282.641) (-1282.952) [-1280.045] -- 0:00:49
219500 -- (-1281.231) (-1285.226) (-1283.162) [-1282.091] * (-1282.133) (-1283.578) [-1280.077] (-1281.182) -- 0:00:49
220000 -- (-1280.456) (-1282.166) (-1283.367) [-1281.039] * (-1281.525) (-1281.054) [-1281.936] (-1280.947) -- 0:00:49
Average standard deviation of split frequencies: 0.015629
220500 -- (-1284.975) [-1280.996] (-1284.992) (-1281.528) * (-1282.263) (-1280.527) (-1281.177) [-1280.875] -- 0:00:49
221000 -- (-1282.628) [-1281.566] (-1283.053) (-1281.505) * (-1281.982) [-1282.860] (-1281.950) (-1280.946) -- 0:00:49
221500 -- (-1284.798) (-1280.528) [-1280.540] (-1281.453) * (-1280.123) (-1280.543) [-1281.740] (-1282.514) -- 0:00:49
222000 -- (-1281.169) (-1282.654) [-1281.206] (-1281.911) * [-1280.806] (-1280.413) (-1279.454) (-1280.122) -- 0:00:49
222500 -- [-1281.413] (-1283.277) (-1280.087) (-1281.645) * (-1281.176) (-1281.692) (-1282.035) [-1280.088] -- 0:00:48
223000 -- (-1281.518) (-1280.047) [-1280.852] (-1280.277) * (-1287.668) (-1281.514) [-1282.233] (-1280.299) -- 0:00:48
223500 -- (-1281.367) [-1280.176] (-1280.719) (-1280.263) * (-1282.885) [-1281.566] (-1281.149) (-1280.243) -- 0:00:48
224000 -- (-1280.681) [-1280.936] (-1281.481) (-1281.127) * (-1279.960) (-1279.827) [-1281.290] (-1280.261) -- 0:00:48
224500 -- [-1282.530] (-1279.855) (-1280.400) (-1281.708) * (-1281.536) [-1281.776] (-1282.589) (-1280.667) -- 0:00:48
225000 -- (-1283.820) (-1282.715) (-1280.411) [-1283.269] * (-1284.718) (-1287.398) [-1280.402] (-1281.355) -- 0:00:48
Average standard deviation of split frequencies: 0.015331
225500 -- (-1282.947) (-1280.324) (-1281.547) [-1281.291] * [-1280.973] (-1282.777) (-1280.046) (-1281.462) -- 0:00:48
226000 -- [-1284.516] (-1284.582) (-1283.820) (-1281.466) * (-1279.617) (-1284.534) [-1280.838] (-1284.363) -- 0:00:47
226500 -- (-1282.356) (-1282.218) [-1281.426] (-1280.282) * (-1280.785) (-1281.661) (-1280.318) [-1279.428] -- 0:00:47
227000 -- (-1280.325) (-1281.693) [-1286.736] (-1279.778) * (-1280.971) [-1283.386] (-1279.688) (-1280.730) -- 0:00:47
227500 -- (-1282.181) (-1281.007) [-1282.230] (-1282.648) * (-1281.403) (-1283.121) [-1280.243] (-1279.237) -- 0:00:50
228000 -- (-1281.833) [-1283.664] (-1282.797) (-1284.451) * (-1281.822) [-1281.147] (-1280.243) (-1280.630) -- 0:00:50
228500 -- (-1282.115) [-1283.141] (-1281.421) (-1283.178) * (-1282.888) (-1282.967) (-1280.825) [-1281.563] -- 0:00:50
229000 -- [-1281.250] (-1280.168) (-1282.333) (-1281.349) * (-1282.707) (-1280.983) (-1282.397) [-1283.196] -- 0:00:50
229500 -- (-1282.857) [-1280.684] (-1280.741) (-1280.934) * (-1281.989) [-1281.563] (-1280.637) (-1283.025) -- 0:00:50
230000 -- (-1284.240) (-1281.249) (-1282.169) [-1280.990] * [-1280.000] (-1282.225) (-1280.077) (-1281.111) -- 0:00:50
Average standard deviation of split frequencies: 0.016564
230500 -- (-1283.234) (-1279.845) [-1282.395] (-1281.913) * (-1284.149) (-1280.548) [-1279.377] (-1283.555) -- 0:00:50
231000 -- [-1282.933] (-1280.783) (-1280.977) (-1284.730) * (-1283.272) (-1280.358) [-1279.397] (-1285.916) -- 0:00:49
231500 -- (-1285.915) (-1280.036) (-1281.521) [-1281.518] * (-1280.714) (-1281.225) (-1280.399) [-1285.507] -- 0:00:49
232000 -- (-1284.575) (-1281.453) (-1281.637) [-1282.854] * (-1279.676) (-1283.354) [-1282.114] (-1286.907) -- 0:00:49
232500 -- (-1284.496) (-1281.655) [-1281.744] (-1281.992) * (-1280.528) [-1279.976] (-1284.639) (-1283.356) -- 0:00:49
233000 -- (-1282.897) (-1283.785) (-1280.399) [-1283.250] * (-1280.547) [-1280.716] (-1279.929) (-1281.432) -- 0:00:49
233500 -- (-1282.761) [-1284.157] (-1280.469) (-1282.358) * (-1281.996) (-1280.066) (-1279.638) [-1283.843] -- 0:00:49
234000 -- (-1280.684) (-1280.152) [-1280.336] (-1285.024) * (-1280.217) (-1280.951) (-1280.732) [-1283.136] -- 0:00:49
234500 -- [-1280.265] (-1281.325) (-1279.754) (-1285.461) * (-1281.779) [-1282.515] (-1283.310) (-1282.802) -- 0:00:48
235000 -- (-1279.540) [-1282.211] (-1280.721) (-1284.082) * [-1282.408] (-1279.866) (-1280.094) (-1283.014) -- 0:00:48
Average standard deviation of split frequencies: 0.017533
235500 -- (-1281.710) [-1280.723] (-1279.716) (-1279.713) * (-1282.078) (-1280.211) (-1281.346) [-1282.034] -- 0:00:48
236000 -- (-1279.894) (-1283.225) [-1279.927] (-1280.166) * (-1282.200) (-1280.761) [-1284.554] (-1280.995) -- 0:00:48
236500 -- (-1280.244) (-1283.059) [-1279.713] (-1279.993) * [-1279.694] (-1283.277) (-1280.024) (-1280.930) -- 0:00:48
237000 -- (-1283.294) (-1281.999) [-1280.746] (-1279.993) * (-1282.552) (-1282.502) [-1284.167] (-1280.571) -- 0:00:48
237500 -- (-1282.029) (-1283.336) [-1280.236] (-1282.541) * (-1280.829) [-1281.751] (-1284.580) (-1281.344) -- 0:00:48
238000 -- (-1280.994) [-1281.408] (-1281.563) (-1280.966) * (-1279.886) (-1282.978) (-1280.702) [-1283.512] -- 0:00:48
238500 -- [-1280.051] (-1280.031) (-1287.486) (-1279.412) * [-1279.782] (-1283.313) (-1281.733) (-1283.853) -- 0:00:47
239000 -- (-1288.618) (-1280.620) (-1283.101) [-1281.207] * [-1280.212] (-1286.134) (-1282.334) (-1284.498) -- 0:00:47
239500 -- (-1280.449) (-1280.418) (-1282.081) [-1281.163] * (-1280.913) [-1281.552] (-1282.035) (-1280.718) -- 0:00:47
240000 -- (-1280.398) (-1281.210) [-1284.307] (-1284.640) * (-1283.379) (-1282.355) [-1279.814] (-1281.198) -- 0:00:47
Average standard deviation of split frequencies: 0.019152
240500 -- (-1281.430) (-1283.969) [-1285.126] (-1279.540) * (-1280.764) (-1280.800) (-1280.390) [-1280.375] -- 0:00:47
241000 -- (-1286.842) (-1282.979) [-1282.704] (-1284.130) * [-1280.538] (-1280.400) (-1281.479) (-1279.742) -- 0:00:47
241500 -- (-1282.388) (-1286.268) [-1283.158] (-1279.998) * (-1281.202) (-1280.885) [-1281.204] (-1279.952) -- 0:00:47
242000 -- (-1279.625) [-1282.755] (-1281.570) (-1282.259) * [-1279.906] (-1280.106) (-1282.297) (-1281.094) -- 0:00:46
242500 -- [-1279.626] (-1285.836) (-1281.041) (-1282.158) * (-1281.003) [-1280.398] (-1282.032) (-1279.511) -- 0:00:46
243000 -- (-1282.460) (-1284.460) (-1280.807) [-1279.363] * (-1280.847) (-1284.756) [-1281.000] (-1280.397) -- 0:00:46
243500 -- (-1282.407) (-1283.199) [-1280.140] (-1281.222) * (-1283.366) [-1280.616] (-1282.248) (-1282.259) -- 0:00:49
244000 -- (-1284.852) (-1280.760) (-1284.003) [-1280.611] * (-1282.266) [-1283.524] (-1282.803) (-1281.845) -- 0:00:49
244500 -- (-1282.080) (-1282.817) (-1282.732) [-1280.298] * (-1282.728) [-1279.863] (-1282.153) (-1282.323) -- 0:00:49
245000 -- (-1283.459) (-1284.396) [-1280.011] (-1281.835) * (-1281.086) (-1284.568) (-1282.220) [-1280.579] -- 0:00:49
Average standard deviation of split frequencies: 0.017459
245500 -- [-1284.699] (-1283.801) (-1280.026) (-1282.630) * (-1280.700) (-1280.287) [-1282.830] (-1280.450) -- 0:00:49
246000 -- (-1282.718) [-1280.026] (-1280.017) (-1281.062) * (-1279.811) [-1280.824] (-1282.631) (-1279.791) -- 0:00:49
246500 -- (-1281.436) (-1283.316) (-1286.680) [-1281.495] * (-1280.567) (-1281.162) (-1281.208) [-1280.032] -- 0:00:48
247000 -- (-1281.459) (-1283.640) (-1282.140) [-1281.456] * (-1287.073) (-1280.718) [-1281.212] (-1280.165) -- 0:00:48
247500 -- (-1283.134) (-1286.483) [-1282.920] (-1284.075) * (-1280.945) (-1281.335) (-1281.514) [-1280.237] -- 0:00:48
248000 -- (-1280.136) (-1281.195) (-1281.412) [-1279.843] * (-1280.616) [-1282.729] (-1280.300) (-1280.313) -- 0:00:48
248500 -- (-1280.784) (-1281.192) (-1280.885) [-1279.791] * (-1283.282) (-1279.809) [-1279.221] (-1281.528) -- 0:00:48
249000 -- (-1279.864) [-1281.119] (-1284.236) (-1281.859) * (-1283.761) (-1284.041) [-1279.487] (-1281.525) -- 0:00:48
249500 -- (-1280.206) (-1283.156) [-1281.455] (-1279.460) * (-1283.067) (-1283.358) (-1279.807) [-1283.984] -- 0:00:48
250000 -- (-1284.366) (-1282.740) [-1281.608] (-1284.366) * (-1282.248) (-1283.590) [-1280.079] (-1281.869) -- 0:00:48
Average standard deviation of split frequencies: 0.017343
250500 -- [-1280.328] (-1286.031) (-1281.768) (-1283.521) * (-1279.416) (-1281.449) [-1280.159] (-1281.938) -- 0:00:47
251000 -- (-1284.205) (-1279.403) (-1279.642) [-1284.657] * (-1280.092) [-1279.735] (-1279.485) (-1283.403) -- 0:00:47
251500 -- (-1282.587) [-1280.328] (-1280.731) (-1279.522) * (-1280.722) (-1282.242) [-1281.294] (-1282.056) -- 0:00:47
252000 -- (-1282.171) (-1281.418) (-1281.504) [-1281.453] * [-1281.155] (-1283.181) (-1283.281) (-1282.532) -- 0:00:47
252500 -- [-1281.936] (-1282.236) (-1280.516) (-1282.640) * (-1283.673) [-1283.402] (-1280.049) (-1283.657) -- 0:00:47
253000 -- (-1279.935) [-1283.135] (-1280.522) (-1284.104) * (-1284.991) (-1283.317) (-1281.525) [-1281.852] -- 0:00:47
253500 -- (-1279.763) (-1280.354) [-1281.693] (-1284.411) * (-1282.170) (-1281.030) [-1280.966] (-1282.164) -- 0:00:47
254000 -- (-1280.860) [-1280.987] (-1280.617) (-1283.259) * (-1280.716) (-1281.868) (-1280.546) [-1282.602] -- 0:00:46
254500 -- (-1280.626) (-1280.292) [-1281.305] (-1281.393) * (-1283.173) (-1281.799) [-1281.453] (-1282.864) -- 0:00:46
255000 -- (-1279.816) (-1282.011) [-1280.745] (-1280.009) * (-1282.890) (-1281.746) [-1282.683] (-1280.921) -- 0:00:46
Average standard deviation of split frequencies: 0.015959
255500 -- [-1281.194] (-1281.311) (-1281.496) (-1281.437) * (-1282.461) (-1280.313) [-1281.098] (-1280.026) -- 0:00:46
256000 -- (-1283.315) (-1283.973) (-1282.007) [-1280.133] * (-1282.284) (-1283.721) (-1280.538) [-1280.155] -- 0:00:46
256500 -- [-1283.464] (-1283.135) (-1285.463) (-1280.135) * [-1281.999] (-1283.461) (-1279.491) (-1279.643) -- 0:00:46
257000 -- (-1282.400) (-1282.936) (-1283.529) [-1279.103] * (-1282.329) (-1284.448) [-1279.772] (-1282.442) -- 0:00:46
257500 -- (-1280.306) (-1287.134) [-1281.679] (-1279.497) * (-1280.396) (-1284.908) [-1279.170] (-1281.742) -- 0:00:46
258000 -- (-1281.370) (-1283.980) (-1280.197) [-1280.914] * (-1281.797) (-1280.008) [-1279.426] (-1281.033) -- 0:00:46
258500 -- (-1281.023) (-1280.534) (-1282.764) [-1280.260] * (-1279.606) [-1279.823] (-1281.457) (-1280.088) -- 0:00:45
259000 -- (-1281.231) (-1281.218) (-1283.298) [-1281.230] * (-1280.138) [-1279.758] (-1280.905) (-1280.044) -- 0:00:45
259500 -- (-1280.705) (-1280.200) [-1282.265] (-1282.202) * (-1282.639) (-1280.936) [-1280.419] (-1280.220) -- 0:00:48
260000 -- [-1279.500] (-1281.005) (-1280.762) (-1281.320) * [-1283.537] (-1280.183) (-1280.423) (-1281.527) -- 0:00:48
Average standard deviation of split frequencies: 0.015271
260500 -- (-1280.479) (-1280.960) [-1280.573] (-1280.757) * (-1283.507) [-1282.233] (-1281.026) (-1285.908) -- 0:00:48
261000 -- (-1282.445) (-1280.195) [-1281.512] (-1283.601) * (-1282.406) (-1282.619) (-1281.052) [-1280.357] -- 0:00:48
261500 -- (-1281.347) (-1281.041) (-1281.195) [-1282.001] * (-1285.430) (-1280.819) [-1281.191] (-1280.700) -- 0:00:48
262000 -- (-1281.602) (-1283.060) (-1281.034) [-1282.551] * (-1281.586) [-1279.443] (-1289.281) (-1280.413) -- 0:00:47
262500 -- (-1279.382) (-1282.619) (-1281.171) [-1280.527] * (-1284.538) [-1281.350] (-1289.205) (-1283.003) -- 0:00:47
263000 -- [-1279.899] (-1282.431) (-1282.307) (-1280.751) * [-1281.430] (-1283.503) (-1283.360) (-1283.355) -- 0:00:47
263500 -- (-1280.734) [-1284.178] (-1280.844) (-1282.051) * (-1286.335) (-1282.150) (-1280.844) [-1282.556] -- 0:00:47
264000 -- (-1280.918) (-1279.643) [-1279.810] (-1287.091) * (-1280.340) [-1280.687] (-1280.293) (-1283.224) -- 0:00:47
264500 -- (-1282.755) [-1279.593] (-1280.178) (-1284.850) * (-1279.744) [-1281.233] (-1279.720) (-1280.327) -- 0:00:47
265000 -- (-1282.242) (-1280.578) [-1279.775] (-1284.772) * [-1280.162] (-1281.302) (-1280.932) (-1280.274) -- 0:00:47
Average standard deviation of split frequencies: 0.015064
265500 -- (-1281.777) (-1286.565) (-1279.609) [-1281.157] * (-1281.395) [-1281.179] (-1281.514) (-1279.965) -- 0:00:47
266000 -- (-1284.627) (-1280.151) (-1279.658) [-1281.282] * (-1281.639) (-1284.501) [-1280.476] (-1280.136) -- 0:00:46
266500 -- (-1281.062) [-1280.234] (-1281.066) (-1280.894) * [-1285.592] (-1281.827) (-1279.831) (-1282.523) -- 0:00:46
267000 -- [-1281.488] (-1279.987) (-1282.982) (-1280.864) * [-1280.569] (-1283.196) (-1279.759) (-1279.639) -- 0:00:46
267500 -- (-1282.855) [-1280.483] (-1281.879) (-1280.478) * (-1284.018) [-1280.957] (-1280.884) (-1282.115) -- 0:00:46
268000 -- (-1280.863) (-1286.867) [-1279.889] (-1282.682) * (-1280.244) (-1280.757) (-1281.006) [-1282.161] -- 0:00:46
268500 -- (-1280.118) (-1281.436) [-1280.114] (-1279.394) * (-1281.609) [-1280.928] (-1280.390) (-1280.643) -- 0:00:46
269000 -- (-1279.914) (-1283.001) (-1283.336) [-1280.412] * (-1280.053) (-1280.170) (-1280.762) [-1280.954] -- 0:00:46
269500 -- (-1279.977) (-1280.291) (-1282.600) [-1281.372] * [-1279.850] (-1282.045) (-1282.137) (-1282.515) -- 0:00:46
270000 -- (-1281.770) (-1280.635) (-1281.120) [-1279.424] * (-1280.625) (-1283.773) (-1290.803) [-1285.596] -- 0:00:45
Average standard deviation of split frequencies: 0.014707
270500 -- (-1280.419) (-1280.055) (-1281.505) [-1279.618] * (-1280.114) (-1281.065) [-1279.937] (-1281.262) -- 0:00:45
271000 -- (-1279.942) (-1281.766) (-1281.464) [-1279.638] * (-1280.081) (-1283.442) [-1279.091] (-1281.979) -- 0:00:45
271500 -- (-1279.052) [-1280.264] (-1279.515) (-1280.696) * (-1283.465) [-1284.467] (-1280.217) (-1280.124) -- 0:00:45
272000 -- (-1279.433) (-1280.173) (-1279.339) [-1279.590] * (-1281.255) [-1281.642] (-1280.615) (-1279.170) -- 0:00:45
272500 -- (-1284.725) (-1280.074) [-1279.686] (-1285.433) * (-1281.996) (-1282.135) (-1280.837) [-1279.966] -- 0:00:45
273000 -- (-1279.808) [-1280.730] (-1279.848) (-1281.645) * (-1281.996) [-1279.958] (-1285.242) (-1279.990) -- 0:00:45
273500 -- [-1279.593] (-1280.574) (-1279.760) (-1279.919) * [-1279.682] (-1280.509) (-1280.689) (-1280.831) -- 0:00:45
274000 -- (-1282.204) (-1280.720) (-1281.157) [-1280.205] * (-1279.705) [-1280.894] (-1279.616) (-1283.016) -- 0:00:45
274500 -- (-1280.928) (-1280.757) (-1282.135) [-1281.671] * [-1279.705] (-1280.380) (-1282.654) (-1281.741) -- 0:00:44
275000 -- (-1280.056) (-1282.377) (-1282.547) [-1280.213] * (-1282.024) (-1281.844) [-1280.516] (-1281.558) -- 0:00:44
Average standard deviation of split frequencies: 0.014613
275500 -- [-1281.560] (-1282.466) (-1285.019) (-1282.736) * (-1281.663) (-1279.773) [-1280.397] (-1281.375) -- 0:00:47
276000 -- (-1280.769) (-1280.738) [-1285.019] (-1280.633) * (-1282.251) [-1279.113] (-1279.938) (-1281.141) -- 0:00:47
276500 -- (-1281.929) (-1283.341) (-1283.179) [-1281.386] * [-1283.221] (-1279.224) (-1280.548) (-1279.595) -- 0:00:47
277000 -- [-1279.489] (-1281.835) (-1282.944) (-1284.084) * (-1284.086) (-1279.215) [-1280.122] (-1282.811) -- 0:00:46
277500 -- (-1280.711) (-1281.822) [-1279.398] (-1280.429) * (-1285.187) (-1282.811) [-1279.542] (-1283.486) -- 0:00:46
278000 -- [-1282.608] (-1281.481) (-1279.056) (-1282.621) * [-1283.008] (-1283.208) (-1280.916) (-1281.719) -- 0:00:46
278500 -- (-1285.152) [-1281.678] (-1279.971) (-1280.397) * (-1282.484) (-1282.094) [-1279.889] (-1280.635) -- 0:00:46
279000 -- [-1280.716] (-1282.406) (-1280.464) (-1281.340) * (-1281.531) (-1280.626) [-1280.126] (-1281.658) -- 0:00:46
279500 -- (-1280.113) [-1282.004] (-1280.261) (-1280.486) * (-1283.968) (-1282.872) (-1281.850) [-1281.011] -- 0:00:46
280000 -- (-1279.868) [-1286.937] (-1281.142) (-1280.110) * (-1281.732) [-1283.983] (-1284.224) (-1281.094) -- 0:00:46
Average standard deviation of split frequencies: 0.016049
280500 -- (-1280.641) (-1282.408) [-1280.963] (-1282.363) * (-1281.325) [-1280.422] (-1288.049) (-1282.940) -- 0:00:46
281000 -- [-1282.041] (-1285.115) (-1279.473) (-1280.214) * (-1281.251) (-1282.053) [-1285.954] (-1283.437) -- 0:00:46
281500 -- (-1283.982) (-1285.848) (-1279.921) [-1280.393] * [-1282.217] (-1280.029) (-1283.309) (-1279.111) -- 0:00:45
282000 -- (-1280.420) (-1288.495) (-1279.704) [-1280.276] * (-1282.355) [-1280.411] (-1283.397) (-1282.920) -- 0:00:45
282500 -- [-1281.649] (-1286.275) (-1279.703) (-1282.545) * (-1282.179) (-1282.197) (-1279.864) [-1283.864] -- 0:00:45
283000 -- (-1281.601) (-1287.379) [-1283.199] (-1282.568) * (-1281.088) (-1284.756) (-1279.345) [-1285.637] -- 0:00:45
283500 -- (-1282.138) (-1287.336) (-1279.927) [-1284.113] * [-1283.992] (-1282.690) (-1285.193) (-1281.055) -- 0:00:45
284000 -- [-1281.155] (-1283.921) (-1281.032) (-1284.121) * (-1279.402) [-1280.305] (-1285.461) (-1281.326) -- 0:00:45
284500 -- (-1281.397) (-1286.020) (-1279.640) [-1283.864] * (-1280.909) (-1281.891) [-1282.587] (-1283.754) -- 0:00:45
285000 -- [-1279.966] (-1281.321) (-1280.546) (-1283.964) * (-1280.874) [-1281.037] (-1281.515) (-1283.193) -- 0:00:45
Average standard deviation of split frequencies: 0.016391
285500 -- (-1284.409) (-1281.278) (-1281.718) [-1279.857] * [-1280.388] (-1280.133) (-1282.752) (-1285.100) -- 0:00:45
286000 -- (-1283.099) (-1283.047) [-1282.215] (-1281.283) * (-1282.520) (-1280.978) (-1279.576) [-1282.021] -- 0:00:44
286500 -- (-1283.907) (-1286.617) [-1283.400] (-1283.218) * [-1282.940] (-1281.837) (-1279.968) (-1280.257) -- 0:00:44
287000 -- (-1281.796) [-1283.402] (-1283.816) (-1281.901) * [-1282.781] (-1282.117) (-1281.319) (-1280.004) -- 0:00:44
287500 -- [-1280.822] (-1284.828) (-1283.617) (-1282.171) * (-1284.178) (-1281.866) [-1284.211] (-1283.499) -- 0:00:44
288000 -- [-1279.881] (-1281.989) (-1284.472) (-1281.826) * (-1281.639) [-1280.526] (-1283.529) (-1283.515) -- 0:00:44
288500 -- (-1280.326) [-1283.943] (-1284.933) (-1283.104) * [-1281.036] (-1282.906) (-1282.279) (-1282.246) -- 0:00:44
289000 -- (-1281.945) [-1282.221] (-1281.344) (-1281.903) * (-1282.837) (-1281.804) [-1281.231] (-1281.060) -- 0:00:44
289500 -- (-1282.436) (-1281.593) [-1284.348] (-1284.824) * (-1283.076) (-1280.482) (-1281.755) [-1280.415] -- 0:00:44
290000 -- (-1281.538) [-1281.592] (-1281.340) (-1284.860) * (-1280.519) (-1280.760) [-1281.484] (-1280.369) -- 0:00:44
Average standard deviation of split frequencies: 0.017157
290500 -- (-1280.288) [-1280.178] (-1281.338) (-1286.315) * (-1281.793) (-1280.624) (-1280.496) [-1280.774] -- 0:00:43
291000 -- (-1279.847) (-1281.628) [-1280.221] (-1281.617) * [-1279.281] (-1280.741) (-1282.968) (-1279.900) -- 0:00:43
291500 -- [-1282.896] (-1280.233) (-1280.184) (-1281.427) * (-1281.195) (-1280.077) [-1281.735] (-1279.465) -- 0:00:46
292000 -- (-1282.854) (-1279.944) [-1282.147] (-1282.754) * (-1282.455) [-1283.248] (-1280.095) (-1279.490) -- 0:00:46
292500 -- [-1286.762] (-1280.892) (-1281.300) (-1283.211) * (-1282.041) (-1281.913) [-1280.658] (-1280.017) -- 0:00:45
293000 -- (-1285.308) (-1281.364) [-1282.112] (-1283.574) * (-1289.495) (-1283.527) (-1280.187) [-1280.066] -- 0:00:45
293500 -- (-1282.818) (-1281.381) (-1281.417) [-1281.469] * (-1282.254) [-1280.429] (-1281.180) (-1280.027) -- 0:00:45
294000 -- (-1284.408) (-1280.291) (-1281.319) [-1280.285] * (-1284.770) (-1280.868) (-1281.045) [-1280.321] -- 0:00:45
294500 -- (-1281.556) [-1280.108] (-1281.961) (-1281.039) * (-1283.034) (-1279.811) (-1279.652) [-1283.179] -- 0:00:45
295000 -- (-1281.159) (-1283.030) (-1279.864) [-1281.480] * (-1282.660) (-1281.353) (-1279.797) [-1282.044] -- 0:00:45
Average standard deviation of split frequencies: 0.015423
295500 -- (-1281.149) (-1280.484) (-1282.489) [-1280.372] * (-1282.802) [-1283.086] (-1280.261) (-1283.595) -- 0:00:45
296000 -- [-1281.505] (-1280.468) (-1280.981) (-1286.152) * (-1287.833) (-1281.591) (-1281.967) [-1279.765] -- 0:00:45
296500 -- [-1282.924] (-1279.911) (-1281.140) (-1282.847) * [-1281.380] (-1285.089) (-1280.591) (-1280.246) -- 0:00:45
297000 -- (-1282.900) (-1281.096) (-1283.891) [-1282.464] * (-1281.036) [-1283.483] (-1281.907) (-1281.694) -- 0:00:44
297500 -- (-1281.386) (-1279.673) [-1282.274] (-1281.887) * [-1283.747] (-1280.894) (-1280.530) (-1282.098) -- 0:00:44
298000 -- [-1280.216] (-1283.116) (-1281.142) (-1281.051) * (-1283.995) [-1279.629] (-1279.500) (-1279.842) -- 0:00:44
298500 -- (-1279.894) (-1282.638) (-1279.598) [-1282.386] * (-1281.381) (-1280.113) [-1279.497] (-1280.237) -- 0:00:44
299000 -- (-1282.495) (-1282.911) [-1279.985] (-1281.220) * [-1281.221] (-1280.707) (-1280.968) (-1280.730) -- 0:00:44
299500 -- (-1281.064) (-1282.587) (-1280.416) [-1281.463] * (-1282.323) (-1280.829) [-1279.161] (-1280.711) -- 0:00:44
300000 -- (-1281.055) (-1283.873) (-1284.279) [-1280.563] * (-1283.109) (-1284.488) (-1282.232) [-1283.008] -- 0:00:44
Average standard deviation of split frequencies: 0.015596
300500 -- [-1281.506] (-1283.703) (-1285.003) (-1282.122) * [-1281.758] (-1282.135) (-1279.379) (-1283.501) -- 0:00:44
301000 -- (-1281.762) [-1282.172] (-1283.451) (-1286.003) * [-1280.864] (-1283.865) (-1281.087) (-1281.283) -- 0:00:44
301500 -- (-1284.372) [-1282.189] (-1283.652) (-1288.417) * [-1280.612] (-1280.613) (-1280.278) (-1282.437) -- 0:00:44
302000 -- (-1281.072) (-1281.387) [-1281.287] (-1280.021) * [-1280.390] (-1284.890) (-1280.853) (-1281.042) -- 0:00:43
302500 -- (-1280.372) (-1283.137) (-1280.352) [-1281.159] * (-1283.894) (-1284.874) (-1280.853) [-1280.518] -- 0:00:43
303000 -- (-1280.452) [-1281.641] (-1279.804) (-1279.266) * (-1286.298) (-1291.963) (-1280.927) [-1280.396] -- 0:00:43
303500 -- [-1279.589] (-1280.243) (-1279.947) (-1281.845) * [-1281.250] (-1280.414) (-1280.122) (-1288.586) -- 0:00:43
304000 -- (-1281.516) (-1283.550) (-1279.451) [-1279.936] * [-1279.283] (-1279.798) (-1280.600) (-1284.788) -- 0:00:43
304500 -- (-1280.062) (-1281.088) (-1279.640) [-1281.679] * (-1280.495) (-1283.363) [-1279.694] (-1284.969) -- 0:00:43
305000 -- (-1281.366) (-1281.547) [-1279.722] (-1280.689) * (-1280.934) (-1281.922) (-1281.615) [-1280.964] -- 0:00:43
Average standard deviation of split frequencies: 0.013942
305500 -- (-1281.511) (-1283.423) [-1280.612] (-1280.978) * (-1284.490) (-1282.314) [-1279.122] (-1284.649) -- 0:00:43
306000 -- (-1279.499) (-1281.463) [-1282.509] (-1281.488) * (-1286.010) (-1280.026) [-1282.007] (-1280.986) -- 0:00:43
306500 -- [-1281.313] (-1285.898) (-1281.810) (-1280.549) * (-1282.904) (-1282.227) (-1280.596) [-1280.376] -- 0:00:42
307000 -- (-1281.697) (-1280.454) (-1281.174) [-1280.622] * (-1283.638) (-1283.506) [-1281.309] (-1281.315) -- 0:00:42
307500 -- [-1279.716] (-1280.345) (-1281.935) (-1281.215) * (-1284.909) [-1282.176] (-1280.860) (-1280.436) -- 0:00:45
308000 -- (-1280.197) (-1280.933) [-1282.502] (-1282.932) * (-1283.106) (-1280.597) [-1280.984] (-1280.096) -- 0:00:44
308500 -- [-1280.298] (-1280.337) (-1283.381) (-1280.880) * (-1281.278) (-1280.391) (-1286.186) [-1280.107] -- 0:00:44
309000 -- (-1280.394) [-1281.270] (-1284.857) (-1280.337) * (-1287.142) (-1280.561) (-1283.794) [-1279.621] -- 0:00:44
309500 -- (-1280.834) [-1283.638] (-1282.947) (-1281.442) * (-1282.525) [-1283.804] (-1282.602) (-1283.012) -- 0:00:44
310000 -- (-1282.259) (-1283.917) (-1284.666) [-1281.170] * (-1284.325) (-1280.988) (-1289.317) [-1281.944] -- 0:00:44
Average standard deviation of split frequencies: 0.014264
310500 -- (-1282.022) [-1282.396] (-1283.023) (-1282.174) * (-1283.221) (-1279.504) [-1282.431] (-1284.416) -- 0:00:44
311000 -- (-1279.681) [-1279.300] (-1285.280) (-1280.175) * (-1283.813) [-1279.519] (-1280.857) (-1280.043) -- 0:00:44
311500 -- (-1279.681) (-1280.923) (-1282.319) [-1282.008] * (-1283.563) [-1279.417] (-1279.775) (-1280.043) -- 0:00:44
312000 -- [-1280.472] (-1283.834) (-1286.784) (-1282.873) * [-1280.769] (-1280.981) (-1280.530) (-1280.822) -- 0:00:44
312500 -- (-1283.727) (-1279.319) [-1283.328] (-1280.615) * [-1283.120] (-1280.196) (-1279.587) (-1280.866) -- 0:00:44
313000 -- (-1280.449) [-1279.543] (-1279.439) (-1284.885) * (-1281.872) (-1280.172) [-1280.352] (-1280.358) -- 0:00:43
313500 -- (-1281.415) (-1287.637) (-1279.868) [-1284.541] * (-1282.690) (-1280.124) (-1282.411) [-1281.421] -- 0:00:43
314000 -- [-1280.093] (-1280.669) (-1280.447) (-1281.533) * [-1280.478] (-1280.828) (-1280.614) (-1281.467) -- 0:00:43
314500 -- [-1280.028] (-1281.458) (-1279.600) (-1281.900) * [-1280.580] (-1280.746) (-1281.461) (-1281.388) -- 0:00:43
315000 -- (-1279.583) (-1281.019) (-1279.891) [-1281.607] * (-1281.658) (-1281.452) (-1281.206) [-1280.590] -- 0:00:43
Average standard deviation of split frequencies: 0.015166
315500 -- (-1281.064) (-1279.605) (-1279.211) [-1282.777] * [-1280.093] (-1282.976) (-1281.880) (-1279.457) -- 0:00:43
316000 -- (-1279.942) (-1279.524) [-1279.214] (-1284.594) * (-1280.143) [-1287.792] (-1282.010) (-1281.702) -- 0:00:43
316500 -- (-1284.327) (-1281.281) [-1280.309] (-1281.895) * (-1280.680) (-1285.068) (-1281.519) [-1281.701] -- 0:00:43
317000 -- (-1286.068) (-1283.305) (-1281.202) [-1280.614] * (-1283.221) (-1282.227) [-1281.069] (-1279.142) -- 0:00:43
317500 -- (-1282.118) (-1281.986) [-1281.748] (-1280.487) * (-1283.917) (-1282.378) (-1285.002) [-1279.140] -- 0:00:42
318000 -- (-1281.978) [-1283.123] (-1282.630) (-1285.059) * (-1280.254) [-1280.988] (-1283.490) (-1280.525) -- 0:00:42
318500 -- [-1280.155] (-1282.173) (-1281.978) (-1284.643) * [-1281.622] (-1281.020) (-1283.782) (-1281.000) -- 0:00:42
319000 -- [-1280.789] (-1281.242) (-1283.323) (-1280.306) * (-1283.699) (-1280.939) [-1279.493] (-1281.013) -- 0:00:42
319500 -- [-1280.736] (-1284.960) (-1282.478) (-1280.948) * (-1282.338) [-1281.061] (-1280.928) (-1283.697) -- 0:00:42
320000 -- (-1281.785) [-1283.737] (-1283.630) (-1281.874) * (-1284.124) (-1281.176) [-1280.478] (-1281.182) -- 0:00:42
Average standard deviation of split frequencies: 0.015272
320500 -- (-1281.801) (-1281.750) [-1285.617] (-1280.174) * [-1279.654] (-1281.188) (-1281.383) (-1283.707) -- 0:00:42
321000 -- [-1280.751] (-1283.220) (-1285.644) (-1282.166) * (-1280.084) (-1282.090) (-1284.269) [-1282.504] -- 0:00:42
321500 -- (-1284.581) (-1279.682) (-1280.971) [-1281.263] * [-1281.469] (-1285.104) (-1284.923) (-1281.869) -- 0:00:42
322000 -- (-1282.714) (-1279.809) (-1281.625) [-1280.578] * (-1279.354) [-1280.876] (-1287.025) (-1283.598) -- 0:00:42
322500 -- (-1284.274) (-1279.940) (-1283.768) [-1280.773] * (-1282.611) (-1281.133) (-1283.683) [-1282.283] -- 0:00:42
323000 -- (-1285.003) (-1279.606) (-1279.494) [-1282.302] * [-1281.372] (-1282.772) (-1280.986) (-1283.178) -- 0:00:41
323500 -- (-1280.890) (-1280.398) [-1280.404] (-1281.570) * [-1279.887] (-1283.802) (-1281.882) (-1280.809) -- 0:00:43
324000 -- (-1281.809) (-1281.797) (-1280.212) [-1283.170] * [-1279.681] (-1283.294) (-1281.615) (-1281.211) -- 0:00:43
324500 -- (-1279.576) (-1284.705) [-1279.727] (-1281.115) * (-1280.727) [-1282.832] (-1281.281) (-1280.885) -- 0:00:43
325000 -- (-1284.260) [-1283.691] (-1280.054) (-1279.612) * (-1281.074) (-1283.036) (-1280.198) [-1281.341] -- 0:00:43
Average standard deviation of split frequencies: 0.014677
325500 -- (-1282.192) (-1281.861) (-1280.350) [-1281.875] * (-1281.353) [-1284.081] (-1279.736) (-1280.214) -- 0:00:43
326000 -- (-1280.468) (-1281.725) [-1280.758] (-1283.897) * [-1283.676] (-1283.383) (-1279.736) (-1281.497) -- 0:00:43
326500 -- (-1288.169) (-1282.141) [-1279.505] (-1286.473) * (-1283.062) [-1283.813] (-1279.753) (-1281.092) -- 0:00:43
327000 -- (-1283.719) (-1283.015) (-1279.583) [-1282.670] * (-1281.895) [-1282.639] (-1280.101) (-1280.755) -- 0:00:43
327500 -- (-1281.291) [-1282.233] (-1280.154) (-1285.881) * (-1280.528) (-1283.276) (-1280.101) [-1280.162] -- 0:00:43
328000 -- (-1283.058) [-1281.069] (-1280.056) (-1282.332) * (-1280.673) (-1283.513) (-1281.410) [-1280.307] -- 0:00:43
328500 -- (-1282.145) [-1284.619] (-1289.208) (-1281.720) * (-1281.529) [-1280.784] (-1281.337) (-1282.918) -- 0:00:42
329000 -- (-1282.684) [-1280.436] (-1282.213) (-1282.551) * (-1281.379) [-1281.990] (-1282.183) (-1282.129) -- 0:00:42
329500 -- (-1283.416) (-1281.275) [-1283.330] (-1282.334) * [-1281.354] (-1280.024) (-1284.299) (-1280.165) -- 0:00:42
330000 -- (-1281.693) [-1279.959] (-1286.686) (-1283.985) * [-1280.026] (-1279.777) (-1284.287) (-1279.882) -- 0:00:42
Average standard deviation of split frequencies: 0.014781
330500 -- (-1281.583) (-1279.732) (-1283.663) [-1281.639] * [-1281.304] (-1282.675) (-1282.166) (-1280.853) -- 0:00:42
331000 -- (-1280.958) [-1279.514] (-1281.310) (-1281.340) * (-1280.629) (-1279.763) (-1281.936) [-1287.857] -- 0:00:42
331500 -- (-1280.833) (-1280.944) [-1281.316] (-1281.131) * [-1282.145] (-1281.437) (-1282.935) (-1281.519) -- 0:00:42
332000 -- (-1280.292) (-1281.713) [-1281.070] (-1283.697) * (-1280.566) (-1283.508) (-1281.523) [-1279.908] -- 0:00:42
332500 -- (-1279.408) [-1281.384] (-1282.127) (-1281.037) * (-1283.122) (-1282.299) [-1281.420] (-1280.392) -- 0:00:42
333000 -- (-1281.575) [-1286.294] (-1283.563) (-1281.156) * [-1285.360] (-1282.124) (-1280.870) (-1280.017) -- 0:00:42
333500 -- [-1281.813] (-1280.674) (-1280.299) (-1279.813) * (-1286.432) (-1285.543) [-1282.889] (-1280.317) -- 0:00:41
334000 -- (-1282.574) (-1281.679) (-1280.491) [-1280.634] * (-1279.795) [-1281.601] (-1284.264) (-1281.435) -- 0:00:41
334500 -- (-1281.948) [-1282.826] (-1282.379) (-1282.801) * [-1280.311] (-1282.287) (-1282.889) (-1280.464) -- 0:00:41
335000 -- [-1281.564] (-1283.376) (-1281.431) (-1283.710) * (-1280.865) (-1282.380) [-1284.055] (-1282.915) -- 0:00:41
Average standard deviation of split frequencies: 0.014399
335500 -- (-1281.614) (-1286.258) (-1280.245) [-1284.856] * (-1280.782) (-1282.322) (-1280.355) [-1283.147] -- 0:00:41
336000 -- (-1280.870) (-1283.306) (-1281.337) [-1279.926] * [-1281.537] (-1279.785) (-1281.725) (-1280.752) -- 0:00:41
336500 -- (-1280.338) (-1280.959) [-1282.279] (-1280.653) * (-1280.386) [-1284.431] (-1280.937) (-1279.859) -- 0:00:41
337000 -- (-1280.411) [-1281.371] (-1280.516) (-1280.030) * (-1282.289) (-1279.751) [-1281.316] (-1282.998) -- 0:00:41
337500 -- (-1280.132) [-1280.849] (-1282.042) (-1286.890) * (-1280.951) (-1279.751) (-1280.344) [-1285.153] -- 0:00:41
338000 -- (-1280.733) (-1281.018) (-1283.756) [-1281.080] * (-1282.968) (-1281.550) (-1281.238) [-1280.740] -- 0:00:41
338500 -- (-1281.129) [-1281.064] (-1283.407) (-1280.129) * [-1281.517] (-1280.605) (-1285.531) (-1280.551) -- 0:00:41
339000 -- (-1280.379) [-1282.875] (-1283.320) (-1280.026) * (-1280.464) (-1284.519) [-1285.761] (-1280.977) -- 0:00:40
339500 -- (-1280.322) (-1281.984) [-1285.480] (-1280.380) * (-1281.030) (-1280.568) [-1283.592] (-1282.137) -- 0:00:42
340000 -- (-1279.907) (-1280.445) (-1281.918) [-1281.263] * (-1283.608) (-1280.073) (-1281.876) [-1281.791] -- 0:00:42
Average standard deviation of split frequencies: 0.014453
340500 -- [-1280.499] (-1281.678) (-1282.201) (-1279.337) * (-1280.098) (-1282.277) (-1280.176) [-1283.309] -- 0:00:42
341000 -- [-1280.856] (-1281.463) (-1279.575) (-1280.597) * (-1280.327) [-1279.703] (-1279.067) (-1283.909) -- 0:00:42
341500 -- (-1280.487) (-1286.036) (-1282.699) [-1281.972] * [-1280.624] (-1280.134) (-1280.044) (-1282.714) -- 0:00:42
342000 -- (-1283.040) (-1282.940) (-1282.790) [-1281.387] * (-1281.136) (-1281.318) (-1281.011) [-1282.000] -- 0:00:42
342500 -- [-1281.550] (-1284.148) (-1279.441) (-1282.464) * [-1281.469] (-1279.527) (-1281.110) (-1283.350) -- 0:00:42
343000 -- (-1279.856) (-1281.811) [-1281.440] (-1279.689) * (-1280.719) (-1280.259) (-1280.478) [-1282.239] -- 0:00:42
343500 -- (-1281.538) (-1281.959) [-1280.750] (-1280.596) * (-1280.471) [-1280.093] (-1280.049) (-1280.481) -- 0:00:42
344000 -- (-1280.238) [-1281.200] (-1281.232) (-1282.145) * (-1285.079) (-1281.061) (-1280.259) [-1284.365] -- 0:00:41
344500 -- (-1280.829) [-1282.748] (-1280.569) (-1283.758) * (-1283.097) [-1281.594] (-1280.850) (-1284.885) -- 0:00:41
345000 -- (-1281.562) (-1279.883) (-1281.101) [-1279.482] * [-1280.544] (-1280.972) (-1279.389) (-1279.117) -- 0:00:41
Average standard deviation of split frequencies: 0.014198
345500 -- (-1280.764) [-1282.477] (-1280.116) (-1280.827) * (-1280.478) (-1280.304) [-1279.428] (-1279.627) -- 0:00:41
346000 -- (-1281.467) (-1279.870) (-1281.312) [-1281.555] * (-1284.694) (-1283.579) (-1282.059) [-1279.504] -- 0:00:41
346500 -- (-1278.969) (-1280.522) (-1281.506) [-1282.626] * (-1282.921) [-1283.958] (-1280.142) (-1280.504) -- 0:00:41
347000 -- (-1279.155) (-1280.080) [-1279.335] (-1280.507) * (-1282.604) [-1282.068] (-1281.961) (-1284.220) -- 0:00:41
347500 -- (-1279.883) (-1284.020) (-1280.865) [-1279.989] * [-1282.861] (-1282.493) (-1281.490) (-1280.040) -- 0:00:41
348000 -- [-1279.412] (-1279.937) (-1280.955) (-1282.858) * (-1281.187) (-1280.936) (-1279.457) [-1280.828] -- 0:00:41
348500 -- [-1278.979] (-1280.933) (-1280.579) (-1283.127) * (-1280.294) [-1281.655] (-1279.735) (-1281.172) -- 0:00:41
349000 -- (-1280.105) (-1281.241) (-1280.581) [-1281.499] * [-1281.363] (-1282.739) (-1281.868) (-1281.529) -- 0:00:41
349500 -- (-1282.141) (-1280.402) [-1280.697] (-1282.344) * (-1279.993) (-1284.139) [-1282.056] (-1281.747) -- 0:00:40
350000 -- (-1282.324) (-1281.692) [-1279.976] (-1281.245) * (-1282.165) (-1282.959) (-1283.440) [-1282.433] -- 0:00:40
Average standard deviation of split frequencies: 0.015499
350500 -- (-1280.475) (-1281.421) (-1280.122) [-1280.294] * (-1284.474) (-1284.892) [-1280.460] (-1283.881) -- 0:00:40
351000 -- [-1284.275] (-1283.283) (-1279.790) (-1285.369) * (-1286.744) (-1283.366) (-1280.963) [-1282.766] -- 0:00:40
351500 -- (-1282.557) [-1279.437] (-1279.973) (-1282.500) * (-1280.350) (-1281.411) (-1279.642) [-1280.012] -- 0:00:40
352000 -- [-1280.310] (-1279.261) (-1281.230) (-1281.511) * (-1282.478) [-1282.232] (-1280.345) (-1281.792) -- 0:00:40
352500 -- (-1280.804) (-1279.617) [-1280.242] (-1279.413) * (-1283.031) (-1279.922) (-1282.696) [-1279.123] -- 0:00:40
353000 -- (-1284.130) [-1279.617] (-1282.007) (-1290.734) * [-1281.562] (-1280.423) (-1281.366) (-1281.792) -- 0:00:40
353500 -- (-1282.771) [-1284.316] (-1281.996) (-1285.155) * (-1281.562) (-1283.576) (-1280.473) [-1282.852] -- 0:00:40
354000 -- (-1286.240) (-1283.534) (-1281.313) [-1281.676] * (-1280.550) [-1279.586] (-1281.286) (-1282.541) -- 0:00:40
354500 -- (-1280.718) [-1286.480] (-1279.909) (-1282.720) * (-1284.446) (-1279.355) [-1282.645] (-1283.571) -- 0:00:40
355000 -- (-1283.087) (-1285.235) [-1280.856] (-1281.148) * (-1280.702) (-1279.588) [-1282.635] (-1280.553) -- 0:00:39
Average standard deviation of split frequencies: 0.014722
355500 -- [-1282.613] (-1282.301) (-1282.688) (-1280.715) * (-1283.269) [-1279.494] (-1282.663) (-1282.523) -- 0:00:41
356000 -- (-1280.144) (-1282.152) [-1280.481] (-1279.636) * (-1281.568) (-1279.590) (-1283.144) [-1281.290] -- 0:00:41
356500 -- (-1279.530) [-1280.849] (-1282.033) (-1283.211) * (-1282.522) [-1282.070] (-1282.850) (-1280.308) -- 0:00:41
357000 -- (-1281.478) (-1283.498) [-1280.596] (-1284.454) * [-1282.229] (-1280.819) (-1281.810) (-1279.937) -- 0:00:41
357500 -- [-1280.933] (-1282.460) (-1279.598) (-1283.294) * (-1281.462) (-1282.862) [-1282.327] (-1281.918) -- 0:00:41
358000 -- (-1281.422) (-1282.984) (-1280.778) [-1282.440] * (-1283.498) (-1283.065) (-1280.579) [-1281.265] -- 0:00:41
358500 -- (-1281.138) (-1282.785) (-1280.708) [-1283.231] * (-1281.341) (-1281.165) [-1281.189] (-1281.318) -- 0:00:41
359000 -- (-1279.881) (-1281.858) [-1283.347] (-1283.712) * (-1281.369) (-1281.888) (-1280.992) [-1280.375] -- 0:00:41
359500 -- (-1280.338) [-1281.891] (-1283.291) (-1281.677) * (-1283.413) [-1282.662] (-1281.338) (-1279.008) -- 0:00:40
360000 -- (-1280.015) [-1282.328] (-1285.402) (-1282.247) * [-1281.385] (-1281.567) (-1281.263) (-1279.052) -- 0:00:40
Average standard deviation of split frequencies: 0.013839
360500 -- (-1279.117) [-1286.242] (-1279.967) (-1283.174) * (-1286.056) (-1282.362) (-1282.471) [-1279.745] -- 0:00:40
361000 -- [-1280.946] (-1281.535) (-1281.664) (-1281.620) * (-1281.907) (-1285.430) (-1283.322) [-1281.112] -- 0:00:40
361500 -- [-1280.970] (-1282.759) (-1283.115) (-1279.192) * (-1284.103) (-1286.625) [-1282.386] (-1280.771) -- 0:00:40
362000 -- (-1279.784) (-1284.911) [-1280.549] (-1281.608) * (-1282.979) [-1282.535] (-1279.948) (-1283.992) -- 0:00:40
362500 -- (-1279.022) (-1281.996) [-1280.550] (-1280.110) * [-1283.092] (-1282.379) (-1280.440) (-1282.419) -- 0:00:40
363000 -- (-1280.243) (-1281.019) [-1279.843] (-1283.868) * [-1280.060] (-1282.738) (-1280.304) (-1280.337) -- 0:00:40
363500 -- (-1280.300) (-1283.272) [-1282.028] (-1286.160) * (-1280.118) [-1281.614] (-1284.620) (-1286.032) -- 0:00:40
364000 -- [-1282.923] (-1280.579) (-1281.240) (-1280.827) * (-1280.109) [-1279.078] (-1282.736) (-1279.586) -- 0:00:40
364500 -- (-1281.049) [-1279.944] (-1280.296) (-1280.171) * (-1281.850) [-1281.593] (-1282.315) (-1282.194) -- 0:00:40
365000 -- [-1281.242] (-1282.029) (-1281.824) (-1281.704) * (-1282.413) (-1281.734) [-1282.229] (-1282.857) -- 0:00:40
Average standard deviation of split frequencies: 0.012236
365500 -- (-1284.766) (-1279.940) (-1281.575) [-1281.260] * (-1286.348) [-1281.953] (-1280.624) (-1279.718) -- 0:00:39
366000 -- (-1281.813) [-1280.477] (-1282.184) (-1286.820) * (-1283.239) (-1280.720) [-1280.216] (-1284.629) -- 0:00:39
366500 -- (-1280.456) (-1283.405) [-1280.944] (-1282.885) * (-1281.793) [-1280.141] (-1281.784) (-1280.069) -- 0:00:39
367000 -- (-1280.542) (-1284.614) (-1281.364) [-1284.141] * (-1281.550) (-1280.848) (-1280.817) [-1279.957] -- 0:00:39
367500 -- [-1281.704] (-1280.327) (-1282.726) (-1280.760) * (-1283.250) [-1280.998] (-1279.316) (-1279.299) -- 0:00:39
368000 -- (-1281.884) (-1282.309) (-1282.021) [-1282.442] * [-1280.598] (-1280.025) (-1280.818) (-1279.794) -- 0:00:39
368500 -- [-1283.301] (-1279.897) (-1282.670) (-1280.390) * (-1281.275) (-1283.091) [-1281.356] (-1279.972) -- 0:00:39
369000 -- (-1281.676) (-1280.537) [-1282.476] (-1280.400) * (-1279.781) (-1282.086) (-1281.534) [-1279.797] -- 0:00:39
369500 -- (-1281.620) (-1281.394) [-1280.143] (-1281.761) * [-1281.125] (-1281.352) (-1287.048) (-1282.411) -- 0:00:39
370000 -- (-1280.049) (-1282.007) [-1281.030] (-1280.966) * (-1280.916) (-1280.703) (-1285.010) [-1282.938] -- 0:00:39
Average standard deviation of split frequencies: 0.012364
370500 -- (-1282.734) (-1281.695) [-1280.160] (-1280.123) * (-1280.439) [-1282.403] (-1282.486) (-1280.480) -- 0:00:39
371000 -- [-1281.279] (-1281.665) (-1280.171) (-1280.437) * (-1282.422) (-1282.315) (-1280.433) [-1281.831] -- 0:00:40
371500 -- (-1283.466) (-1283.866) (-1281.968) [-1285.431] * (-1281.006) (-1283.133) [-1281.044] (-1285.285) -- 0:00:40
372000 -- (-1284.627) [-1283.171] (-1280.989) (-1285.171) * (-1281.670) [-1284.760] (-1281.138) (-1281.504) -- 0:00:40
372500 -- (-1281.470) [-1281.921] (-1282.716) (-1282.236) * (-1283.452) (-1279.481) (-1280.410) [-1281.764] -- 0:00:40
373000 -- (-1281.959) (-1284.937) [-1282.867] (-1280.828) * (-1282.182) (-1284.466) (-1282.564) [-1281.530] -- 0:00:40
373500 -- (-1282.315) (-1280.440) [-1280.902] (-1281.082) * (-1282.183) (-1282.050) (-1281.161) [-1284.340] -- 0:00:40
374000 -- [-1281.025] (-1282.948) (-1281.862) (-1280.541) * (-1281.854) [-1280.940] (-1282.536) (-1283.305) -- 0:00:40
374500 -- (-1280.992) [-1281.250] (-1284.472) (-1283.502) * (-1281.853) (-1280.321) [-1281.717] (-1282.361) -- 0:00:40
375000 -- (-1280.040) (-1281.312) [-1280.750] (-1282.566) * (-1282.366) [-1280.206] (-1281.260) (-1283.870) -- 0:00:40
Average standard deviation of split frequencies: 0.011353
375500 -- [-1283.494] (-1281.274) (-1283.305) (-1282.142) * (-1281.447) (-1281.199) [-1283.123] (-1282.128) -- 0:00:39
376000 -- (-1280.604) (-1281.355) (-1281.467) [-1281.037] * (-1281.572) (-1282.748) (-1281.998) [-1280.507] -- 0:00:39
376500 -- (-1279.674) [-1282.769] (-1284.936) (-1281.278) * (-1280.371) [-1281.241] (-1281.955) (-1280.855) -- 0:00:39
377000 -- [-1279.465] (-1280.654) (-1280.446) (-1280.214) * (-1284.325) (-1281.217) (-1285.409) [-1280.197] -- 0:00:39
377500 -- (-1280.433) (-1281.779) [-1282.256] (-1279.984) * (-1284.562) (-1280.754) [-1288.036] (-1282.029) -- 0:00:39
378000 -- (-1280.549) [-1282.183] (-1280.669) (-1282.663) * (-1283.669) [-1280.619] (-1284.934) (-1280.720) -- 0:00:39
378500 -- (-1279.587) (-1284.263) (-1285.428) [-1282.961] * (-1282.878) [-1280.769] (-1287.634) (-1280.010) -- 0:00:39
379000 -- (-1281.301) (-1285.098) [-1285.559] (-1282.048) * (-1282.474) [-1282.196] (-1281.495) (-1279.838) -- 0:00:39
379500 -- (-1282.417) [-1283.586] (-1286.052) (-1282.977) * (-1281.875) (-1282.634) (-1280.737) [-1281.031] -- 0:00:39
380000 -- (-1280.514) (-1283.031) (-1282.480) [-1281.212] * (-1283.441) (-1285.311) (-1280.962) [-1280.503] -- 0:00:39
Average standard deviation of split frequencies: 0.010939
380500 -- (-1281.144) (-1283.687) (-1285.750) [-1280.452] * (-1281.134) (-1281.835) (-1280.663) [-1281.185] -- 0:00:39
381000 -- (-1280.040) (-1281.441) (-1285.560) [-1282.203] * (-1282.348) (-1285.439) [-1279.698] (-1283.216) -- 0:00:38
381500 -- [-1280.033] (-1285.663) (-1280.592) (-1281.804) * [-1281.899] (-1285.554) (-1283.655) (-1283.522) -- 0:00:38
382000 -- [-1280.647] (-1279.100) (-1284.435) (-1281.009) * (-1283.258) (-1282.194) (-1281.228) [-1283.127] -- 0:00:38
382500 -- [-1282.703] (-1281.698) (-1283.589) (-1280.385) * (-1282.941) (-1286.603) (-1281.657) [-1281.198] -- 0:00:38
383000 -- (-1280.189) [-1280.349] (-1284.166) (-1283.091) * (-1286.355) [-1280.979] (-1281.078) (-1282.232) -- 0:00:38
383500 -- (-1280.333) (-1281.582) (-1280.216) [-1281.940] * (-1283.820) (-1279.769) [-1281.468] (-1289.193) -- 0:00:38
384000 -- [-1280.680] (-1281.651) (-1281.110) (-1284.972) * (-1281.212) [-1279.676] (-1280.140) (-1283.359) -- 0:00:38
384500 -- [-1282.460] (-1281.942) (-1279.925) (-1282.790) * (-1280.289) [-1281.021] (-1281.116) (-1286.851) -- 0:00:38
385000 -- (-1280.656) (-1284.094) (-1280.208) [-1282.921] * (-1280.417) (-1282.126) [-1280.582] (-1283.482) -- 0:00:38
Average standard deviation of split frequencies: 0.010927
385500 -- (-1286.590) [-1281.416] (-1282.014) (-1281.551) * (-1279.909) [-1282.665] (-1281.884) (-1280.466) -- 0:00:38
386000 -- (-1286.592) (-1281.048) (-1280.797) [-1281.282] * (-1283.088) (-1280.667) [-1282.247] (-1281.674) -- 0:00:38
386500 -- (-1283.587) (-1280.976) (-1281.143) [-1280.760] * [-1280.116] (-1283.692) (-1280.220) (-1279.575) -- 0:00:38
387000 -- (-1282.216) (-1280.700) (-1285.242) [-1281.625] * (-1285.178) (-1281.774) (-1283.749) [-1280.166] -- 0:00:39
387500 -- [-1279.949] (-1280.373) (-1281.320) (-1282.716) * (-1281.493) [-1280.022] (-1283.384) (-1282.703) -- 0:00:39
388000 -- (-1281.693) (-1279.797) [-1283.241] (-1283.651) * [-1281.418] (-1280.481) (-1280.200) (-1283.565) -- 0:00:39
388500 -- (-1284.905) [-1279.187] (-1281.807) (-1283.221) * [-1280.227] (-1283.069) (-1280.300) (-1284.381) -- 0:00:39
389000 -- (-1287.280) (-1279.072) [-1280.160] (-1285.480) * (-1283.439) [-1284.903] (-1280.201) (-1285.581) -- 0:00:39
389500 -- [-1283.999] (-1279.066) (-1281.599) (-1286.157) * (-1288.363) (-1282.033) [-1281.722] (-1282.826) -- 0:00:39
390000 -- (-1284.281) (-1279.992) (-1280.313) [-1280.511] * [-1279.598] (-1281.722) (-1281.441) (-1280.729) -- 0:00:39
Average standard deviation of split frequencies: 0.011286
390500 -- (-1281.141) (-1279.123) (-1279.454) [-1281.256] * [-1280.171] (-1282.826) (-1281.307) (-1280.281) -- 0:00:39
391000 -- (-1287.837) (-1279.357) (-1279.342) [-1279.862] * (-1280.462) (-1282.025) (-1282.252) [-1280.667] -- 0:00:38
391500 -- (-1283.840) [-1280.538] (-1282.394) (-1279.625) * (-1281.247) (-1282.621) (-1282.580) [-1281.764] -- 0:00:38
392000 -- (-1279.291) [-1281.963] (-1282.292) (-1281.077) * (-1281.266) (-1282.658) [-1281.758] (-1283.325) -- 0:00:38
392500 -- (-1282.503) (-1280.356) (-1279.410) [-1279.581] * [-1285.190] (-1279.794) (-1281.261) (-1284.268) -- 0:00:38
393000 -- (-1282.206) [-1282.928] (-1279.800) (-1283.757) * (-1280.570) [-1279.863] (-1280.571) (-1286.674) -- 0:00:38
393500 -- [-1286.428] (-1280.748) (-1281.158) (-1280.153) * (-1282.123) [-1279.726] (-1282.524) (-1288.400) -- 0:00:38
394000 -- (-1283.945) [-1285.339] (-1282.532) (-1284.100) * (-1279.879) (-1283.134) [-1280.293] (-1282.340) -- 0:00:38
394500 -- (-1284.531) (-1281.293) (-1281.957) [-1281.344] * (-1280.928) (-1280.829) [-1281.973] (-1282.141) -- 0:00:38
395000 -- (-1284.326) (-1281.344) [-1282.077] (-1282.666) * (-1281.977) (-1281.006) (-1282.531) [-1282.568] -- 0:00:38
Average standard deviation of split frequencies: 0.011274
395500 -- [-1281.847] (-1280.579) (-1280.768) (-1281.617) * (-1279.754) [-1280.376] (-1283.489) (-1281.556) -- 0:00:38
396000 -- (-1281.289) (-1280.365) [-1280.264] (-1281.882) * [-1282.140] (-1284.765) (-1285.497) (-1283.240) -- 0:00:38
396500 -- (-1284.910) [-1281.325] (-1282.597) (-1287.199) * [-1282.013] (-1281.210) (-1281.669) (-1287.224) -- 0:00:38
397000 -- (-1281.887) (-1279.746) [-1280.260] (-1281.225) * (-1285.402) [-1280.914] (-1282.747) (-1285.156) -- 0:00:37
397500 -- (-1280.382) [-1279.741] (-1282.048) (-1280.603) * (-1280.207) (-1280.115) (-1280.690) [-1283.765] -- 0:00:37
398000 -- (-1279.174) [-1280.222] (-1280.607) (-1285.585) * (-1282.630) (-1279.903) (-1281.869) [-1283.812] -- 0:00:37
398500 -- (-1285.146) [-1279.935] (-1283.462) (-1282.720) * (-1282.346) (-1279.600) (-1281.587) [-1279.911] -- 0:00:37
399000 -- (-1282.415) (-1281.824) (-1282.990) [-1281.921] * (-1279.765) (-1279.912) (-1282.028) [-1280.532] -- 0:00:37
399500 -- [-1280.172] (-1280.242) (-1281.942) (-1281.404) * (-1280.662) [-1283.302] (-1282.923) (-1283.209) -- 0:00:37
400000 -- (-1279.748) (-1280.111) [-1283.009] (-1282.344) * (-1280.683) (-1286.605) [-1281.407] (-1279.984) -- 0:00:37
Average standard deviation of split frequencies: 0.010381
400500 -- [-1280.759] (-1282.843) (-1286.381) (-1282.805) * (-1283.166) (-1280.794) (-1281.095) [-1281.076] -- 0:00:37
401000 -- [-1280.759] (-1280.303) (-1280.567) (-1282.341) * (-1280.380) (-1280.744) [-1280.887] (-1280.296) -- 0:00:37
401500 -- (-1279.866) [-1280.106] (-1282.070) (-1282.095) * (-1280.366) (-1281.214) [-1282.713] (-1280.850) -- 0:00:37
402000 -- (-1279.353) (-1283.337) (-1286.684) [-1280.844] * (-1282.590) [-1281.083] (-1283.021) (-1280.641) -- 0:00:37
402500 -- [-1281.300] (-1281.243) (-1286.073) (-1282.405) * (-1280.783) (-1282.077) [-1281.987] (-1282.179) -- 0:00:37
403000 -- (-1283.339) (-1280.331) [-1279.237] (-1282.439) * (-1280.319) (-1279.440) [-1280.300] (-1283.212) -- 0:00:38
403500 -- [-1283.370] (-1280.666) (-1280.750) (-1280.610) * (-1281.672) [-1279.062] (-1281.327) (-1281.197) -- 0:00:38
404000 -- (-1280.623) (-1279.664) [-1281.414] (-1281.505) * [-1283.637] (-1279.062) (-1280.789) (-1281.912) -- 0:00:38
404500 -- (-1279.907) (-1279.955) [-1281.817] (-1281.945) * (-1283.865) (-1284.048) (-1279.363) [-1280.534] -- 0:00:38
405000 -- (-1280.161) (-1279.955) (-1282.200) [-1280.844] * (-1282.680) (-1281.333) [-1282.351] (-1281.850) -- 0:00:38
Average standard deviation of split frequencies: 0.009934
405500 -- (-1281.145) (-1282.293) (-1285.975) [-1280.046] * [-1282.039] (-1280.069) (-1285.422) (-1281.884) -- 0:00:38
406000 -- (-1282.114) (-1281.267) (-1280.910) [-1280.863] * (-1281.009) (-1285.225) (-1285.860) [-1281.295] -- 0:00:38
406500 -- (-1283.593) [-1281.690] (-1280.562) (-1279.817) * (-1279.324) (-1281.990) (-1284.976) [-1281.177] -- 0:00:37
407000 -- (-1285.416) (-1282.523) [-1279.847] (-1280.599) * (-1279.485) [-1281.910] (-1281.991) (-1280.684) -- 0:00:37
407500 -- (-1283.075) [-1280.640] (-1286.099) (-1280.649) * (-1280.440) (-1283.385) [-1282.842] (-1279.606) -- 0:00:37
408000 -- (-1282.340) (-1280.297) [-1283.063] (-1283.693) * [-1282.739] (-1285.539) (-1281.917) (-1279.646) -- 0:00:37
408500 -- [-1280.155] (-1281.062) (-1283.166) (-1282.553) * (-1282.891) [-1282.377] (-1285.772) (-1279.877) -- 0:00:37
409000 -- (-1279.929) (-1281.143) [-1280.554] (-1279.907) * (-1282.599) (-1280.287) (-1284.648) [-1280.346] -- 0:00:37
409500 -- (-1280.071) (-1282.715) [-1281.962] (-1280.335) * (-1284.040) (-1282.660) [-1284.608] (-1281.538) -- 0:00:37
410000 -- [-1280.218] (-1284.173) (-1284.114) (-1282.692) * [-1281.052] (-1281.489) (-1280.518) (-1280.818) -- 0:00:37
Average standard deviation of split frequencies: 0.009926
410500 -- (-1284.506) (-1282.746) (-1285.931) [-1280.393] * (-1287.104) (-1280.776) (-1280.696) [-1281.860] -- 0:00:37
411000 -- (-1285.614) (-1282.253) [-1284.154] (-1280.028) * (-1284.669) (-1279.224) [-1282.582] (-1280.879) -- 0:00:37
411500 -- (-1281.468) (-1282.421) [-1281.699] (-1283.910) * (-1282.291) (-1280.983) [-1284.644] (-1280.210) -- 0:00:37
412000 -- (-1282.074) (-1282.736) [-1281.196] (-1281.172) * (-1284.281) (-1286.035) [-1280.269] (-1280.412) -- 0:00:37
412500 -- (-1280.054) (-1288.553) (-1287.599) [-1279.442] * (-1280.627) (-1280.890) (-1281.452) [-1279.165] -- 0:00:37
413000 -- [-1280.084] (-1281.359) (-1282.255) (-1283.637) * (-1279.419) [-1281.007] (-1281.844) (-1279.628) -- 0:00:36
413500 -- (-1282.039) (-1279.828) [-1279.779] (-1283.750) * (-1279.441) [-1284.424] (-1282.715) (-1279.750) -- 0:00:36
414000 -- [-1282.369] (-1280.131) (-1280.999) (-1282.775) * [-1285.113] (-1281.055) (-1282.731) (-1281.008) -- 0:00:36
414500 -- (-1280.750) (-1280.598) [-1281.852] (-1281.686) * (-1281.147) (-1279.631) (-1281.636) [-1282.410] -- 0:00:36
415000 -- [-1279.431] (-1279.745) (-1284.106) (-1279.682) * (-1282.181) (-1282.138) [-1280.467] (-1287.107) -- 0:00:36
Average standard deviation of split frequencies: 0.009932
415500 -- (-1283.890) (-1279.883) (-1290.770) [-1281.093] * (-1284.630) (-1281.132) (-1279.242) [-1280.950] -- 0:00:36
416000 -- (-1284.230) [-1279.518] (-1281.623) (-1281.656) * (-1282.360) (-1281.421) (-1280.267) [-1280.153] -- 0:00:36
416500 -- (-1280.418) (-1279.460) (-1281.707) [-1283.328] * (-1286.881) [-1281.129] (-1283.824) (-1282.394) -- 0:00:36
417000 -- [-1279.418] (-1283.141) (-1280.948) (-1282.115) * [-1280.910] (-1280.648) (-1282.118) (-1281.482) -- 0:00:36
417500 -- [-1279.491] (-1286.928) (-1283.418) (-1281.750) * [-1280.080] (-1280.934) (-1282.663) (-1279.725) -- 0:00:36
418000 -- (-1281.452) (-1282.143) (-1282.341) [-1282.859] * (-1279.836) (-1280.565) (-1285.643) [-1283.976] -- 0:00:36
418500 -- (-1282.845) (-1279.471) (-1282.260) [-1280.853] * (-1281.422) [-1280.316] (-1283.407) (-1282.231) -- 0:00:36
419000 -- (-1282.382) [-1285.047] (-1281.300) (-1282.375) * (-1281.844) [-1280.999] (-1279.709) (-1281.572) -- 0:00:37
419500 -- [-1282.130] (-1282.532) (-1281.552) (-1280.054) * (-1282.315) (-1279.728) [-1280.118] (-1280.843) -- 0:00:37
420000 -- (-1280.671) (-1282.361) (-1282.539) [-1281.535] * (-1281.198) (-1281.784) [-1282.369] (-1281.955) -- 0:00:37
Average standard deviation of split frequencies: 0.010086
420500 -- (-1282.333) (-1286.304) (-1281.914) [-1280.547] * (-1280.315) (-1282.142) (-1281.721) [-1285.261] -- 0:00:37
421000 -- (-1282.530) [-1281.985] (-1280.033) (-1280.211) * [-1280.824] (-1280.832) (-1280.200) (-1282.890) -- 0:00:37
421500 -- [-1279.345] (-1280.452) (-1280.675) (-1279.565) * (-1283.529) (-1281.582) (-1280.734) [-1280.681] -- 0:00:37
422000 -- (-1279.441) [-1284.684] (-1282.141) (-1281.921) * [-1281.416] (-1283.808) (-1281.119) (-1280.613) -- 0:00:36
422500 -- [-1279.317] (-1284.784) (-1281.131) (-1280.759) * (-1280.294) [-1280.946] (-1284.347) (-1280.241) -- 0:00:36
423000 -- (-1280.778) (-1284.840) (-1281.320) [-1279.937] * [-1279.857] (-1283.371) (-1282.554) (-1280.332) -- 0:00:36
423500 -- (-1281.294) (-1282.308) [-1282.322] (-1280.973) * [-1281.726] (-1285.925) (-1282.827) (-1280.941) -- 0:00:36
424000 -- (-1280.845) (-1279.829) (-1282.632) [-1281.147] * (-1281.963) (-1279.831) [-1281.144] (-1284.094) -- 0:00:36
424500 -- (-1280.642) [-1283.398] (-1281.738) (-1281.650) * (-1281.191) (-1281.909) [-1280.569] (-1282.919) -- 0:00:36
425000 -- (-1283.970) [-1282.881] (-1282.114) (-1281.357) * [-1281.704] (-1281.613) (-1279.831) (-1280.744) -- 0:00:36
Average standard deviation of split frequencies: 0.009569
425500 -- [-1283.320] (-1281.504) (-1282.699) (-1283.924) * (-1280.808) (-1281.836) (-1281.750) [-1281.802] -- 0:00:36
426000 -- [-1282.656] (-1283.448) (-1282.930) (-1283.726) * (-1279.793) (-1282.204) [-1281.443] (-1279.078) -- 0:00:36
426500 -- (-1284.173) (-1281.198) (-1280.250) [-1281.475] * (-1279.782) [-1281.196] (-1280.811) (-1279.196) -- 0:00:36
427000 -- (-1281.236) (-1282.902) (-1280.301) [-1281.566] * (-1279.765) (-1279.481) [-1282.666] (-1279.196) -- 0:00:36
427500 -- (-1280.440) [-1286.189] (-1283.295) (-1284.127) * (-1284.802) [-1280.226] (-1279.709) (-1279.701) -- 0:00:36
428000 -- [-1280.403] (-1281.621) (-1283.352) (-1284.353) * (-1283.032) (-1280.144) [-1279.608] (-1280.394) -- 0:00:36
428500 -- (-1284.051) [-1281.589] (-1281.997) (-1279.980) * [-1284.816] (-1285.144) (-1280.730) (-1280.400) -- 0:00:36
429000 -- (-1281.034) (-1284.406) [-1283.333] (-1284.858) * (-1279.992) [-1281.154] (-1282.575) (-1280.414) -- 0:00:35
429500 -- (-1280.198) [-1284.734] (-1281.701) (-1280.804) * [-1279.953] (-1282.703) (-1280.683) (-1283.805) -- 0:00:35
430000 -- (-1280.549) (-1286.285) (-1284.368) [-1280.527] * [-1285.426] (-1280.177) (-1282.372) (-1282.178) -- 0:00:35
Average standard deviation of split frequencies: 0.008950
430500 -- [-1280.973] (-1284.071) (-1285.123) (-1282.836) * (-1281.121) (-1281.159) (-1286.198) [-1282.085] -- 0:00:35
431000 -- [-1280.974] (-1281.116) (-1284.677) (-1279.895) * (-1280.899) (-1282.403) [-1280.192] (-1286.064) -- 0:00:35
431500 -- [-1280.348] (-1282.467) (-1283.408) (-1279.948) * (-1280.813) (-1283.658) [-1280.730] (-1286.465) -- 0:00:35
432000 -- (-1281.076) [-1281.423] (-1283.405) (-1280.057) * (-1280.610) (-1287.203) [-1279.240] (-1284.131) -- 0:00:35
432500 -- [-1280.104] (-1281.116) (-1281.468) (-1279.583) * [-1281.166] (-1281.303) (-1281.228) (-1282.221) -- 0:00:35
433000 -- (-1279.879) (-1279.874) [-1283.470] (-1280.412) * [-1279.960] (-1279.736) (-1280.719) (-1281.779) -- 0:00:35
433500 -- [-1279.617] (-1280.247) (-1280.999) (-1280.412) * [-1283.665] (-1279.369) (-1281.868) (-1282.633) -- 0:00:35
434000 -- [-1281.934] (-1282.902) (-1283.083) (-1280.361) * (-1281.110) [-1281.136] (-1283.300) (-1285.914) -- 0:00:35
434500 -- (-1289.094) (-1280.058) (-1280.740) [-1281.316] * (-1281.670) (-1281.476) (-1281.265) [-1283.783] -- 0:00:36
435000 -- (-1284.040) [-1279.414] (-1279.405) (-1280.220) * (-1282.608) (-1281.945) [-1279.363] (-1282.163) -- 0:00:36
Average standard deviation of split frequencies: 0.009222
435500 -- (-1280.962) [-1282.850] (-1280.251) (-1279.675) * [-1282.271] (-1279.378) (-1281.105) (-1280.666) -- 0:00:36
436000 -- (-1281.505) (-1280.170) [-1280.516] (-1279.310) * (-1283.706) (-1279.669) (-1281.526) [-1279.883] -- 0:00:36
436500 -- (-1280.708) (-1280.955) (-1280.403) [-1282.567] * (-1285.582) [-1281.913] (-1280.719) (-1279.517) -- 0:00:36
437000 -- (-1282.930) (-1280.300) [-1280.149] (-1280.555) * [-1282.408] (-1281.976) (-1280.937) (-1279.802) -- 0:00:36
437500 -- [-1282.143] (-1280.311) (-1280.284) (-1279.996) * (-1283.210) (-1283.634) [-1279.636] (-1280.033) -- 0:00:36
438000 -- (-1280.628) [-1280.387] (-1280.104) (-1281.110) * (-1284.933) (-1281.244) (-1279.848) [-1280.475] -- 0:00:35
438500 -- (-1281.958) (-1281.472) (-1281.396) [-1280.873] * (-1281.414) [-1281.905] (-1281.423) (-1283.567) -- 0:00:35
439000 -- (-1279.724) (-1282.505) [-1281.454] (-1281.856) * [-1282.024] (-1280.186) (-1286.179) (-1281.218) -- 0:00:35
439500 -- (-1280.231) (-1280.826) (-1282.504) [-1281.518] * (-1283.603) [-1282.108] (-1280.802) (-1280.585) -- 0:00:35
440000 -- (-1283.151) [-1279.553] (-1280.095) (-1281.351) * (-1281.252) (-1279.459) [-1280.387] (-1280.264) -- 0:00:35
Average standard deviation of split frequencies: 0.008495
440500 -- (-1282.030) [-1281.028] (-1282.006) (-1282.513) * (-1280.974) (-1280.211) [-1281.237] (-1281.708) -- 0:00:35
441000 -- [-1280.770] (-1280.996) (-1280.488) (-1282.996) * (-1282.445) (-1283.289) (-1281.246) [-1281.444] -- 0:00:35
441500 -- [-1279.571] (-1281.511) (-1281.050) (-1282.383) * (-1281.028) (-1283.963) [-1280.144] (-1281.059) -- 0:00:35
442000 -- (-1279.736) [-1282.570] (-1287.771) (-1280.595) * (-1287.130) (-1282.181) (-1280.195) [-1280.450] -- 0:00:35
442500 -- (-1281.747) (-1283.504) (-1281.705) [-1281.292] * (-1281.718) (-1284.006) [-1279.501] (-1279.741) -- 0:00:35
443000 -- (-1281.170) (-1280.604) [-1279.739] (-1279.847) * [-1281.765] (-1279.726) (-1285.135) (-1281.547) -- 0:00:35
443500 -- (-1282.227) [-1280.077] (-1280.024) (-1282.129) * (-1282.116) (-1279.188) [-1283.806] (-1285.335) -- 0:00:35
444000 -- [-1282.859] (-1281.972) (-1280.155) (-1283.158) * (-1283.550) [-1279.720] (-1281.798) (-1280.403) -- 0:00:35
444500 -- (-1282.370) [-1279.573] (-1282.541) (-1281.172) * (-1283.986) [-1278.907] (-1279.997) (-1282.936) -- 0:00:34
445000 -- (-1279.958) (-1280.420) [-1280.383] (-1280.790) * (-1282.209) (-1279.519) (-1281.184) [-1279.481] -- 0:00:34
Average standard deviation of split frequencies: 0.008514
445500 -- (-1279.706) (-1284.573) [-1280.516] (-1283.190) * (-1280.364) (-1284.206) [-1280.835] (-1280.796) -- 0:00:34
446000 -- (-1283.932) (-1282.483) [-1281.666] (-1283.843) * [-1280.816] (-1280.759) (-1280.219) (-1280.167) -- 0:00:34
446500 -- (-1281.923) [-1281.329] (-1281.366) (-1284.389) * (-1280.007) [-1280.477] (-1280.213) (-1283.205) -- 0:00:34
447000 -- (-1283.227) (-1279.771) [-1286.193] (-1283.362) * [-1281.491] (-1283.673) (-1279.216) (-1284.955) -- 0:00:34
447500 -- (-1280.758) [-1280.690] (-1282.467) (-1281.597) * [-1280.579] (-1282.545) (-1285.876) (-1284.126) -- 0:00:34
448000 -- [-1279.297] (-1281.271) (-1282.554) (-1281.705) * [-1281.046] (-1285.211) (-1284.936) (-1284.264) -- 0:00:34
448500 -- (-1280.565) (-1281.367) (-1284.913) [-1282.279] * [-1287.136] (-1286.016) (-1280.787) (-1281.257) -- 0:00:34
449000 -- [-1279.421] (-1283.117) (-1280.433) (-1282.615) * (-1282.738) (-1286.668) [-1282.953] (-1280.551) -- 0:00:34
449500 -- [-1281.001] (-1280.510) (-1279.662) (-1280.857) * (-1283.436) (-1283.405) [-1283.522] (-1280.551) -- 0:00:34
450000 -- (-1283.997) (-1280.650) [-1280.352] (-1279.903) * (-1282.453) (-1282.364) [-1284.161] (-1282.140) -- 0:00:34
Average standard deviation of split frequencies: 0.008491
450500 -- (-1279.288) [-1280.483] (-1281.268) (-1280.085) * [-1282.356] (-1281.008) (-1281.479) (-1281.639) -- 0:00:35
451000 -- (-1279.456) [-1283.107] (-1280.105) (-1279.466) * [-1280.630] (-1283.292) (-1280.167) (-1282.168) -- 0:00:35
451500 -- [-1279.877] (-1283.636) (-1280.973) (-1280.678) * [-1281.208] (-1283.750) (-1279.535) (-1284.245) -- 0:00:35
452000 -- (-1283.436) [-1281.818] (-1279.906) (-1282.330) * (-1281.297) (-1280.723) [-1279.928] (-1285.054) -- 0:00:35
452500 -- (-1281.052) [-1282.068] (-1281.043) (-1282.068) * [-1281.373] (-1281.734) (-1282.557) (-1286.436) -- 0:00:35
453000 -- [-1284.291] (-1281.054) (-1279.307) (-1280.281) * (-1279.703) [-1279.835] (-1279.957) (-1282.502) -- 0:00:35
453500 -- (-1282.929) (-1283.737) (-1280.241) [-1280.396] * (-1279.698) (-1283.037) [-1280.122] (-1282.283) -- 0:00:34
454000 -- [-1283.928] (-1282.270) (-1279.698) (-1281.551) * (-1284.023) (-1281.222) [-1288.516] (-1281.172) -- 0:00:34
454500 -- [-1280.646] (-1284.703) (-1284.929) (-1280.040) * (-1287.256) [-1280.220] (-1284.148) (-1279.748) -- 0:00:34
455000 -- (-1281.136) [-1278.985] (-1280.493) (-1280.187) * (-1282.207) (-1280.319) (-1282.059) [-1284.062] -- 0:00:34
Average standard deviation of split frequencies: 0.007430
455500 -- (-1280.558) [-1279.389] (-1280.839) (-1280.036) * (-1281.828) (-1281.368) (-1282.672) [-1284.707] -- 0:00:34
456000 -- (-1281.906) (-1280.543) [-1285.643] (-1280.453) * [-1282.019] (-1281.153) (-1284.080) (-1286.602) -- 0:00:34
456500 -- (-1282.034) [-1282.570] (-1285.580) (-1280.655) * (-1282.265) [-1279.784] (-1283.102) (-1282.929) -- 0:00:34
457000 -- (-1281.607) (-1279.170) (-1283.104) [-1280.813] * (-1281.934) [-1280.754] (-1281.389) (-1283.296) -- 0:00:34
457500 -- (-1281.975) (-1280.143) [-1282.294] (-1283.298) * [-1283.210] (-1281.208) (-1280.717) (-1284.706) -- 0:00:34
458000 -- (-1280.603) (-1279.893) (-1281.272) [-1283.313] * (-1280.103) [-1280.089] (-1280.274) (-1284.836) -- 0:00:34
458500 -- (-1283.084) [-1280.938] (-1280.416) (-1281.668) * (-1279.940) (-1280.148) [-1281.113] (-1280.771) -- 0:00:34
459000 -- (-1283.168) (-1280.127) (-1280.882) [-1282.480] * (-1279.744) (-1280.164) [-1279.699] (-1286.214) -- 0:00:34
459500 -- (-1283.625) [-1281.107] (-1280.811) (-1284.108) * (-1280.756) (-1280.611) (-1279.832) [-1279.733] -- 0:00:34
460000 -- (-1281.659) (-1281.108) [-1281.549] (-1281.533) * (-1280.541) [-1281.263] (-1281.532) (-1279.774) -- 0:00:34
Average standard deviation of split frequencies: 0.007803
460500 -- (-1281.964) (-1281.657) (-1281.265) [-1283.500] * [-1280.921] (-1283.701) (-1281.996) (-1282.740) -- 0:00:33
461000 -- (-1283.112) [-1282.063] (-1281.889) (-1280.419) * [-1281.132] (-1282.245) (-1282.606) (-1281.117) -- 0:00:33
461500 -- (-1280.841) (-1281.502) (-1282.273) [-1280.050] * [-1280.831] (-1279.922) (-1282.652) (-1279.922) -- 0:00:33
462000 -- (-1282.624) (-1280.251) [-1281.140] (-1281.573) * (-1284.521) [-1279.918] (-1281.173) (-1279.915) -- 0:00:33
462500 -- (-1281.777) (-1279.479) [-1284.293] (-1282.419) * (-1288.185) [-1281.415] (-1280.882) (-1279.789) -- 0:00:33
463000 -- (-1281.188) (-1286.218) (-1285.469) [-1281.983] * (-1281.084) (-1279.959) [-1281.207] (-1281.109) -- 0:00:33
463500 -- (-1280.756) (-1281.996) (-1280.001) [-1282.845] * (-1282.897) [-1280.809] (-1280.567) (-1284.727) -- 0:00:33
464000 -- (-1283.119) (-1280.856) (-1281.532) [-1282.865] * (-1282.011) (-1282.077) (-1281.532) [-1280.248] -- 0:00:33
464500 -- (-1282.589) (-1284.477) [-1282.131] (-1280.255) * (-1281.134) [-1283.124] (-1281.735) (-1279.964) -- 0:00:33
465000 -- [-1280.121] (-1282.608) (-1283.896) (-1282.849) * (-1281.691) (-1282.373) (-1279.301) [-1282.827] -- 0:00:33
Average standard deviation of split frequencies: 0.007018
465500 -- [-1280.391] (-1281.445) (-1283.605) (-1282.541) * [-1280.895] (-1281.622) (-1279.641) (-1282.908) -- 0:00:34
466000 -- (-1283.110) (-1281.773) [-1281.841] (-1281.010) * [-1280.901] (-1280.784) (-1280.253) (-1281.012) -- 0:00:34
466500 -- (-1280.273) (-1281.949) [-1281.280] (-1281.268) * [-1281.656] (-1280.354) (-1280.652) (-1280.338) -- 0:00:34
467000 -- (-1280.274) [-1286.351] (-1282.390) (-1280.298) * (-1281.283) [-1280.382] (-1282.344) (-1282.538) -- 0:00:34
467500 -- (-1286.939) (-1286.080) (-1279.414) [-1280.554] * [-1280.497] (-1279.826) (-1282.474) (-1282.839) -- 0:00:34
468000 -- (-1282.705) [-1280.174] (-1279.414) (-1280.260) * (-1280.782) (-1289.216) (-1283.796) [-1281.650] -- 0:00:34
468500 -- (-1280.443) (-1279.777) (-1279.610) [-1280.940] * (-1282.647) (-1286.341) (-1281.864) [-1280.914] -- 0:00:34
469000 -- (-1280.706) (-1279.535) [-1281.126] (-1281.449) * (-1282.250) (-1283.771) (-1282.708) [-1280.837] -- 0:00:33
469500 -- (-1281.965) [-1281.871] (-1283.568) (-1280.775) * (-1282.514) [-1280.975] (-1285.084) (-1279.981) -- 0:00:33
470000 -- [-1281.412] (-1280.922) (-1281.311) (-1281.404) * (-1279.552) [-1279.932] (-1279.282) (-1283.949) -- 0:00:33
Average standard deviation of split frequencies: 0.008200
470500 -- [-1281.298] (-1281.011) (-1282.300) (-1280.798) * (-1280.566) [-1280.017] (-1280.330) (-1286.990) -- 0:00:33
471000 -- (-1281.689) (-1281.168) (-1288.059) [-1281.661] * (-1281.220) [-1281.101] (-1280.791) (-1281.421) -- 0:00:33
471500 -- (-1285.217) (-1286.083) (-1280.218) [-1282.538] * (-1281.713) (-1280.490) [-1283.689] (-1281.535) -- 0:00:33
472000 -- (-1279.433) [-1281.158] (-1279.122) (-1282.784) * (-1281.687) (-1280.561) [-1284.830] (-1282.474) -- 0:00:33
472500 -- [-1280.456] (-1282.023) (-1282.278) (-1282.945) * (-1281.035) [-1280.438] (-1280.886) (-1280.589) -- 0:00:33
473000 -- [-1279.625] (-1281.296) (-1281.614) (-1281.556) * (-1280.895) (-1280.466) (-1280.114) [-1279.383] -- 0:00:33
473500 -- (-1279.625) (-1280.827) (-1282.310) [-1281.882] * [-1279.733] (-1282.540) (-1280.959) (-1281.506) -- 0:00:33
474000 -- (-1279.377) (-1279.785) (-1280.681) [-1279.897] * (-1283.988) [-1280.445] (-1284.014) (-1281.344) -- 0:00:33
474500 -- (-1284.138) [-1282.708] (-1280.758) (-1281.714) * (-1285.614) [-1281.443] (-1284.424) (-1280.652) -- 0:00:33
475000 -- [-1281.812] (-1279.818) (-1283.403) (-1285.437) * [-1284.019] (-1280.847) (-1285.399) (-1281.130) -- 0:00:33
Average standard deviation of split frequencies: 0.008356
475500 -- (-1280.363) (-1280.473) (-1282.924) [-1280.225] * (-1281.794) (-1281.077) (-1283.053) [-1285.863] -- 0:00:33
476000 -- (-1281.623) (-1287.389) [-1279.016] (-1279.239) * (-1279.987) [-1279.674] (-1283.056) (-1283.707) -- 0:00:33
476500 -- (-1280.203) (-1284.766) [-1280.939] (-1281.980) * [-1279.975] (-1279.730) (-1280.475) (-1281.948) -- 0:00:32
477000 -- (-1280.715) (-1284.454) [-1281.373] (-1281.103) * [-1279.554] (-1282.368) (-1281.951) (-1280.290) -- 0:00:32
477500 -- (-1283.702) [-1283.792] (-1281.660) (-1281.688) * (-1279.180) (-1279.323) [-1281.481] (-1280.047) -- 0:00:32
478000 -- (-1282.242) (-1282.601) (-1280.583) [-1279.745] * (-1282.692) [-1279.600] (-1282.321) (-1284.846) -- 0:00:32
478500 -- [-1280.021] (-1280.446) (-1280.417) (-1280.793) * (-1280.905) [-1285.082] (-1281.419) (-1286.757) -- 0:00:32
479000 -- (-1283.245) (-1282.621) [-1282.495] (-1280.594) * [-1281.160] (-1284.860) (-1282.120) (-1284.780) -- 0:00:32
479500 -- (-1278.973) (-1283.538) [-1282.958] (-1281.283) * (-1279.631) (-1280.902) [-1279.619] (-1283.690) -- 0:00:32
480000 -- (-1280.808) (-1281.370) [-1283.105] (-1279.388) * (-1280.086) (-1288.643) [-1279.135] (-1281.362) -- 0:00:32
Average standard deviation of split frequencies: 0.008827
480500 -- (-1281.548) (-1280.326) [-1281.753] (-1282.250) * [-1282.084] (-1281.025) (-1281.502) (-1282.259) -- 0:00:32
481000 -- (-1281.873) (-1285.624) [-1282.982] (-1279.348) * (-1283.559) (-1283.058) (-1281.545) [-1279.993] -- 0:00:33
481500 -- (-1281.287) [-1281.473] (-1281.128) (-1281.213) * (-1283.932) (-1283.399) [-1279.724] (-1283.989) -- 0:00:33
482000 -- [-1279.520] (-1286.298) (-1279.628) (-1279.403) * (-1282.144) (-1280.630) (-1279.596) [-1279.430] -- 0:00:33
482500 -- (-1280.552) (-1283.011) [-1280.785] (-1282.043) * [-1280.196] (-1279.538) (-1283.602) (-1281.209) -- 0:00:33
483000 -- (-1280.588) (-1285.785) (-1280.052) [-1282.305] * (-1283.659) (-1280.079) (-1283.161) [-1279.645] -- 0:00:33
483500 -- (-1279.851) (-1286.669) [-1283.234] (-1281.360) * [-1280.725] (-1279.117) (-1280.437) (-1280.243) -- 0:00:33
484000 -- (-1284.593) (-1286.033) (-1281.735) [-1283.358] * (-1281.028) [-1279.613] (-1280.566) (-1281.663) -- 0:00:33
484500 -- (-1285.758) (-1280.337) (-1280.804) [-1279.298] * [-1280.034] (-1280.387) (-1280.494) (-1281.138) -- 0:00:32
485000 -- (-1281.095) [-1283.278] (-1279.831) (-1280.063) * (-1282.978) [-1279.647] (-1281.021) (-1280.500) -- 0:00:32
Average standard deviation of split frequencies: 0.008730
485500 -- (-1285.779) [-1281.937] (-1280.638) (-1279.970) * [-1283.425] (-1282.865) (-1279.683) (-1280.174) -- 0:00:32
486000 -- (-1280.664) (-1282.510) (-1279.202) [-1282.547] * [-1281.409] (-1286.863) (-1279.868) (-1281.738) -- 0:00:32
486500 -- (-1281.671) (-1282.833) (-1279.767) [-1282.597] * (-1280.687) (-1280.648) (-1280.030) [-1283.160] -- 0:00:32
487000 -- (-1282.414) (-1281.710) [-1279.324] (-1283.256) * (-1285.239) (-1280.664) [-1281.245] (-1283.569) -- 0:00:32
487500 -- (-1282.505) (-1281.256) [-1281.202] (-1283.054) * (-1285.905) (-1280.451) [-1283.955] (-1284.124) -- 0:00:32
488000 -- (-1283.266) [-1281.244] (-1281.930) (-1281.680) * [-1283.275] (-1279.860) (-1282.500) (-1283.256) -- 0:00:32
488500 -- [-1286.980] (-1282.974) (-1281.708) (-1279.405) * [-1285.254] (-1282.492) (-1279.550) (-1285.227) -- 0:00:32
489000 -- (-1285.289) (-1282.111) [-1281.885] (-1279.388) * [-1280.590] (-1283.170) (-1284.128) (-1279.889) -- 0:00:32
489500 -- (-1286.476) [-1280.532] (-1281.945) (-1279.930) * (-1281.307) (-1283.804) (-1279.691) [-1280.500] -- 0:00:32
490000 -- (-1284.154) (-1283.262) (-1280.828) [-1279.917] * (-1282.957) (-1283.212) (-1279.691) [-1282.005] -- 0:00:32
Average standard deviation of split frequencies: 0.008046
490500 -- (-1280.298) [-1282.596] (-1282.009) (-1281.976) * [-1281.529] (-1281.566) (-1279.710) (-1280.014) -- 0:00:32
491000 -- (-1281.543) (-1281.068) [-1281.506] (-1283.578) * [-1283.036] (-1281.834) (-1282.338) (-1280.958) -- 0:00:32
491500 -- (-1285.274) (-1283.013) [-1280.207] (-1287.235) * (-1281.901) (-1281.336) [-1283.404] (-1279.982) -- 0:00:32
492000 -- (-1283.712) (-1282.118) [-1281.156] (-1281.066) * (-1283.455) (-1280.638) (-1281.769) [-1279.112] -- 0:00:32
492500 -- [-1280.010] (-1281.453) (-1279.612) (-1283.056) * (-1283.541) [-1280.075] (-1281.773) (-1279.182) -- 0:00:31
493000 -- (-1280.050) (-1283.057) (-1281.390) [-1281.601] * (-1284.896) [-1279.703] (-1279.716) (-1280.524) -- 0:00:31
493500 -- [-1280.005] (-1280.911) (-1284.606) (-1285.229) * (-1284.460) (-1281.010) [-1279.846] (-1280.562) -- 0:00:31
494000 -- (-1281.150) (-1285.412) (-1282.775) [-1284.007] * [-1281.665] (-1280.844) (-1281.745) (-1281.917) -- 0:00:31
494500 -- (-1280.806) [-1280.731] (-1281.717) (-1280.114) * (-1280.573) (-1281.403) [-1283.808] (-1281.241) -- 0:00:31
495000 -- (-1279.514) (-1280.781) (-1281.072) [-1281.623] * (-1281.254) (-1282.826) [-1280.714] (-1284.354) -- 0:00:31
Average standard deviation of split frequencies: 0.008554
495500 -- [-1279.252] (-1282.952) (-1279.774) (-1282.207) * [-1281.126] (-1279.310) (-1280.322) (-1281.614) -- 0:00:31
496000 -- (-1280.041) [-1286.966] (-1281.710) (-1281.426) * (-1280.273) [-1280.366] (-1280.261) (-1280.398) -- 0:00:31
496500 -- [-1281.192] (-1279.461) (-1279.575) (-1281.521) * (-1282.087) (-1285.170) (-1282.522) [-1279.991] -- 0:00:32
497000 -- (-1282.237) (-1281.265) [-1281.472] (-1281.426) * (-1281.138) (-1280.012) [-1280.211] (-1280.050) -- 0:00:32
497500 -- (-1279.938) (-1284.012) (-1280.595) [-1280.593] * [-1280.325] (-1282.927) (-1282.971) (-1280.261) -- 0:00:32
498000 -- (-1280.427) (-1283.118) [-1285.673] (-1282.237) * (-1282.760) [-1280.392] (-1280.434) (-1281.474) -- 0:00:32
498500 -- (-1279.820) (-1282.020) [-1283.046] (-1282.950) * (-1280.373) [-1281.348] (-1281.622) (-1281.039) -- 0:00:32
499000 -- (-1281.386) (-1280.108) [-1280.527] (-1282.637) * (-1280.447) [-1281.890] (-1282.606) (-1282.168) -- 0:00:32
499500 -- (-1280.064) [-1280.087] (-1280.970) (-1283.339) * (-1281.480) [-1281.452] (-1281.543) (-1282.136) -- 0:00:32
500000 -- (-1280.402) (-1281.096) [-1279.870] (-1281.775) * (-1283.667) (-1280.926) (-1284.094) [-1282.010] -- 0:00:32
Average standard deviation of split frequencies: 0.009004
500500 -- [-1281.036] (-1285.783) (-1280.871) (-1280.496) * [-1281.387] (-1280.377) (-1285.578) (-1282.635) -- 0:00:31
501000 -- (-1282.048) (-1282.376) (-1281.823) [-1281.890] * (-1281.863) (-1279.477) [-1279.914] (-1286.152) -- 0:00:31
501500 -- [-1281.670] (-1280.483) (-1281.147) (-1281.215) * (-1283.568) (-1279.716) (-1279.132) [-1280.264] -- 0:00:31
502000 -- [-1280.411] (-1280.437) (-1284.781) (-1281.045) * (-1282.692) [-1280.164] (-1283.000) (-1281.362) -- 0:00:31
502500 -- (-1280.354) (-1281.306) (-1279.660) [-1280.140] * (-1285.401) (-1279.934) (-1282.109) [-1285.429] -- 0:00:31
503000 -- (-1280.705) (-1280.393) (-1280.116) [-1281.171] * [-1281.489] (-1280.843) (-1282.815) (-1281.580) -- 0:00:31
503500 -- (-1284.132) (-1281.703) [-1280.283] (-1281.865) * [-1279.467] (-1283.062) (-1282.441) (-1281.885) -- 0:00:31
504000 -- [-1282.934] (-1281.882) (-1281.048) (-1286.737) * [-1279.446] (-1290.716) (-1281.420) (-1281.048) -- 0:00:31
504500 -- [-1280.288] (-1281.677) (-1281.594) (-1285.565) * (-1279.827) (-1294.693) [-1280.293] (-1281.144) -- 0:00:31
505000 -- [-1279.508] (-1282.121) (-1283.131) (-1282.156) * (-1283.933) (-1284.702) [-1280.091] (-1281.026) -- 0:00:31
Average standard deviation of split frequencies: 0.008850
505500 -- (-1279.963) (-1282.189) [-1282.726] (-1281.273) * [-1282.295] (-1282.892) (-1279.441) (-1279.927) -- 0:00:31
506000 -- (-1279.430) (-1283.564) [-1285.487] (-1281.592) * [-1281.871] (-1282.774) (-1278.961) (-1279.668) -- 0:00:31
506500 -- (-1279.710) (-1281.187) (-1285.285) [-1279.675] * (-1290.011) [-1279.527] (-1279.561) (-1280.005) -- 0:00:31
507000 -- [-1279.556] (-1284.817) (-1282.363) (-1280.851) * (-1280.306) (-1279.649) [-1279.808] (-1280.292) -- 0:00:31
507500 -- [-1280.779] (-1282.634) (-1280.212) (-1281.273) * (-1280.584) [-1279.438] (-1280.947) (-1284.758) -- 0:00:31
508000 -- [-1279.838] (-1281.826) (-1280.778) (-1279.579) * [-1279.773] (-1280.243) (-1281.146) (-1279.233) -- 0:00:30
508500 -- (-1279.814) [-1282.231] (-1281.623) (-1285.228) * (-1280.935) [-1281.436] (-1285.725) (-1282.351) -- 0:00:30
509000 -- (-1280.667) (-1284.592) (-1281.672) [-1281.379] * [-1280.396] (-1281.420) (-1280.387) (-1282.963) -- 0:00:30
509500 -- (-1280.947) (-1283.624) (-1280.153) [-1279.189] * (-1280.114) [-1281.008] (-1281.462) (-1284.371) -- 0:00:30
510000 -- (-1280.504) [-1282.727] (-1279.990) (-1281.925) * (-1280.588) (-1280.791) [-1281.995] (-1288.691) -- 0:00:30
Average standard deviation of split frequencies: 0.008597
510500 -- (-1282.027) (-1281.591) (-1282.733) [-1287.080] * [-1280.040] (-1283.006) (-1282.975) (-1281.485) -- 0:00:30
511000 -- [-1281.231] (-1279.656) (-1280.049) (-1287.008) * (-1280.754) (-1282.713) [-1282.783] (-1281.667) -- 0:00:30
511500 -- [-1281.372] (-1279.909) (-1280.482) (-1279.859) * (-1282.548) (-1280.162) (-1280.101) [-1281.171] -- 0:00:30
512000 -- (-1280.054) [-1280.515] (-1281.014) (-1280.414) * (-1281.047) (-1280.350) [-1283.851] (-1283.217) -- 0:00:31
512500 -- (-1280.152) [-1279.889] (-1280.416) (-1285.485) * [-1282.191] (-1280.154) (-1281.153) (-1280.018) -- 0:00:31
513000 -- (-1280.922) (-1280.201) (-1280.530) [-1281.596] * (-1281.889) (-1282.662) [-1280.259] (-1280.013) -- 0:00:31
513500 -- (-1282.086) (-1280.781) [-1280.706] (-1281.323) * (-1281.409) (-1280.856) [-1281.865] (-1280.170) -- 0:00:31
514000 -- [-1280.283] (-1280.424) (-1280.955) (-1282.428) * (-1281.198) (-1281.551) (-1284.139) [-1280.882] -- 0:00:31
514500 -- [-1279.772] (-1285.789) (-1282.009) (-1280.855) * (-1279.629) [-1279.588] (-1281.074) (-1280.296) -- 0:00:31
515000 -- (-1279.300) (-1280.334) (-1283.758) [-1281.060] * (-1280.258) (-1279.929) [-1280.248] (-1282.061) -- 0:00:31
Average standard deviation of split frequencies: 0.008279
515500 -- (-1280.667) (-1279.402) [-1280.049] (-1281.393) * [-1279.892] (-1286.959) (-1280.934) (-1281.562) -- 0:00:31
516000 -- (-1284.013) [-1281.537] (-1280.515) (-1282.731) * (-1283.744) (-1281.881) (-1280.164) [-1281.035] -- 0:00:30
516500 -- (-1279.012) [-1282.186] (-1279.922) (-1282.103) * [-1281.857] (-1279.480) (-1280.941) (-1281.229) -- 0:00:30
517000 -- (-1279.070) (-1281.906) (-1280.352) [-1283.812] * [-1284.412] (-1281.817) (-1281.058) (-1279.892) -- 0:00:30
517500 -- (-1279.901) [-1281.880] (-1281.267) (-1281.864) * (-1284.861) [-1281.284] (-1283.059) (-1281.240) -- 0:00:30
518000 -- [-1280.736] (-1285.664) (-1282.758) (-1280.038) * (-1286.202) (-1279.252) (-1283.404) [-1284.838] -- 0:00:30
518500 -- (-1282.743) (-1285.346) (-1284.205) [-1279.727] * (-1281.492) (-1281.910) (-1284.440) [-1282.180] -- 0:00:30
519000 -- (-1281.982) (-1280.039) (-1283.372) [-1281.680] * (-1285.493) [-1281.813] (-1282.584) (-1284.266) -- 0:00:30
519500 -- (-1283.272) (-1281.195) [-1281.672] (-1281.489) * (-1283.267) (-1282.416) (-1282.793) [-1279.848] -- 0:00:30
520000 -- (-1281.076) (-1282.831) (-1280.616) [-1280.762] * (-1280.504) [-1280.263] (-1281.468) (-1279.755) -- 0:00:30
Average standard deviation of split frequencies: 0.008884
520500 -- (-1282.540) [-1283.335] (-1281.502) (-1280.390) * [-1280.458] (-1282.855) (-1279.890) (-1286.382) -- 0:00:30
521000 -- [-1280.853] (-1281.032) (-1280.477) (-1283.270) * [-1280.411] (-1279.898) (-1279.903) (-1280.984) -- 0:00:30
521500 -- (-1280.405) [-1280.353] (-1286.480) (-1287.592) * [-1279.968] (-1285.026) (-1280.230) (-1282.249) -- 0:00:30
522000 -- (-1280.358) (-1282.419) [-1280.550] (-1279.424) * [-1280.387] (-1281.217) (-1279.057) (-1284.304) -- 0:00:30
522500 -- (-1282.147) (-1281.204) [-1280.132] (-1279.856) * (-1280.361) (-1280.862) [-1286.635] (-1283.618) -- 0:00:30
523000 -- (-1282.197) (-1283.729) [-1281.931] (-1282.285) * (-1281.278) [-1281.062] (-1281.615) (-1283.139) -- 0:00:30
523500 -- (-1281.088) (-1282.575) [-1280.398] (-1281.201) * (-1281.465) [-1283.654] (-1283.552) (-1282.374) -- 0:00:30
524000 -- [-1281.375] (-1282.445) (-1280.455) (-1280.801) * [-1280.100] (-1281.983) (-1279.414) (-1282.088) -- 0:00:29
524500 -- (-1282.447) (-1282.185) (-1280.394) [-1282.788] * (-1280.713) (-1280.934) (-1280.353) [-1279.669] -- 0:00:29
525000 -- (-1279.721) [-1280.732] (-1280.813) (-1282.074) * (-1280.634) (-1282.904) (-1285.670) [-1279.891] -- 0:00:29
Average standard deviation of split frequencies: 0.008906
525500 -- [-1279.723] (-1281.772) (-1280.552) (-1281.753) * (-1281.269) [-1286.261] (-1284.931) (-1282.949) -- 0:00:29
526000 -- (-1279.787) [-1284.358] (-1282.496) (-1280.384) * (-1282.445) [-1282.783] (-1282.320) (-1281.204) -- 0:00:29
526500 -- (-1280.902) (-1283.286) (-1280.079) [-1280.554] * [-1283.135] (-1281.806) (-1283.107) (-1280.857) -- 0:00:29
527000 -- (-1282.095) (-1279.714) (-1281.177) [-1279.868] * (-1282.277) [-1280.407] (-1282.201) (-1279.863) -- 0:00:29
527500 -- (-1280.221) (-1279.529) [-1280.548] (-1280.854) * (-1279.855) (-1281.096) [-1280.602] (-1279.577) -- 0:00:29
528000 -- (-1280.585) [-1279.905] (-1283.044) (-1280.680) * (-1280.413) (-1281.555) (-1279.281) [-1281.771] -- 0:00:30
528500 -- [-1282.623] (-1281.836) (-1280.887) (-1280.860) * (-1280.275) [-1279.904] (-1283.026) (-1287.396) -- 0:00:30
529000 -- (-1280.178) (-1279.751) [-1280.796] (-1282.803) * (-1280.338) (-1285.500) (-1280.749) [-1280.055] -- 0:00:30
529500 -- (-1281.802) (-1279.856) [-1281.455] (-1282.307) * (-1280.243) [-1280.181] (-1281.296) (-1282.416) -- 0:00:30
530000 -- (-1281.801) (-1280.377) (-1282.781) [-1280.487] * (-1280.474) (-1279.630) [-1281.561] (-1288.742) -- 0:00:30
Average standard deviation of split frequencies: 0.009216
530500 -- (-1284.324) (-1279.232) (-1281.992) [-1280.009] * (-1279.929) (-1279.635) [-1282.546] (-1282.887) -- 0:00:30
531000 -- (-1283.157) (-1279.785) [-1282.136] (-1280.546) * [-1279.180] (-1280.495) (-1281.389) (-1283.858) -- 0:00:30
531500 -- (-1279.868) (-1280.012) (-1285.297) [-1283.168] * (-1281.518) (-1280.015) [-1282.713] (-1282.540) -- 0:00:29
532000 -- (-1280.833) [-1280.064] (-1284.668) (-1282.321) * (-1283.184) [-1279.266] (-1280.357) (-1282.963) -- 0:00:29
532500 -- [-1281.241] (-1281.139) (-1285.162) (-1284.332) * (-1283.438) (-1279.765) [-1280.868] (-1279.924) -- 0:00:29
533000 -- (-1280.969) (-1279.971) (-1282.460) [-1281.485] * (-1281.518) (-1280.096) [-1280.734] (-1279.838) -- 0:00:29
533500 -- [-1283.893] (-1281.760) (-1280.255) (-1279.498) * [-1280.427] (-1280.251) (-1280.290) (-1280.640) -- 0:00:29
534000 -- (-1281.919) [-1280.753] (-1280.833) (-1281.283) * (-1279.929) (-1280.350) (-1280.586) [-1282.088] -- 0:00:29
534500 -- [-1279.587] (-1280.949) (-1282.824) (-1282.407) * (-1283.018) (-1284.830) [-1282.633] (-1279.511) -- 0:00:29
535000 -- (-1280.538) (-1280.764) (-1280.397) [-1282.822] * (-1281.849) (-1280.220) (-1281.186) [-1281.510] -- 0:00:29
Average standard deviation of split frequencies: 0.009312
535500 -- [-1280.661] (-1280.387) (-1280.502) (-1282.295) * (-1282.596) (-1279.443) [-1281.808] (-1281.507) -- 0:00:29
536000 -- (-1280.345) (-1280.576) (-1281.727) [-1283.168] * (-1281.057) (-1281.813) (-1280.985) [-1280.118] -- 0:00:29
536500 -- (-1279.173) [-1279.708] (-1280.123) (-1280.427) * (-1280.588) (-1282.062) (-1280.143) [-1279.539] -- 0:00:29
537000 -- (-1280.325) [-1280.380] (-1279.570) (-1280.951) * [-1281.317] (-1282.330) (-1288.911) (-1279.765) -- 0:00:29
537500 -- [-1279.817] (-1279.689) (-1281.776) (-1282.777) * (-1280.197) (-1279.758) (-1283.790) [-1279.988] -- 0:00:29
538000 -- (-1281.283) [-1279.725] (-1282.209) (-1280.465) * (-1281.452) (-1279.137) [-1281.980] (-1279.670) -- 0:00:29
538500 -- (-1282.654) (-1280.044) (-1281.834) [-1283.323] * (-1282.482) (-1279.534) (-1281.878) [-1279.002] -- 0:00:29
539000 -- (-1284.692) (-1282.152) [-1281.245] (-1281.751) * (-1280.139) (-1282.284) (-1282.808) [-1280.966] -- 0:00:29
539500 -- (-1280.102) (-1280.858) [-1284.513] (-1280.196) * (-1280.767) (-1280.998) [-1282.600] (-1279.708) -- 0:00:29
540000 -- (-1280.953) (-1280.115) [-1279.584] (-1280.668) * (-1281.423) [-1284.156] (-1280.905) (-1280.010) -- 0:00:28
Average standard deviation of split frequencies: 0.010155
540500 -- (-1279.844) (-1282.051) [-1280.479] (-1280.488) * (-1282.706) (-1284.041) [-1280.984] (-1282.331) -- 0:00:28
541000 -- (-1279.678) (-1282.450) [-1288.680] (-1283.502) * (-1282.199) [-1281.162] (-1279.163) (-1282.026) -- 0:00:28
541500 -- (-1282.438) [-1282.432] (-1283.480) (-1283.972) * (-1283.090) (-1282.383) [-1280.799] (-1282.655) -- 0:00:28
542000 -- (-1280.446) (-1282.427) (-1282.073) [-1283.380] * (-1282.634) (-1281.679) [-1280.979] (-1281.255) -- 0:00:28
542500 -- (-1282.273) (-1284.690) [-1279.953] (-1281.423) * (-1282.116) [-1279.425] (-1284.378) (-1281.217) -- 0:00:28
543000 -- (-1279.866) (-1283.280) (-1280.517) [-1281.875] * (-1284.360) (-1284.060) (-1282.483) [-1280.478] -- 0:00:28
543500 -- (-1280.432) (-1284.184) (-1281.715) [-1282.138] * [-1283.689] (-1281.429) (-1285.785) (-1281.448) -- 0:00:28
544000 -- (-1281.639) (-1282.687) (-1281.570) [-1280.308] * (-1283.598) (-1280.236) [-1283.111] (-1282.687) -- 0:00:29
544500 -- (-1283.211) [-1283.503] (-1282.173) (-1279.742) * (-1281.704) (-1282.941) (-1280.099) [-1279.913] -- 0:00:29
545000 -- (-1280.612) (-1283.258) (-1283.384) [-1280.323] * (-1284.901) [-1280.305] (-1280.564) (-1280.716) -- 0:00:29
Average standard deviation of split frequencies: 0.010208
545500 -- (-1281.116) [-1282.297] (-1279.492) (-1281.840) * (-1280.811) (-1282.965) (-1281.186) [-1280.456] -- 0:00:29
546000 -- (-1282.079) [-1280.785] (-1283.263) (-1280.369) * (-1279.658) (-1284.445) (-1284.454) [-1281.194] -- 0:00:29
546500 -- (-1281.427) (-1280.866) (-1284.566) [-1280.264] * [-1287.411] (-1281.817) (-1283.149) (-1281.813) -- 0:00:29
547000 -- [-1281.047] (-1282.539) (-1281.137) (-1280.650) * (-1282.665) (-1283.314) (-1284.314) [-1281.606] -- 0:00:28
547500 -- [-1281.612] (-1282.676) (-1281.422) (-1280.097) * (-1283.388) (-1279.730) (-1282.544) [-1281.708] -- 0:00:28
548000 -- (-1283.890) (-1281.776) [-1283.488] (-1281.429) * [-1280.771] (-1280.106) (-1280.528) (-1288.869) -- 0:00:28
548500 -- (-1280.843) (-1281.706) [-1279.920] (-1283.324) * (-1280.587) (-1284.668) (-1282.176) [-1282.245] -- 0:00:28
549000 -- (-1283.477) (-1282.090) [-1282.439] (-1290.287) * (-1280.353) [-1284.446] (-1285.153) (-1283.853) -- 0:00:28
549500 -- [-1286.611] (-1282.063) (-1283.551) (-1286.145) * [-1279.544] (-1283.392) (-1280.879) (-1283.514) -- 0:00:28
550000 -- (-1280.725) [-1283.819] (-1279.535) (-1285.358) * (-1283.619) (-1279.683) [-1279.650] (-1281.534) -- 0:00:28
Average standard deviation of split frequencies: 0.010172
550500 -- [-1281.328] (-1283.753) (-1279.607) (-1284.755) * (-1282.408) (-1280.717) [-1280.002] (-1285.434) -- 0:00:28
551000 -- (-1280.792) (-1281.957) (-1280.313) [-1281.310] * (-1282.849) [-1279.995] (-1280.105) (-1286.657) -- 0:00:28
551500 -- (-1280.124) (-1280.675) [-1279.498] (-1280.513) * [-1281.382] (-1284.179) (-1286.692) (-1281.838) -- 0:00:28
552000 -- (-1280.613) (-1284.135) [-1281.152] (-1280.150) * (-1283.788) (-1281.208) (-1283.609) [-1279.157] -- 0:00:28
552500 -- [-1281.250] (-1283.782) (-1279.711) (-1283.092) * (-1282.402) [-1282.035] (-1280.933) (-1281.022) -- 0:00:28
553000 -- [-1280.068] (-1281.431) (-1279.354) (-1279.638) * [-1282.755] (-1283.948) (-1280.890) (-1287.640) -- 0:00:28
553500 -- [-1279.756] (-1282.228) (-1279.938) (-1279.820) * [-1279.420] (-1282.346) (-1279.706) (-1285.860) -- 0:00:28
554000 -- (-1280.410) (-1282.114) [-1279.896] (-1279.025) * (-1280.433) (-1280.940) [-1283.022] (-1284.097) -- 0:00:28
554500 -- (-1279.878) (-1281.717) [-1279.840] (-1282.196) * (-1281.747) (-1279.983) (-1280.678) [-1279.932] -- 0:00:28
555000 -- [-1279.323] (-1283.758) (-1279.709) (-1284.715) * (-1282.505) (-1284.891) [-1281.220] (-1279.311) -- 0:00:28
Average standard deviation of split frequencies: 0.010124
555500 -- [-1282.039] (-1281.674) (-1280.951) (-1280.815) * (-1282.152) (-1285.383) (-1282.121) [-1280.944] -- 0:00:28
556000 -- [-1280.789] (-1281.053) (-1281.672) (-1279.970) * [-1280.697] (-1284.447) (-1280.777) (-1282.828) -- 0:00:27
556500 -- [-1284.279] (-1280.047) (-1280.755) (-1281.310) * (-1279.931) (-1283.363) (-1280.476) [-1279.961] -- 0:00:27
557000 -- (-1280.835) (-1280.678) [-1280.188] (-1281.206) * (-1282.503) (-1281.107) [-1281.388] (-1280.546) -- 0:00:27
557500 -- [-1281.576] (-1279.705) (-1282.004) (-1280.951) * (-1282.877) [-1279.630] (-1279.616) (-1279.379) -- 0:00:27
558000 -- (-1280.377) [-1280.489] (-1281.564) (-1284.609) * (-1281.811) (-1279.631) (-1282.214) [-1279.770] -- 0:00:27
558500 -- (-1282.572) [-1281.085] (-1280.967) (-1283.118) * (-1280.139) (-1284.748) [-1283.991] (-1279.547) -- 0:00:27
559000 -- (-1285.528) (-1280.423) [-1280.553] (-1280.313) * [-1280.605] (-1281.109) (-1284.865) (-1279.901) -- 0:00:27
559500 -- (-1283.085) (-1280.386) [-1282.189] (-1279.125) * [-1279.682] (-1279.670) (-1279.793) (-1283.337) -- 0:00:27
560000 -- (-1282.868) [-1280.025] (-1282.294) (-1280.127) * (-1279.913) (-1279.705) [-1279.495] (-1281.671) -- 0:00:28
Average standard deviation of split frequencies: 0.010337
560500 -- (-1285.032) (-1280.878) (-1280.073) [-1279.931] * (-1279.770) (-1279.969) [-1280.276] (-1283.236) -- 0:00:28
561000 -- [-1284.318] (-1281.071) (-1281.366) (-1282.360) * (-1279.772) (-1287.086) [-1281.918] (-1280.424) -- 0:00:28
561500 -- (-1281.041) [-1283.089] (-1286.263) (-1279.505) * (-1279.124) (-1284.652) [-1280.649] (-1280.448) -- 0:00:28
562000 -- (-1280.544) (-1282.675) (-1286.420) [-1279.500] * (-1282.699) [-1279.568] (-1283.018) (-1280.030) -- 0:00:28
562500 -- [-1279.847] (-1282.692) (-1284.324) (-1279.450) * (-1279.598) [-1279.231] (-1282.567) (-1279.762) -- 0:00:28
563000 -- (-1284.781) (-1279.906) [-1282.302] (-1282.669) * [-1280.205] (-1281.398) (-1281.586) (-1282.411) -- 0:00:27
563500 -- (-1282.331) (-1280.952) (-1283.166) [-1280.369] * (-1280.078) (-1280.707) (-1280.878) [-1279.501] -- 0:00:27
564000 -- (-1287.478) [-1279.381] (-1281.331) (-1282.108) * (-1281.718) (-1281.209) (-1281.557) [-1280.017] -- 0:00:27
564500 -- [-1282.124] (-1280.639) (-1280.302) (-1283.200) * (-1283.933) [-1281.943] (-1279.416) (-1282.006) -- 0:00:27
565000 -- (-1282.634) (-1282.287) (-1280.626) [-1281.944] * (-1281.664) (-1286.199) [-1279.422] (-1279.948) -- 0:00:27
Average standard deviation of split frequencies: 0.010288
565500 -- [-1280.392] (-1282.624) (-1283.516) (-1281.513) * (-1283.729) (-1282.033) [-1279.960] (-1283.492) -- 0:00:27
566000 -- [-1280.190] (-1287.789) (-1281.864) (-1280.043) * (-1282.875) [-1281.363] (-1279.758) (-1282.097) -- 0:00:27
566500 -- (-1283.173) [-1281.065] (-1280.846) (-1280.050) * (-1285.107) [-1280.423] (-1281.339) (-1280.500) -- 0:00:27
567000 -- [-1279.427] (-1282.822) (-1281.273) (-1280.237) * [-1282.702] (-1280.301) (-1284.593) (-1280.652) -- 0:00:27
567500 -- (-1281.531) (-1280.794) [-1281.256] (-1281.060) * [-1282.814] (-1281.886) (-1280.510) (-1280.514) -- 0:00:27
568000 -- (-1283.924) [-1281.807] (-1282.593) (-1283.921) * (-1280.592) (-1285.535) (-1280.116) [-1279.285] -- 0:00:27
568500 -- [-1279.850] (-1282.972) (-1280.238) (-1279.859) * (-1284.864) (-1279.760) (-1279.479) [-1279.404] -- 0:00:27
569000 -- (-1287.378) [-1280.576] (-1283.220) (-1281.356) * (-1281.723) (-1280.696) (-1280.209) [-1279.547] -- 0:00:27
569500 -- (-1281.085) [-1280.304] (-1280.389) (-1282.564) * [-1283.474] (-1281.528) (-1281.456) (-1281.254) -- 0:00:27
570000 -- (-1281.176) (-1280.383) [-1280.293] (-1282.214) * (-1282.207) [-1280.203] (-1281.153) (-1281.471) -- 0:00:27
Average standard deviation of split frequencies: 0.010544
570500 -- (-1280.499) [-1281.408] (-1282.374) (-1279.487) * (-1281.241) [-1281.211] (-1282.433) (-1282.235) -- 0:00:27
571000 -- (-1280.212) [-1281.955] (-1280.870) (-1279.649) * [-1280.927] (-1281.122) (-1280.458) (-1282.332) -- 0:00:27
571500 -- (-1282.405) [-1281.404] (-1281.805) (-1280.573) * (-1281.168) (-1282.547) (-1282.637) [-1282.134] -- 0:00:26
572000 -- (-1280.790) (-1285.037) [-1280.011] (-1282.101) * (-1283.966) (-1279.993) (-1281.993) [-1281.748] -- 0:00:26
572500 -- (-1281.256) [-1280.300] (-1283.734) (-1279.927) * [-1285.155] (-1283.056) (-1282.070) (-1280.998) -- 0:00:26
573000 -- (-1281.755) (-1282.915) (-1280.944) [-1280.936] * (-1281.527) (-1282.269) [-1281.271] (-1279.660) -- 0:00:26
573500 -- [-1281.252] (-1281.479) (-1285.961) (-1280.586) * (-1282.106) [-1280.533] (-1280.627) (-1280.585) -- 0:00:26
574000 -- (-1282.337) (-1282.677) (-1280.979) [-1279.624] * [-1279.951] (-1283.383) (-1282.692) (-1284.863) -- 0:00:26
574500 -- (-1281.103) (-1281.675) (-1281.368) [-1279.544] * (-1280.583) (-1282.564) [-1280.484] (-1286.848) -- 0:00:26
575000 -- (-1281.812) [-1282.373] (-1280.699) (-1283.951) * (-1280.707) [-1282.958] (-1279.498) (-1281.914) -- 0:00:26
Average standard deviation of split frequencies: 0.011410
575500 -- (-1281.614) (-1281.140) [-1279.317] (-1288.534) * (-1281.739) (-1279.618) (-1280.443) [-1283.206] -- 0:00:26
576000 -- (-1283.398) (-1282.288) [-1280.267] (-1283.916) * (-1282.497) (-1282.245) [-1280.145] (-1280.702) -- 0:00:27
576500 -- (-1283.533) (-1285.266) (-1280.823) [-1280.055] * (-1283.123) (-1280.485) (-1280.687) [-1279.945] -- 0:00:27
577000 -- (-1280.212) [-1282.119] (-1282.898) (-1279.445) * (-1279.931) (-1283.466) (-1281.900) [-1280.212] -- 0:00:27
577500 -- (-1282.644) [-1280.157] (-1281.789) (-1280.568) * (-1279.621) [-1279.691] (-1283.211) (-1282.597) -- 0:00:27
578000 -- [-1282.029] (-1284.443) (-1283.835) (-1281.107) * (-1281.405) (-1279.571) (-1282.371) [-1280.382] -- 0:00:27
578500 -- (-1282.485) (-1281.802) (-1280.273) [-1281.367] * (-1279.253) (-1282.528) [-1282.217] (-1280.298) -- 0:00:26
579000 -- (-1279.918) (-1280.514) [-1280.272] (-1281.207) * (-1282.292) (-1283.425) [-1282.317] (-1279.831) -- 0:00:26
579500 -- (-1279.980) (-1282.666) (-1280.785) [-1279.546] * [-1280.640] (-1282.629) (-1282.226) (-1279.709) -- 0:00:26
580000 -- (-1280.649) (-1284.572) (-1278.953) [-1281.134] * (-1281.591) (-1282.109) (-1280.034) [-1280.644] -- 0:00:26
Average standard deviation of split frequencies: 0.011461
580500 -- [-1280.071] (-1282.519) (-1279.435) (-1282.810) * (-1280.633) (-1283.386) (-1282.669) [-1282.963] -- 0:00:26
581000 -- (-1280.220) (-1279.462) (-1279.265) [-1281.564] * (-1280.578) (-1280.327) [-1283.897] (-1280.354) -- 0:00:26
581500 -- (-1279.562) [-1280.214] (-1281.735) (-1281.305) * (-1285.753) [-1282.089] (-1282.417) (-1280.434) -- 0:00:26
582000 -- (-1284.335) [-1280.326] (-1283.377) (-1280.950) * [-1279.903] (-1281.853) (-1282.749) (-1280.922) -- 0:00:26
582500 -- [-1280.770] (-1282.202) (-1281.895) (-1285.428) * (-1284.016) [-1279.080] (-1280.498) (-1281.749) -- 0:00:26
583000 -- (-1281.652) (-1286.735) (-1280.034) [-1279.847] * (-1281.840) [-1279.492] (-1280.052) (-1279.754) -- 0:00:26
583500 -- (-1279.803) (-1281.764) [-1279.948] (-1280.266) * [-1281.543] (-1280.426) (-1280.532) (-1280.698) -- 0:00:26
584000 -- [-1280.422] (-1279.481) (-1281.387) (-1279.370) * (-1281.499) (-1283.617) (-1279.513) [-1281.205] -- 0:00:26
584500 -- (-1279.581) (-1280.986) (-1280.667) [-1280.040] * (-1280.581) [-1280.007] (-1283.304) (-1283.350) -- 0:00:26
585000 -- (-1281.398) [-1281.025] (-1280.562) (-1281.632) * (-1280.840) (-1279.986) (-1282.113) [-1284.905] -- 0:00:26
Average standard deviation of split frequencies: 0.010552
585500 -- (-1280.318) [-1280.970] (-1279.280) (-1281.754) * (-1280.082) (-1280.359) [-1282.137] (-1283.245) -- 0:00:26
586000 -- (-1281.547) (-1281.398) [-1279.167] (-1287.163) * (-1280.128) [-1281.778] (-1288.986) (-1281.098) -- 0:00:26
586500 -- (-1282.168) (-1281.120) (-1280.345) [-1291.081] * [-1282.784] (-1281.496) (-1282.473) (-1281.176) -- 0:00:26
587000 -- [-1284.204] (-1282.040) (-1281.563) (-1282.134) * [-1280.780] (-1279.513) (-1282.932) (-1280.930) -- 0:00:26
587500 -- [-1280.700] (-1280.817) (-1282.187) (-1281.974) * (-1288.928) (-1280.392) (-1283.996) [-1281.782] -- 0:00:25
588000 -- (-1282.429) (-1280.962) [-1282.280] (-1281.538) * (-1287.362) (-1281.099) [-1280.470] (-1281.016) -- 0:00:25
588500 -- (-1283.472) (-1282.314) (-1281.715) [-1281.164] * (-1282.415) (-1281.799) (-1280.769) [-1280.404] -- 0:00:25
589000 -- (-1282.258) [-1282.559] (-1280.233) (-1280.746) * (-1281.763) (-1290.718) [-1279.779] (-1280.874) -- 0:00:25
589500 -- (-1282.793) (-1281.951) [-1280.458] (-1282.483) * [-1281.465] (-1283.875) (-1280.392) (-1280.764) -- 0:00:25
590000 -- [-1280.934] (-1280.216) (-1280.662) (-1281.335) * (-1280.105) (-1282.225) [-1281.206] (-1279.474) -- 0:00:25
Average standard deviation of split frequencies: 0.010516
590500 -- (-1280.445) [-1279.300] (-1279.971) (-1282.514) * (-1282.933) [-1281.078] (-1280.084) (-1280.334) -- 0:00:25
591000 -- (-1281.388) (-1280.150) (-1280.431) [-1280.997] * (-1280.950) (-1285.502) [-1280.302] (-1280.368) -- 0:00:25
591500 -- (-1280.483) (-1279.707) (-1280.085) [-1283.109] * (-1285.032) (-1280.413) [-1279.636] (-1281.986) -- 0:00:25
592000 -- [-1281.631] (-1279.751) (-1279.884) (-1280.824) * (-1282.899) (-1281.865) [-1280.475] (-1283.276) -- 0:00:26
592500 -- [-1279.902] (-1280.488) (-1282.178) (-1281.784) * (-1280.091) [-1283.590] (-1280.800) (-1282.934) -- 0:00:26
593000 -- (-1280.325) (-1282.243) (-1280.812) [-1279.952] * [-1285.282] (-1282.254) (-1279.546) (-1279.745) -- 0:00:26
593500 -- (-1280.432) (-1280.940) (-1282.894) [-1281.024] * (-1281.610) (-1282.091) [-1279.405] (-1281.108) -- 0:00:26
594000 -- (-1280.518) [-1282.108] (-1284.988) (-1280.861) * (-1282.046) [-1281.680] (-1282.138) (-1281.565) -- 0:00:25
594500 -- [-1284.054] (-1283.120) (-1281.165) (-1279.700) * [-1281.811] (-1284.103) (-1281.773) (-1281.716) -- 0:00:25
595000 -- (-1280.125) (-1284.712) (-1281.694) [-1279.901] * (-1280.722) (-1281.421) [-1280.728] (-1281.903) -- 0:00:25
Average standard deviation of split frequencies: 0.010701
595500 -- (-1281.994) (-1281.675) (-1282.693) [-1279.710] * (-1279.578) (-1281.388) [-1280.610] (-1283.232) -- 0:00:25
596000 -- (-1281.414) (-1280.779) [-1282.515] (-1279.915) * (-1284.803) (-1284.071) (-1281.697) [-1284.812] -- 0:00:25
596500 -- (-1281.479) (-1281.464) (-1285.005) [-1282.664] * (-1280.092) [-1280.741] (-1285.025) (-1279.664) -- 0:00:25
597000 -- (-1280.175) [-1281.323] (-1283.287) (-1282.962) * (-1286.111) (-1282.114) (-1280.995) [-1279.407] -- 0:00:25
597500 -- (-1280.251) (-1280.670) [-1283.803] (-1288.713) * (-1281.386) [-1281.205] (-1279.707) (-1279.621) -- 0:00:25
598000 -- (-1281.129) [-1279.917] (-1281.696) (-1283.394) * (-1282.869) [-1279.982] (-1284.656) (-1279.206) -- 0:00:25
598500 -- (-1280.944) (-1281.524) (-1280.872) [-1284.158] * (-1281.010) (-1280.941) (-1282.882) [-1279.998] -- 0:00:25
599000 -- [-1283.583] (-1282.109) (-1281.641) (-1283.274) * [-1280.771] (-1279.780) (-1280.952) (-1279.714) -- 0:00:25
599500 -- (-1279.298) (-1281.036) [-1280.580] (-1282.460) * (-1279.313) (-1279.860) [-1279.961] (-1279.590) -- 0:00:25
600000 -- (-1280.549) (-1282.333) [-1279.292] (-1289.522) * [-1279.588] (-1279.408) (-1281.222) (-1284.295) -- 0:00:25
Average standard deviation of split frequencies: 0.011357
600500 -- (-1280.248) (-1281.118) (-1280.846) [-1281.148] * (-1280.362) [-1280.662] (-1281.898) (-1282.256) -- 0:00:25
601000 -- (-1280.966) [-1280.495] (-1279.965) (-1280.283) * [-1279.598] (-1280.193) (-1281.049) (-1282.026) -- 0:00:25
601500 -- (-1280.289) (-1283.617) (-1280.350) [-1279.969] * (-1279.648) [-1283.532] (-1279.947) (-1281.808) -- 0:00:25
602000 -- (-1281.528) (-1279.031) (-1281.781) [-1280.265] * (-1280.060) (-1281.962) (-1279.914) [-1283.205] -- 0:00:25
602500 -- (-1285.129) (-1282.780) (-1281.986) [-1282.731] * (-1280.570) (-1283.190) (-1279.668) [-1281.271] -- 0:00:25
603000 -- (-1283.021) [-1280.502] (-1280.265) (-1280.462) * (-1283.879) (-1286.254) [-1279.277] (-1279.365) -- 0:00:25
603500 -- (-1281.299) [-1280.693] (-1280.601) (-1280.561) * (-1280.786) (-1280.730) [-1279.200] (-1280.972) -- 0:00:24
604000 -- (-1284.691) (-1283.897) (-1279.518) [-1281.262] * (-1280.872) [-1280.186] (-1285.993) (-1279.810) -- 0:00:24
604500 -- [-1280.279] (-1279.200) (-1279.545) (-1282.166) * (-1279.739) (-1280.719) [-1280.162] (-1279.925) -- 0:00:24
605000 -- (-1282.934) [-1280.812] (-1280.471) (-1281.713) * (-1280.138) (-1279.404) (-1280.391) [-1281.327] -- 0:00:24
Average standard deviation of split frequencies: 0.010845
605500 -- (-1282.574) [-1283.269] (-1280.302) (-1279.342) * [-1281.615] (-1279.850) (-1279.656) (-1282.676) -- 0:00:24
606000 -- (-1282.129) [-1285.466] (-1283.594) (-1281.392) * (-1281.890) [-1279.622] (-1280.018) (-1284.236) -- 0:00:24
606500 -- (-1279.777) (-1281.168) [-1280.179] (-1281.227) * (-1279.803) [-1282.554] (-1280.875) (-1279.376) -- 0:00:24
607000 -- (-1280.268) (-1279.828) [-1281.169] (-1285.061) * (-1279.760) (-1281.305) (-1281.068) [-1280.227] -- 0:00:24
607500 -- (-1280.154) [-1279.546] (-1283.251) (-1280.031) * (-1279.525) [-1281.245] (-1280.669) (-1283.730) -- 0:00:24
608000 -- [-1280.828] (-1280.315) (-1283.675) (-1280.712) * [-1281.121] (-1279.853) (-1281.464) (-1281.857) -- 0:00:25
608500 -- (-1279.708) (-1285.195) [-1282.274] (-1280.984) * (-1279.401) (-1280.781) (-1281.405) [-1283.897] -- 0:00:25
609000 -- [-1280.470] (-1280.050) (-1282.504) (-1281.623) * [-1281.227] (-1280.470) (-1281.204) (-1281.262) -- 0:00:25
609500 -- (-1281.274) (-1279.610) (-1281.656) [-1284.157] * (-1281.201) (-1281.286) [-1282.100] (-1282.616) -- 0:00:24
610000 -- (-1280.433) (-1280.967) [-1280.516] (-1282.679) * (-1282.650) (-1280.209) (-1282.768) [-1282.770] -- 0:00:24
Average standard deviation of split frequencies: 0.010762
610500 -- (-1281.059) (-1283.454) (-1279.899) [-1279.355] * [-1280.225] (-1281.477) (-1281.639) (-1279.992) -- 0:00:24
611000 -- (-1280.108) (-1283.219) (-1280.450) [-1280.868] * (-1282.374) (-1282.799) (-1281.294) [-1280.638] -- 0:00:24
611500 -- (-1281.540) [-1280.857] (-1279.784) (-1281.509) * (-1281.544) [-1282.567] (-1281.294) (-1281.253) -- 0:00:24
612000 -- (-1279.977) (-1281.002) (-1280.800) [-1281.561] * (-1280.932) (-1288.119) [-1282.524] (-1282.339) -- 0:00:24
612500 -- (-1279.749) (-1283.977) [-1281.927] (-1279.526) * (-1282.900) (-1283.958) (-1281.844) [-1279.929] -- 0:00:24
613000 -- (-1279.827) (-1281.838) (-1282.705) [-1282.815] * (-1281.150) (-1281.379) [-1280.802] (-1285.933) -- 0:00:24
613500 -- [-1281.771] (-1283.940) (-1280.726) (-1283.603) * (-1281.604) (-1285.933) [-1280.629] (-1292.163) -- 0:00:24
614000 -- [-1285.073] (-1282.004) (-1280.256) (-1281.775) * (-1282.022) [-1282.024] (-1280.720) (-1286.782) -- 0:00:24
614500 -- (-1280.598) [-1280.354] (-1279.798) (-1280.125) * (-1281.053) (-1281.465) [-1281.066] (-1281.903) -- 0:00:24
615000 -- (-1280.853) [-1279.529] (-1283.711) (-1281.038) * (-1279.997) (-1280.241) (-1281.320) [-1283.136] -- 0:00:24
Average standard deviation of split frequencies: 0.010759
615500 -- (-1280.151) (-1281.522) [-1283.103] (-1283.038) * [-1279.233] (-1284.518) (-1285.122) (-1282.559) -- 0:00:24
616000 -- (-1279.369) [-1280.697] (-1284.430) (-1281.645) * (-1280.768) (-1280.630) [-1280.112] (-1280.286) -- 0:00:24
616500 -- (-1280.302) [-1280.371] (-1280.305) (-1279.377) * (-1282.073) [-1282.126] (-1282.354) (-1280.996) -- 0:00:24
617000 -- (-1279.133) (-1281.161) (-1281.322) [-1280.139] * (-1282.593) (-1281.707) (-1281.006) [-1280.425] -- 0:00:24
617500 -- [-1280.093] (-1283.223) (-1282.270) (-1282.312) * (-1284.983) (-1280.602) [-1281.023] (-1285.549) -- 0:00:24
618000 -- (-1284.543) (-1280.513) (-1282.069) [-1279.833] * (-1280.263) (-1280.496) [-1283.468] (-1282.980) -- 0:00:24
618500 -- (-1283.106) (-1280.977) [-1279.656] (-1280.070) * (-1282.210) [-1280.203] (-1280.979) (-1282.884) -- 0:00:24
619000 -- (-1282.550) [-1280.227] (-1282.912) (-1281.717) * (-1285.092) (-1280.106) (-1281.576) [-1283.212] -- 0:00:24
619500 -- (-1284.697) (-1279.897) [-1280.164] (-1282.459) * (-1282.821) [-1280.812] (-1281.842) (-1282.035) -- 0:00:23
620000 -- (-1279.915) (-1286.789) [-1279.561] (-1284.440) * (-1280.435) [-1281.280] (-1281.874) (-1283.099) -- 0:00:23
Average standard deviation of split frequencies: 0.011393
620500 -- (-1279.683) [-1280.105] (-1279.519) (-1281.639) * (-1284.812) [-1283.656] (-1279.057) (-1281.588) -- 0:00:23
621000 -- (-1279.980) (-1283.922) (-1279.763) [-1280.250] * (-1284.362) (-1279.139) (-1281.732) [-1282.604] -- 0:00:23
621500 -- (-1280.176) (-1280.730) (-1280.130) [-1280.347] * (-1281.001) (-1282.819) (-1281.822) [-1280.529] -- 0:00:23
622000 -- (-1280.283) [-1280.730] (-1280.627) (-1279.964) * (-1281.360) [-1281.983] (-1281.368) (-1279.487) -- 0:00:23
622500 -- (-1283.127) (-1284.660) (-1280.252) [-1280.439] * (-1284.761) [-1279.053] (-1280.697) (-1282.494) -- 0:00:23
623000 -- (-1279.862) (-1280.243) (-1280.551) [-1282.054] * (-1282.725) (-1279.413) [-1280.103] (-1284.403) -- 0:00:23
623500 -- (-1280.927) [-1280.290] (-1280.197) (-1280.768) * (-1281.121) (-1285.113) [-1280.036] (-1282.964) -- 0:00:23
624000 -- [-1280.584] (-1287.542) (-1280.351) (-1283.152) * [-1287.542] (-1281.903) (-1279.846) (-1280.132) -- 0:00:23
624500 -- (-1280.652) (-1281.195) (-1279.869) [-1280.784] * (-1286.443) (-1280.786) (-1279.802) [-1282.462] -- 0:00:24
625000 -- (-1282.027) (-1285.295) (-1279.978) [-1280.021] * (-1280.668) [-1279.112] (-1281.114) (-1279.771) -- 0:00:24
Average standard deviation of split frequencies: 0.011694
625500 -- (-1281.779) (-1279.857) [-1280.504] (-1281.231) * [-1281.422] (-1281.089) (-1283.122) (-1283.677) -- 0:00:23
626000 -- (-1284.096) (-1280.941) (-1280.072) [-1280.578] * (-1281.785) (-1283.666) (-1286.210) [-1281.172] -- 0:00:23
626500 -- (-1282.536) (-1280.552) [-1283.984] (-1283.643) * [-1280.455] (-1281.491) (-1280.429) (-1282.163) -- 0:00:23
627000 -- (-1280.597) [-1280.587] (-1281.013) (-1280.625) * (-1279.968) (-1282.104) (-1280.266) [-1286.524] -- 0:00:23
627500 -- (-1281.365) (-1280.454) [-1279.957] (-1282.100) * (-1286.396) [-1280.611] (-1280.626) (-1282.430) -- 0:00:23
628000 -- [-1280.216] (-1285.598) (-1279.597) (-1282.101) * (-1280.142) [-1285.766] (-1282.562) (-1280.297) -- 0:00:23
628500 -- (-1281.139) (-1282.098) [-1279.589] (-1281.007) * [-1283.945] (-1280.779) (-1281.726) (-1279.985) -- 0:00:23
629000 -- (-1281.214) [-1282.989] (-1279.157) (-1279.775) * (-1284.312) (-1280.051) (-1281.726) [-1282.886] -- 0:00:23
629500 -- (-1281.854) [-1282.525] (-1281.856) (-1280.463) * (-1281.916) (-1279.757) [-1281.928] (-1281.746) -- 0:00:23
630000 -- (-1282.074) [-1286.822] (-1281.430) (-1280.527) * [-1280.917] (-1279.891) (-1281.207) (-1280.535) -- 0:00:23
Average standard deviation of split frequencies: 0.011872
630500 -- (-1284.306) (-1282.372) (-1283.535) [-1279.756] * [-1283.172] (-1280.900) (-1281.981) (-1280.446) -- 0:00:23
631000 -- (-1281.746) (-1281.694) (-1284.298) [-1281.352] * [-1283.665] (-1283.142) (-1284.698) (-1280.876) -- 0:00:23
631500 -- (-1281.583) [-1282.654] (-1281.830) (-1280.527) * (-1281.751) (-1282.077) (-1280.713) [-1281.026] -- 0:00:23
632000 -- [-1285.609] (-1281.851) (-1281.504) (-1281.979) * [-1283.266] (-1281.498) (-1280.303) (-1280.283) -- 0:00:23
632500 -- (-1281.323) (-1283.440) [-1280.659] (-1282.718) * (-1284.298) [-1280.265] (-1283.447) (-1280.315) -- 0:00:23
633000 -- (-1282.395) (-1282.142) (-1283.370) [-1281.953] * (-1282.221) [-1284.042] (-1283.229) (-1281.394) -- 0:00:23
633500 -- (-1280.948) (-1282.186) (-1284.732) [-1282.539] * (-1283.504) (-1283.448) (-1283.158) [-1281.272] -- 0:00:23
634000 -- [-1284.891] (-1280.335) (-1281.797) (-1283.020) * [-1281.134] (-1280.050) (-1285.027) (-1282.165) -- 0:00:23
634500 -- (-1287.576) (-1280.759) [-1280.726] (-1285.286) * (-1282.922) [-1281.345] (-1285.027) (-1283.726) -- 0:00:23
635000 -- (-1286.280) (-1281.017) [-1283.113] (-1279.399) * (-1286.629) [-1280.257] (-1283.360) (-1283.247) -- 0:00:22
Average standard deviation of split frequencies: 0.011685
635500 -- (-1282.224) [-1279.791] (-1280.591) (-1282.214) * (-1280.652) (-1280.476) (-1285.168) [-1282.729] -- 0:00:22
636000 -- [-1279.430] (-1281.615) (-1279.875) (-1280.574) * [-1283.358] (-1280.692) (-1281.179) (-1282.595) -- 0:00:22
636500 -- (-1280.554) [-1285.108] (-1279.645) (-1281.371) * (-1281.398) [-1285.383] (-1279.487) (-1284.326) -- 0:00:22
637000 -- (-1281.713) (-1282.097) (-1281.077) [-1280.943] * (-1279.951) (-1282.784) [-1280.704] (-1282.272) -- 0:00:22
637500 -- (-1280.097) (-1281.806) [-1284.017] (-1283.365) * (-1282.672) [-1282.411] (-1280.268) (-1281.466) -- 0:00:22
638000 -- (-1281.436) (-1279.132) [-1280.269] (-1280.019) * (-1282.818) [-1279.706] (-1279.508) (-1279.815) -- 0:00:22
638500 -- (-1281.093) (-1282.945) [-1279.723] (-1281.439) * (-1281.964) (-1280.435) [-1280.314] (-1282.747) -- 0:00:22
639000 -- (-1280.957) (-1281.792) [-1279.786] (-1282.223) * [-1280.311] (-1285.461) (-1280.214) (-1279.771) -- 0:00:22
639500 -- [-1280.654] (-1281.899) (-1279.962) (-1281.895) * (-1279.807) [-1280.762] (-1280.214) (-1282.390) -- 0:00:22
640000 -- (-1280.745) (-1284.275) (-1281.178) [-1281.350] * (-1282.199) (-1287.835) (-1281.703) [-1283.686] -- 0:00:22
Average standard deviation of split frequencies: 0.012033
640500 -- (-1281.357) (-1286.770) [-1283.878] (-1280.828) * (-1281.117) (-1291.510) [-1283.102] (-1283.704) -- 0:00:23
641000 -- [-1282.100] (-1280.535) (-1280.957) (-1286.342) * (-1282.325) [-1289.811] (-1283.602) (-1279.340) -- 0:00:22
641500 -- (-1282.525) [-1283.072] (-1280.022) (-1281.322) * (-1284.873) (-1279.026) (-1281.880) [-1284.201] -- 0:00:22
642000 -- [-1281.273] (-1282.291) (-1285.685) (-1281.628) * (-1280.345) [-1281.872] (-1279.596) (-1280.722) -- 0:00:22
642500 -- (-1282.160) (-1279.389) (-1282.678) [-1280.609] * (-1280.292) [-1280.353] (-1282.385) (-1283.891) -- 0:00:22
643000 -- [-1282.125] (-1286.058) (-1281.812) (-1281.066) * (-1284.052) (-1283.687) [-1281.687] (-1280.525) -- 0:00:22
643500 -- (-1281.967) [-1286.259] (-1278.999) (-1279.646) * (-1281.333) [-1279.678] (-1280.794) (-1280.602) -- 0:00:22
644000 -- (-1283.571) (-1283.360) [-1279.008] (-1280.798) * [-1280.392] (-1282.657) (-1279.963) (-1280.755) -- 0:00:22
644500 -- [-1283.904] (-1282.588) (-1278.962) (-1282.386) * (-1280.224) [-1279.757] (-1280.042) (-1281.829) -- 0:00:22
645000 -- (-1284.886) [-1283.602] (-1279.508) (-1284.321) * (-1281.954) [-1279.313] (-1281.348) (-1280.413) -- 0:00:22
Average standard deviation of split frequencies: 0.011762
645500 -- (-1282.921) (-1279.290) [-1279.345] (-1286.223) * (-1284.126) [-1279.556] (-1279.774) (-1282.918) -- 0:00:22
646000 -- (-1283.717) [-1282.528] (-1279.382) (-1281.256) * (-1284.492) (-1281.621) (-1280.977) [-1281.832] -- 0:00:22
646500 -- [-1279.903] (-1279.366) (-1286.431) (-1280.441) * (-1281.746) (-1282.817) (-1282.398) [-1281.628] -- 0:00:22
647000 -- (-1280.140) (-1280.400) (-1281.922) [-1280.667] * (-1283.707) [-1280.561] (-1280.964) (-1283.039) -- 0:00:22
647500 -- [-1281.809] (-1282.040) (-1281.229) (-1282.991) * (-1280.831) (-1281.239) (-1280.099) [-1284.282] -- 0:00:22
648000 -- (-1282.024) (-1284.158) (-1281.740) [-1283.331] * (-1281.971) (-1280.916) (-1280.959) [-1280.810] -- 0:00:22
648500 -- (-1280.838) [-1281.936] (-1280.740) (-1278.940) * [-1280.803] (-1280.170) (-1281.997) (-1280.547) -- 0:00:22
649000 -- (-1282.934) [-1283.190] (-1280.325) (-1281.174) * (-1281.414) (-1283.365) (-1281.277) [-1283.109] -- 0:00:22
649500 -- (-1282.522) (-1280.887) [-1280.006] (-1282.358) * [-1280.008] (-1279.641) (-1283.487) (-1281.393) -- 0:00:22
650000 -- [-1281.797] (-1281.382) (-1280.655) (-1281.343) * (-1283.230) (-1280.776) [-1280.568] (-1280.561) -- 0:00:22
Average standard deviation of split frequencies: 0.012189
650500 -- [-1280.817] (-1287.165) (-1281.926) (-1280.100) * (-1280.348) (-1280.235) [-1280.601] (-1281.568) -- 0:00:22
651000 -- (-1280.949) [-1290.759] (-1283.103) (-1281.458) * (-1279.719) (-1281.193) (-1282.047) [-1282.538] -- 0:00:21
651500 -- (-1288.952) (-1284.341) (-1281.371) [-1280.656] * (-1283.792) (-1280.660) (-1279.611) [-1281.600] -- 0:00:21
652000 -- (-1288.146) (-1282.993) (-1281.671) [-1280.763] * (-1281.608) (-1282.523) [-1281.449] (-1281.530) -- 0:00:21
652500 -- [-1281.433] (-1280.474) (-1280.583) (-1281.200) * (-1281.028) [-1281.478] (-1281.002) (-1280.392) -- 0:00:21
653000 -- (-1285.907) [-1280.641] (-1284.479) (-1283.255) * (-1282.670) (-1279.801) (-1282.583) [-1281.694] -- 0:00:21
653500 -- [-1280.917] (-1284.795) (-1282.077) (-1281.592) * (-1281.869) (-1281.683) (-1283.988) [-1281.240] -- 0:00:21
654000 -- [-1280.266] (-1282.277) (-1279.832) (-1280.546) * [-1280.328] (-1285.683) (-1284.512) (-1281.104) -- 0:00:21
654500 -- (-1281.374) (-1279.659) [-1279.915] (-1279.477) * (-1281.118) (-1280.447) (-1285.006) [-1280.206] -- 0:00:21
655000 -- [-1279.238] (-1281.595) (-1281.388) (-1280.080) * [-1281.225] (-1282.141) (-1281.874) (-1280.555) -- 0:00:21
Average standard deviation of split frequencies: 0.012005
655500 -- (-1281.038) [-1279.493] (-1284.273) (-1284.702) * [-1280.871] (-1281.032) (-1281.994) (-1280.413) -- 0:00:21
656000 -- (-1280.045) (-1282.180) [-1282.141] (-1283.245) * (-1280.964) (-1283.667) (-1282.470) [-1282.915] -- 0:00:21
656500 -- (-1281.555) [-1280.004] (-1282.976) (-1280.498) * (-1282.196) [-1281.288] (-1280.885) (-1282.233) -- 0:00:21
657000 -- (-1280.741) (-1280.248) [-1280.097] (-1280.885) * [-1280.458] (-1280.274) (-1280.229) (-1281.597) -- 0:00:21
657500 -- (-1279.136) [-1282.774] (-1280.505) (-1284.072) * (-1282.973) (-1280.832) [-1285.248] (-1281.570) -- 0:00:21
658000 -- [-1283.454] (-1283.183) (-1282.061) (-1284.765) * (-1282.401) (-1279.554) [-1281.030] (-1286.257) -- 0:00:21
658500 -- [-1280.540] (-1282.821) (-1284.891) (-1280.810) * (-1284.069) [-1281.486] (-1280.647) (-1283.244) -- 0:00:21
659000 -- (-1282.382) (-1282.466) [-1282.242] (-1281.844) * (-1280.800) (-1281.497) (-1281.687) [-1281.740] -- 0:00:21
659500 -- [-1282.207] (-1283.557) (-1283.446) (-1280.357) * (-1281.971) (-1280.813) (-1282.941) [-1282.726] -- 0:00:21
660000 -- (-1286.806) (-1285.596) (-1283.289) [-1280.450] * (-1281.006) (-1280.455) (-1282.738) [-1281.365] -- 0:00:21
Average standard deviation of split frequencies: 0.011626
660500 -- (-1281.676) (-1285.218) [-1284.376] (-1280.025) * (-1283.881) (-1280.084) [-1282.339] (-1280.607) -- 0:00:21
661000 -- (-1282.814) [-1279.996] (-1280.781) (-1286.705) * (-1281.239) (-1279.845) [-1283.063] (-1280.441) -- 0:00:21
661500 -- (-1280.195) (-1285.851) (-1286.410) [-1285.117] * [-1282.162] (-1281.159) (-1283.755) (-1281.791) -- 0:00:21
662000 -- [-1279.187] (-1283.539) (-1281.086) (-1280.347) * (-1279.423) (-1281.108) (-1283.069) [-1280.449] -- 0:00:21
662500 -- (-1279.413) (-1282.383) (-1281.386) [-1280.928] * (-1282.371) [-1281.527] (-1281.644) (-1281.332) -- 0:00:21
663000 -- [-1278.965] (-1288.675) (-1281.644) (-1282.787) * [-1279.069] (-1282.298) (-1284.649) (-1282.295) -- 0:00:21
663500 -- (-1280.825) [-1281.007] (-1282.477) (-1281.403) * [-1279.069] (-1281.454) (-1281.807) (-1282.252) -- 0:00:21
664000 -- [-1287.035] (-1280.381) (-1282.294) (-1280.967) * (-1280.299) (-1281.468) [-1282.556] (-1280.386) -- 0:00:21
664500 -- (-1281.592) [-1281.526] (-1282.725) (-1280.039) * (-1284.138) (-1283.062) [-1287.812] (-1283.246) -- 0:00:21
665000 -- (-1280.018) (-1279.514) [-1282.856] (-1283.705) * [-1280.392] (-1286.480) (-1281.429) (-1279.582) -- 0:00:21
Average standard deviation of split frequencies: 0.011168
665500 -- [-1282.395] (-1282.605) (-1284.394) (-1283.077) * (-1281.407) (-1282.840) [-1282.397] (-1281.838) -- 0:00:21
666000 -- [-1285.254] (-1282.775) (-1279.598) (-1283.586) * (-1281.954) (-1282.076) (-1279.906) [-1279.803] -- 0:00:21
666500 -- (-1280.707) [-1283.374] (-1280.060) (-1283.363) * (-1280.579) (-1281.313) (-1281.451) [-1279.247] -- 0:00:21
667000 -- (-1279.960) (-1289.526) [-1279.543] (-1281.024) * (-1283.506) (-1282.433) (-1281.134) [-1281.817] -- 0:00:20
667500 -- [-1284.528] (-1288.081) (-1281.190) (-1283.438) * (-1283.357) [-1280.714] (-1285.938) (-1279.841) -- 0:00:20
668000 -- (-1281.396) (-1285.191) [-1281.924] (-1282.869) * (-1280.449) [-1280.470] (-1279.541) (-1279.276) -- 0:00:20
668500 -- (-1281.762) [-1280.260] (-1288.654) (-1282.398) * (-1280.905) (-1281.451) (-1282.482) [-1281.748] -- 0:00:20
669000 -- (-1282.944) (-1280.512) (-1286.014) [-1280.829] * (-1279.842) [-1280.519] (-1282.017) (-1280.733) -- 0:00:20
669500 -- (-1281.964) (-1279.680) (-1281.629) [-1279.303] * (-1281.935) (-1285.207) (-1282.465) [-1280.254] -- 0:00:20
670000 -- (-1281.476) [-1281.141] (-1283.179) (-1280.346) * (-1281.016) [-1283.875] (-1282.462) (-1280.813) -- 0:00:20
Average standard deviation of split frequencies: 0.011637
670500 -- [-1280.092] (-1280.412) (-1283.035) (-1280.376) * (-1284.065) (-1291.186) (-1283.248) [-1281.556] -- 0:00:20
671000 -- (-1279.448) (-1285.061) [-1280.939] (-1287.858) * (-1295.411) (-1286.143) (-1282.186) [-1281.231] -- 0:00:20
671500 -- (-1280.745) (-1284.644) (-1279.740) [-1283.202] * (-1287.998) (-1281.935) (-1281.147) [-1281.199] -- 0:00:20
672000 -- [-1280.927] (-1281.963) (-1279.299) (-1283.004) * (-1284.869) (-1279.717) (-1280.684) [-1283.552] -- 0:00:20
672500 -- (-1280.361) [-1284.339] (-1280.283) (-1279.555) * (-1287.038) [-1281.472] (-1282.938) (-1281.129) -- 0:00:20
673000 -- (-1280.058) [-1280.653] (-1281.636) (-1282.189) * (-1279.028) (-1282.541) (-1281.335) [-1280.182] -- 0:00:20
673500 -- (-1282.423) [-1280.558] (-1284.094) (-1280.024) * (-1281.948) [-1283.173] (-1283.651) (-1280.194) -- 0:00:20
674000 -- (-1281.773) (-1283.051) [-1279.163] (-1281.640) * (-1279.767) (-1280.062) (-1279.878) [-1280.609] -- 0:00:20
674500 -- [-1279.499] (-1282.755) (-1280.123) (-1281.364) * (-1282.980) (-1283.991) [-1282.042] (-1280.003) -- 0:00:20
675000 -- (-1281.605) [-1284.318] (-1281.670) (-1283.549) * (-1284.573) (-1281.494) (-1280.230) [-1282.038] -- 0:00:20
Average standard deviation of split frequencies: 0.011116
675500 -- (-1282.856) [-1282.240] (-1280.318) (-1284.272) * [-1283.421] (-1281.546) (-1279.895) (-1281.932) -- 0:00:20
676000 -- [-1284.591] (-1279.102) (-1281.715) (-1280.052) * (-1280.619) [-1282.201] (-1281.923) (-1281.894) -- 0:00:20
676500 -- (-1281.534) (-1281.894) [-1282.600] (-1280.827) * (-1279.819) (-1280.638) [-1281.986] (-1281.340) -- 0:00:20
677000 -- (-1280.324) (-1279.975) (-1280.361) [-1284.539] * (-1279.464) (-1280.317) [-1282.993] (-1280.774) -- 0:00:20
677500 -- (-1280.098) (-1280.363) [-1281.370] (-1282.714) * (-1280.216) (-1282.599) (-1283.230) [-1283.125] -- 0:00:20
678000 -- (-1281.472) (-1282.218) [-1281.122] (-1283.552) * (-1281.280) [-1280.456] (-1282.930) (-1283.999) -- 0:00:20
678500 -- (-1282.315) (-1287.401) [-1284.487] (-1282.698) * (-1281.509) (-1280.328) [-1283.704] (-1283.089) -- 0:00:20
679000 -- (-1279.608) (-1281.724) (-1282.968) [-1280.860] * (-1280.895) [-1282.649] (-1282.966) (-1280.217) -- 0:00:20
679500 -- (-1282.378) (-1279.809) (-1282.636) [-1282.589] * (-1281.592) (-1282.891) (-1285.982) [-1280.178] -- 0:00:20
680000 -- (-1283.187) [-1280.790] (-1281.583) (-1284.699) * [-1280.386] (-1281.291) (-1285.553) (-1279.341) -- 0:00:20
Average standard deviation of split frequencies: 0.011285
680500 -- [-1279.902] (-1282.805) (-1281.219) (-1283.328) * [-1285.674] (-1280.485) (-1287.266) (-1282.552) -- 0:00:20
681000 -- [-1281.750] (-1281.133) (-1286.633) (-1282.654) * (-1282.579) [-1282.013] (-1284.081) (-1279.960) -- 0:00:20
681500 -- (-1279.502) (-1282.798) [-1281.098] (-1283.379) * (-1284.430) [-1279.334] (-1281.767) (-1280.272) -- 0:00:20
682000 -- [-1280.603] (-1285.821) (-1282.063) (-1281.460) * (-1284.430) (-1279.455) [-1281.192] (-1280.156) -- 0:00:20
682500 -- [-1281.532] (-1282.123) (-1282.292) (-1282.639) * [-1280.886] (-1282.270) (-1281.110) (-1284.238) -- 0:00:20
683000 -- (-1279.863) [-1282.199] (-1282.485) (-1280.815) * (-1281.769) [-1282.117] (-1281.869) (-1281.506) -- 0:00:19
683500 -- [-1280.240] (-1280.728) (-1280.896) (-1283.342) * (-1280.076) (-1281.161) (-1282.940) [-1280.212] -- 0:00:19
684000 -- (-1280.677) [-1280.392] (-1280.944) (-1281.631) * (-1282.174) [-1279.712] (-1280.418) (-1282.561) -- 0:00:19
684500 -- [-1281.735] (-1280.736) (-1285.536) (-1282.314) * (-1282.170) (-1280.685) (-1281.563) [-1283.101] -- 0:00:19
685000 -- (-1283.556) [-1281.062] (-1281.479) (-1282.209) * (-1281.159) (-1284.806) (-1281.703) [-1280.433] -- 0:00:19
Average standard deviation of split frequencies: 0.011722
685500 -- (-1285.883) (-1283.135) (-1281.731) [-1279.541] * (-1279.765) (-1279.469) (-1280.074) [-1281.336] -- 0:00:19
686000 -- (-1282.542) (-1281.441) [-1283.356] (-1280.782) * (-1283.949) (-1279.704) (-1284.248) [-1279.376] -- 0:00:19
686500 -- (-1282.057) (-1281.112) [-1280.311] (-1280.357) * (-1281.397) (-1280.312) (-1282.623) [-1279.302] -- 0:00:19
687000 -- (-1279.398) [-1281.597] (-1280.978) (-1284.849) * [-1281.511] (-1281.822) (-1286.470) (-1279.304) -- 0:00:19
687500 -- (-1279.276) (-1280.526) (-1282.190) [-1283.223] * (-1280.239) (-1285.822) [-1280.307] (-1279.463) -- 0:00:19
688000 -- (-1280.722) (-1280.382) [-1280.511] (-1281.194) * [-1281.781] (-1282.984) (-1280.145) (-1281.163) -- 0:00:19
688500 -- (-1280.016) (-1281.488) [-1280.119] (-1280.914) * (-1280.749) (-1280.348) (-1281.497) [-1279.909] -- 0:00:19
689000 -- (-1281.601) (-1280.132) (-1282.636) [-1281.027] * (-1280.707) (-1282.168) [-1282.448] (-1281.960) -- 0:00:19
689500 -- (-1280.658) (-1279.951) (-1280.561) [-1280.262] * [-1281.908] (-1283.373) (-1281.466) (-1281.579) -- 0:00:19
690000 -- [-1282.753] (-1279.992) (-1282.643) (-1280.101) * (-1280.794) [-1281.465] (-1280.493) (-1279.943) -- 0:00:19
Average standard deviation of split frequencies: 0.011603
690500 -- (-1281.347) [-1282.033] (-1281.855) (-1281.019) * (-1284.072) (-1280.269) (-1279.358) [-1285.506] -- 0:00:19
691000 -- (-1281.106) (-1284.217) [-1284.855] (-1280.944) * (-1281.676) (-1282.045) (-1280.678) [-1282.068] -- 0:00:19
691500 -- (-1283.713) (-1282.039) [-1280.083] (-1283.104) * (-1281.188) (-1282.170) (-1281.244) [-1280.884] -- 0:00:19
692000 -- (-1283.962) (-1282.581) [-1281.685] (-1281.894) * (-1280.817) [-1280.102] (-1280.008) (-1283.107) -- 0:00:19
692500 -- [-1282.506] (-1285.893) (-1279.898) (-1282.275) * (-1280.010) [-1280.675] (-1281.922) (-1285.783) -- 0:00:19
693000 -- (-1280.182) [-1281.790] (-1282.814) (-1282.026) * [-1282.086] (-1280.437) (-1280.558) (-1285.129) -- 0:00:19
693500 -- (-1281.449) (-1282.274) (-1280.329) [-1281.967] * (-1280.535) (-1282.216) (-1280.558) [-1282.862] -- 0:00:19
694000 -- (-1279.266) [-1282.309] (-1280.738) (-1282.141) * (-1280.034) (-1279.639) [-1280.513] (-1286.307) -- 0:00:19
694500 -- [-1279.266] (-1282.184) (-1280.122) (-1283.672) * [-1280.438] (-1283.263) (-1281.812) (-1287.967) -- 0:00:19
695000 -- (-1279.254) (-1282.846) [-1281.543] (-1280.468) * [-1280.438] (-1282.867) (-1280.373) (-1284.203) -- 0:00:19
Average standard deviation of split frequencies: 0.010996
695500 -- (-1278.962) (-1284.051) [-1279.670] (-1280.164) * (-1280.893) (-1282.829) [-1286.617] (-1281.017) -- 0:00:19
696000 -- (-1279.338) [-1281.687] (-1279.513) (-1279.969) * (-1281.281) [-1280.467] (-1281.695) (-1283.561) -- 0:00:19
696500 -- (-1279.295) (-1279.430) [-1281.465] (-1281.562) * (-1281.354) (-1279.796) [-1280.218] (-1285.461) -- 0:00:19
697000 -- (-1281.155) (-1280.751) (-1282.132) [-1280.172] * (-1281.405) [-1280.694] (-1279.318) (-1280.448) -- 0:00:19
697500 -- (-1279.292) (-1281.216) (-1283.663) [-1286.091] * (-1282.471) (-1281.170) (-1281.340) [-1280.844] -- 0:00:19
698000 -- (-1279.609) (-1284.546) (-1281.019) [-1282.541] * (-1281.826) [-1280.638] (-1281.839) (-1279.841) -- 0:00:19
698500 -- (-1281.295) (-1281.128) (-1282.159) [-1280.457] * (-1282.140) (-1280.921) (-1282.189) [-1279.848] -- 0:00:18
699000 -- [-1280.016] (-1282.320) (-1280.648) (-1282.551) * (-1280.670) (-1281.410) [-1281.336] (-1280.331) -- 0:00:18
699500 -- (-1280.514) [-1280.013] (-1280.547) (-1281.485) * (-1279.435) (-1282.134) (-1280.564) [-1280.111] -- 0:00:18
700000 -- (-1281.411) (-1279.849) (-1279.408) [-1283.136] * (-1279.852) (-1287.052) [-1279.392] (-1281.008) -- 0:00:18
Average standard deviation of split frequencies: 0.010428
700500 -- [-1282.315] (-1280.425) (-1280.219) (-1280.336) * (-1283.377) (-1282.774) (-1279.168) [-1281.280] -- 0:00:18
701000 -- [-1282.093] (-1281.750) (-1279.853) (-1280.241) * (-1281.934) (-1290.721) [-1279.174] (-1280.997) -- 0:00:18
701500 -- (-1283.401) [-1284.490] (-1282.173) (-1281.482) * (-1280.480) [-1282.352] (-1279.174) (-1281.212) -- 0:00:18
702000 -- (-1281.990) (-1282.632) [-1279.309] (-1283.238) * (-1281.087) (-1289.711) [-1278.996] (-1280.946) -- 0:00:18
702500 -- (-1280.297) [-1279.332] (-1281.203) (-1284.584) * [-1279.814] (-1281.640) (-1279.460) (-1279.433) -- 0:00:18
703000 -- (-1280.452) (-1278.934) [-1282.779] (-1284.883) * (-1280.408) (-1279.078) (-1280.016) [-1279.266] -- 0:00:18
703500 -- (-1280.260) (-1283.898) (-1280.956) [-1280.969] * (-1281.104) (-1279.009) (-1283.183) [-1279.583] -- 0:00:18
704000 -- (-1279.751) [-1283.329] (-1280.651) (-1282.908) * (-1281.058) (-1283.046) [-1279.818] (-1282.458) -- 0:00:18
704500 -- (-1279.986) [-1289.153] (-1280.774) (-1280.004) * [-1279.911] (-1282.325) (-1280.407) (-1279.984) -- 0:00:18
705000 -- (-1279.737) [-1281.232] (-1283.055) (-1284.601) * (-1282.415) [-1281.906] (-1280.124) (-1280.045) -- 0:00:18
Average standard deviation of split frequencies: 0.010183
705500 -- [-1280.524] (-1283.017) (-1286.166) (-1280.121) * (-1283.428) (-1281.676) (-1282.455) [-1284.195] -- 0:00:18
706000 -- [-1284.491] (-1282.318) (-1283.283) (-1281.854) * (-1285.482) [-1281.280] (-1284.281) (-1284.002) -- 0:00:18
706500 -- (-1282.997) (-1284.748) (-1281.480) [-1281.493] * (-1280.568) (-1281.370) (-1285.177) [-1282.310] -- 0:00:18
707000 -- (-1281.948) [-1280.462] (-1280.169) (-1282.489) * (-1286.466) (-1280.997) [-1279.930] (-1280.372) -- 0:00:18
707500 -- (-1279.958) (-1283.876) (-1279.698) [-1282.053] * (-1287.120) [-1279.859] (-1284.569) (-1279.257) -- 0:00:18
708000 -- (-1281.310) [-1282.427] (-1279.988) (-1281.755) * (-1282.556) [-1281.578] (-1282.693) (-1281.823) -- 0:00:18
708500 -- (-1282.281) (-1280.901) (-1279.619) [-1279.288] * [-1283.446] (-1284.391) (-1281.788) (-1282.652) -- 0:00:18
709000 -- [-1281.603] (-1279.913) (-1279.698) (-1279.696) * (-1280.708) [-1280.712] (-1281.795) (-1280.208) -- 0:00:18
709500 -- (-1280.290) [-1283.872] (-1280.365) (-1280.390) * (-1279.892) (-1281.221) [-1282.693] (-1280.207) -- 0:00:18
710000 -- (-1281.533) (-1282.154) (-1280.569) [-1280.752] * [-1280.551] (-1280.290) (-1279.354) (-1279.646) -- 0:00:18
Average standard deviation of split frequencies: 0.010215
710500 -- (-1281.443) (-1280.754) (-1280.568) [-1279.795] * (-1280.355) [-1282.834] (-1279.439) (-1282.347) -- 0:00:18
711000 -- (-1282.716) (-1279.918) [-1281.967] (-1282.128) * (-1279.726) (-1287.186) [-1279.043] (-1281.975) -- 0:00:18
711500 -- (-1284.618) (-1282.070) (-1284.109) [-1279.198] * (-1281.648) (-1282.080) [-1279.037] (-1281.927) -- 0:00:18
712000 -- (-1282.952) [-1283.048] (-1281.778) (-1279.152) * (-1280.200) (-1281.521) [-1280.412] (-1284.917) -- 0:00:18
712500 -- (-1283.354) (-1281.510) [-1281.614] (-1284.478) * [-1279.788] (-1281.486) (-1280.398) (-1282.021) -- 0:00:18
713000 -- (-1282.778) (-1285.186) (-1281.595) [-1283.599] * (-1279.865) (-1281.022) (-1281.142) [-1280.870] -- 0:00:18
713500 -- (-1279.557) [-1282.751] (-1282.158) (-1283.803) * (-1281.510) (-1281.248) [-1281.118] (-1287.190) -- 0:00:18
714000 -- (-1279.564) [-1283.174] (-1283.605) (-1284.134) * (-1285.800) [-1279.925] (-1282.566) (-1280.986) -- 0:00:18
714500 -- (-1281.691) [-1281.860] (-1281.935) (-1285.328) * (-1283.700) (-1280.983) [-1280.446] (-1279.308) -- 0:00:17
715000 -- (-1283.446) [-1283.694] (-1282.307) (-1280.803) * (-1280.726) (-1283.844) (-1280.158) [-1280.339] -- 0:00:17
Average standard deviation of split frequencies: 0.010287
715500 -- (-1281.756) (-1285.582) (-1289.876) [-1282.834] * (-1280.115) (-1282.851) [-1280.163] (-1279.632) -- 0:00:17
716000 -- (-1284.278) (-1279.885) (-1285.404) [-1281.412] * (-1283.211) [-1283.150] (-1280.289) (-1281.377) -- 0:00:17
716500 -- [-1282.988] (-1282.317) (-1281.768) (-1283.113) * (-1281.473) [-1282.239] (-1283.354) (-1279.789) -- 0:00:17
717000 -- (-1280.647) (-1279.916) [-1281.898] (-1281.889) * (-1282.651) (-1280.278) [-1281.774] (-1282.125) -- 0:00:17
717500 -- [-1279.808] (-1279.255) (-1280.814) (-1281.084) * (-1281.693) (-1285.069) (-1282.121) [-1284.419] -- 0:00:17
718000 -- (-1279.456) (-1279.270) [-1280.955] (-1280.597) * (-1282.755) [-1281.664] (-1279.921) (-1282.142) -- 0:00:17
718500 -- (-1279.456) [-1284.158] (-1281.739) (-1281.505) * [-1284.393] (-1280.499) (-1282.197) (-1283.153) -- 0:00:17
719000 -- (-1279.948) (-1281.371) (-1280.742) [-1281.615] * [-1281.070] (-1281.378) (-1279.746) (-1282.877) -- 0:00:17
719500 -- [-1280.221] (-1280.900) (-1279.542) (-1280.813) * (-1280.981) [-1282.401] (-1280.024) (-1280.544) -- 0:00:17
720000 -- (-1280.566) (-1283.150) [-1279.528] (-1281.822) * (-1283.517) (-1281.184) (-1283.281) [-1282.516] -- 0:00:17
Average standard deviation of split frequencies: 0.010466
720500 -- (-1282.238) [-1281.494] (-1282.218) (-1281.590) * [-1283.604] (-1280.276) (-1280.625) (-1281.359) -- 0:00:17
721000 -- (-1280.451) (-1281.726) (-1280.113) [-1283.845] * [-1282.129] (-1284.934) (-1281.854) (-1283.334) -- 0:00:17
721500 -- [-1281.589] (-1287.409) (-1280.184) (-1281.903) * (-1283.123) (-1283.717) (-1280.765) [-1279.660] -- 0:00:17
722000 -- (-1281.394) (-1284.971) (-1284.185) [-1284.291] * (-1282.071) [-1280.903] (-1284.399) (-1279.901) -- 0:00:17
722500 -- (-1280.212) (-1287.351) (-1281.599) [-1281.797] * (-1281.904) [-1280.485] (-1281.229) (-1288.034) -- 0:00:17
723000 -- (-1280.873) [-1283.774] (-1281.785) (-1282.147) * [-1281.348] (-1281.964) (-1280.530) (-1288.700) -- 0:00:17
723500 -- (-1279.747) (-1280.745) (-1280.354) [-1279.970] * [-1281.507] (-1281.065) (-1283.763) (-1285.166) -- 0:00:17
724000 -- (-1281.120) (-1279.680) [-1280.378] (-1283.724) * (-1282.121) (-1280.326) [-1283.785] (-1280.551) -- 0:00:17
724500 -- (-1282.263) [-1279.912] (-1282.418) (-1280.125) * (-1280.904) (-1280.939) [-1283.748] (-1279.507) -- 0:00:17
725000 -- (-1282.494) (-1285.013) (-1281.082) [-1279.879] * (-1281.507) (-1280.199) (-1283.607) [-1279.713] -- 0:00:17
Average standard deviation of split frequencies: 0.010673
725500 -- (-1279.753) [-1280.758] (-1280.730) (-1279.321) * [-1279.664] (-1280.794) (-1280.319) (-1280.611) -- 0:00:17
726000 -- [-1280.619] (-1282.006) (-1279.691) (-1279.278) * (-1279.557) [-1281.047] (-1281.029) (-1280.434) -- 0:00:17
726500 -- (-1280.442) (-1285.318) [-1281.648] (-1279.443) * (-1279.582) (-1281.995) (-1281.017) [-1281.768] -- 0:00:17
727000 -- (-1279.657) (-1281.201) (-1285.911) [-1280.702] * (-1281.416) (-1280.951) (-1285.554) [-1280.200] -- 0:00:17
727500 -- (-1282.641) (-1280.693) [-1283.353] (-1282.753) * (-1279.741) (-1280.150) [-1279.780] (-1280.634) -- 0:00:17
728000 -- (-1281.205) (-1280.144) [-1282.143] (-1281.438) * [-1281.461] (-1280.458) (-1279.763) (-1280.705) -- 0:00:17
728500 -- [-1279.503] (-1282.967) (-1284.248) (-1281.341) * (-1281.705) [-1280.414] (-1280.400) (-1283.142) -- 0:00:17
729000 -- [-1281.088] (-1283.515) (-1281.033) (-1280.142) * (-1281.533) (-1283.554) (-1279.599) [-1283.737] -- 0:00:17
729500 -- (-1284.214) (-1280.690) [-1282.708] (-1279.898) * [-1283.901] (-1282.912) (-1279.592) (-1284.114) -- 0:00:17
730000 -- (-1281.671) (-1282.312) (-1283.064) [-1282.937] * (-1281.528) [-1280.329] (-1280.485) (-1281.753) -- 0:00:17
Average standard deviation of split frequencies: 0.010928
730500 -- (-1282.029) (-1284.319) (-1279.790) [-1283.812] * (-1281.629) (-1279.720) [-1280.460] (-1280.598) -- 0:00:16
731000 -- (-1282.347) (-1285.721) (-1281.785) [-1281.048] * (-1283.324) (-1281.439) [-1281.616] (-1281.254) -- 0:00:16
731500 -- [-1283.694] (-1280.134) (-1280.437) (-1287.391) * (-1279.642) (-1280.538) [-1283.312] (-1281.201) -- 0:00:16
732000 -- (-1279.947) [-1281.058] (-1282.190) (-1283.134) * [-1282.348] (-1282.097) (-1279.465) (-1279.907) -- 0:00:16
732500 -- (-1281.985) (-1281.434) (-1281.133) [-1280.419] * (-1282.475) [-1279.912] (-1280.703) (-1281.714) -- 0:00:16
733000 -- [-1287.872] (-1279.897) (-1279.354) (-1281.339) * (-1283.341) (-1280.214) [-1280.566] (-1281.780) -- 0:00:16
733500 -- (-1286.501) [-1279.266] (-1280.953) (-1283.363) * (-1281.139) (-1280.069) (-1279.442) [-1279.656] -- 0:00:16
734000 -- [-1286.932] (-1282.357) (-1282.002) (-1282.212) * (-1282.316) (-1280.343) (-1281.354) [-1280.218] -- 0:00:16
734500 -- (-1286.067) [-1281.188] (-1283.952) (-1285.524) * (-1280.210) (-1281.479) [-1280.374] (-1280.315) -- 0:00:16
735000 -- (-1284.807) [-1281.384] (-1283.515) (-1282.750) * (-1280.976) (-1282.783) (-1283.199) [-1281.416] -- 0:00:16
Average standard deviation of split frequencies: 0.010376
735500 -- (-1286.135) [-1280.344] (-1283.293) (-1282.238) * (-1282.000) (-1282.235) (-1280.355) [-1279.234] -- 0:00:16
736000 -- (-1287.010) (-1281.336) [-1281.082] (-1280.223) * [-1284.131] (-1281.405) (-1288.020) (-1279.462) -- 0:00:16
736500 -- (-1281.491) (-1280.292) (-1281.663) [-1280.415] * (-1281.931) (-1282.306) [-1286.349] (-1279.583) -- 0:00:16
737000 -- (-1281.937) (-1279.556) (-1280.663) [-1285.906] * (-1281.372) [-1280.155] (-1283.735) (-1281.803) -- 0:00:16
737500 -- (-1281.002) (-1279.602) [-1281.014] (-1281.908) * (-1280.507) (-1279.567) (-1281.950) [-1282.887] -- 0:00:16
738000 -- [-1280.051] (-1281.694) (-1279.161) (-1281.528) * (-1281.937) (-1281.481) (-1280.839) [-1280.233] -- 0:00:16
738500 -- (-1281.436) [-1282.755] (-1281.292) (-1283.772) * (-1282.561) (-1280.252) [-1280.590] (-1279.689) -- 0:00:16
739000 -- (-1280.661) (-1282.736) (-1285.347) [-1283.005] * (-1280.050) (-1282.758) [-1282.282] (-1280.477) -- 0:00:16
739500 -- (-1283.728) (-1281.445) [-1285.173] (-1287.037) * [-1283.569] (-1283.259) (-1283.631) (-1283.885) -- 0:00:16
740000 -- [-1283.933] (-1280.403) (-1281.452) (-1283.025) * (-1284.037) [-1281.823] (-1279.597) (-1282.444) -- 0:00:16
Average standard deviation of split frequencies: 0.010541
740500 -- (-1282.188) (-1281.357) (-1282.268) [-1279.800] * [-1280.042] (-1282.625) (-1287.981) (-1282.553) -- 0:00:16
741000 -- [-1280.762] (-1283.920) (-1282.257) (-1282.756) * (-1280.277) [-1282.266] (-1280.396) (-1279.652) -- 0:00:16
741500 -- (-1283.691) [-1283.434] (-1280.384) (-1285.476) * (-1280.384) (-1283.937) (-1281.254) [-1280.019] -- 0:00:16
742000 -- [-1280.916] (-1281.265) (-1279.766) (-1281.357) * (-1280.211) (-1283.864) [-1281.124] (-1283.364) -- 0:00:16
742500 -- [-1280.024] (-1280.442) (-1280.973) (-1279.072) * (-1280.870) [-1281.893] (-1280.425) (-1280.245) -- 0:00:16
743000 -- (-1293.928) (-1280.568) (-1280.390) [-1279.705] * (-1282.993) (-1281.290) [-1282.570] (-1281.360) -- 0:00:16
743500 -- (-1282.047) [-1279.582] (-1282.023) (-1280.135) * (-1280.845) (-1280.756) (-1282.000) [-1280.019] -- 0:00:16
744000 -- (-1281.340) (-1283.654) (-1283.783) [-1279.896] * (-1280.803) (-1281.062) (-1279.591) [-1280.265] -- 0:00:16
744500 -- (-1284.651) (-1281.147) [-1282.315] (-1284.297) * [-1282.550] (-1281.065) (-1279.582) (-1279.647) -- 0:00:16
745000 -- (-1280.316) [-1279.574] (-1281.419) (-1283.479) * (-1280.462) (-1281.311) (-1279.163) [-1281.107] -- 0:00:16
Average standard deviation of split frequencies: 0.010979
745500 -- (-1279.103) (-1279.626) [-1280.845] (-1282.919) * (-1281.411) (-1280.267) (-1280.675) [-1281.469] -- 0:00:16
746000 -- (-1281.436) (-1282.221) (-1283.058) [-1281.835] * (-1284.531) (-1280.252) [-1280.165] (-1281.355) -- 0:00:16
746500 -- (-1284.272) (-1279.988) (-1284.480) [-1279.943] * (-1283.038) [-1280.413] (-1283.002) (-1282.636) -- 0:00:15
747000 -- (-1289.958) (-1282.128) [-1280.651] (-1282.760) * [-1281.146] (-1280.918) (-1282.233) (-1286.695) -- 0:00:15
747500 -- (-1279.560) [-1284.551] (-1280.247) (-1281.746) * (-1280.643) (-1280.436) [-1279.674] (-1284.227) -- 0:00:15
748000 -- [-1283.475] (-1287.806) (-1283.831) (-1282.400) * (-1282.077) [-1280.637] (-1279.409) (-1283.306) -- 0:00:15
748500 -- (-1281.697) (-1284.350) (-1284.959) [-1280.073] * (-1282.700) [-1281.823] (-1282.581) (-1281.636) -- 0:00:15
749000 -- (-1279.932) [-1286.011] (-1280.152) (-1280.585) * (-1283.733) [-1280.804] (-1282.776) (-1282.639) -- 0:00:15
749500 -- (-1282.495) (-1283.541) (-1279.518) [-1281.062] * (-1281.679) [-1280.516] (-1283.459) (-1281.067) -- 0:00:15
750000 -- (-1281.426) (-1280.526) [-1279.379] (-1279.439) * (-1281.247) (-1280.879) (-1282.554) [-1279.535] -- 0:00:15
Average standard deviation of split frequencies: 0.011029
750500 -- [-1284.490] (-1283.183) (-1285.978) (-1279.945) * [-1279.896] (-1285.010) (-1280.491) (-1281.149) -- 0:00:15
751000 -- (-1283.344) [-1280.598] (-1284.012) (-1281.746) * (-1282.013) [-1281.704] (-1280.809) (-1280.633) -- 0:00:15
751500 -- (-1279.966) (-1283.172) (-1282.479) [-1282.121] * (-1282.715) [-1282.190] (-1283.335) (-1282.374) -- 0:00:15
752000 -- [-1279.348] (-1282.454) (-1280.637) (-1281.550) * (-1281.962) [-1282.200] (-1281.425) (-1281.672) -- 0:00:15
752500 -- (-1282.638) (-1285.363) (-1282.958) [-1280.308] * [-1280.015] (-1279.969) (-1279.775) (-1281.683) -- 0:00:15
753000 -- (-1288.930) [-1281.656] (-1281.553) (-1283.407) * (-1279.816) [-1280.626] (-1281.737) (-1283.096) -- 0:00:15
753500 -- (-1280.497) (-1282.079) [-1283.116] (-1283.287) * (-1279.925) [-1280.585] (-1282.893) (-1281.999) -- 0:00:15
754000 -- (-1280.422) (-1282.200) (-1283.315) [-1284.418] * (-1281.429) (-1283.469) (-1280.621) [-1282.457] -- 0:00:15
754500 -- (-1282.020) (-1279.996) [-1279.986] (-1281.278) * (-1290.220) [-1280.572] (-1282.204) (-1280.474) -- 0:00:15
755000 -- [-1279.549] (-1280.265) (-1279.401) (-1280.533) * (-1287.530) [-1280.078] (-1282.419) (-1283.502) -- 0:00:15
Average standard deviation of split frequencies: 0.010951
755500 -- (-1282.001) (-1279.738) [-1280.993] (-1284.384) * (-1281.316) (-1282.827) (-1283.455) [-1283.089] -- 0:00:15
756000 -- (-1282.071) (-1280.953) [-1280.408] (-1281.236) * [-1281.560] (-1280.785) (-1279.407) (-1278.959) -- 0:00:15
756500 -- (-1279.628) (-1280.468) [-1281.894] (-1286.013) * (-1285.867) (-1284.046) (-1284.017) [-1282.482] -- 0:00:15
757000 -- [-1281.204] (-1279.796) (-1280.117) (-1280.577) * (-1281.923) [-1281.704] (-1279.680) (-1280.528) -- 0:00:15
757500 -- (-1281.343) [-1281.680] (-1280.444) (-1279.694) * (-1282.001) (-1283.216) (-1279.836) [-1281.087] -- 0:00:15
758000 -- (-1279.792) [-1280.031] (-1279.746) (-1283.283) * (-1280.979) (-1280.349) [-1281.797] (-1280.442) -- 0:00:15
758500 -- (-1281.030) (-1281.059) [-1281.160] (-1281.405) * (-1284.878) (-1280.884) (-1281.534) [-1279.155] -- 0:00:15
759000 -- (-1280.032) (-1287.138) [-1281.381] (-1281.359) * (-1281.646) (-1282.703) [-1280.466] (-1284.245) -- 0:00:15
759500 -- (-1280.355) (-1283.049) [-1283.712] (-1282.153) * (-1286.099) (-1282.564) [-1279.396] (-1283.109) -- 0:00:15
760000 -- [-1281.344] (-1281.722) (-1285.243) (-1284.062) * (-1282.943) [-1279.268] (-1280.682) (-1286.847) -- 0:00:15
Average standard deviation of split frequencies: 0.010652
760500 -- (-1281.033) (-1283.396) [-1282.861] (-1285.105) * [-1285.015] (-1280.517) (-1279.613) (-1284.967) -- 0:00:15
761000 -- (-1280.774) (-1282.343) [-1281.965] (-1280.137) * (-1279.914) [-1280.764] (-1281.542) (-1285.563) -- 0:00:15
761500 -- (-1283.936) [-1281.644] (-1281.949) (-1280.591) * (-1281.043) (-1285.831) (-1282.938) [-1283.640] -- 0:00:15
762000 -- (-1282.806) (-1281.703) [-1282.409] (-1280.629) * [-1280.189] (-1285.086) (-1282.501) (-1281.326) -- 0:00:14
762500 -- [-1279.671] (-1283.008) (-1281.637) (-1280.316) * (-1280.572) (-1282.363) (-1281.618) [-1281.502] -- 0:00:14
763000 -- [-1281.302] (-1282.615) (-1279.892) (-1283.476) * (-1279.857) [-1280.156] (-1282.902) (-1282.373) -- 0:00:14
763500 -- (-1283.943) (-1283.428) (-1280.015) [-1284.958] * (-1280.923) (-1281.583) [-1280.992] (-1281.068) -- 0:00:14
764000 -- (-1283.979) (-1280.761) [-1281.519] (-1281.736) * (-1279.372) [-1279.716] (-1282.140) (-1281.212) -- 0:00:14
764500 -- (-1284.843) [-1283.831] (-1281.068) (-1281.033) * (-1282.616) [-1280.008] (-1280.927) (-1280.671) -- 0:00:14
765000 -- [-1279.826] (-1279.474) (-1282.765) (-1281.650) * (-1280.003) [-1280.511] (-1283.948) (-1279.372) -- 0:00:14
Average standard deviation of split frequencies: 0.009738
765500 -- (-1279.705) [-1280.081] (-1281.358) (-1281.926) * (-1281.113) (-1281.562) [-1282.146] (-1280.609) -- 0:00:14
766000 -- (-1279.662) [-1279.978] (-1280.938) (-1280.003) * [-1280.901] (-1281.262) (-1279.509) (-1280.875) -- 0:00:14
766500 -- (-1281.864) (-1279.513) [-1280.111] (-1281.628) * (-1280.199) [-1281.827] (-1280.624) (-1280.125) -- 0:00:14
767000 -- (-1280.326) (-1280.315) (-1280.756) [-1281.120] * (-1282.592) (-1281.466) (-1280.134) [-1281.765] -- 0:00:14
767500 -- (-1282.591) (-1283.486) (-1281.252) [-1279.822] * (-1280.933) [-1280.618] (-1280.654) (-1281.086) -- 0:00:14
768000 -- (-1283.855) (-1280.958) [-1281.108] (-1280.398) * (-1284.701) (-1281.388) [-1280.493] (-1279.565) -- 0:00:14
768500 -- (-1283.279) [-1284.390] (-1285.549) (-1280.018) * (-1285.645) (-1280.691) [-1287.165] (-1279.859) -- 0:00:14
769000 -- (-1282.750) (-1287.130) [-1282.270] (-1279.362) * (-1287.307) [-1282.831] (-1286.004) (-1281.060) -- 0:00:14
769500 -- (-1280.546) (-1280.218) (-1282.323) [-1280.406] * (-1284.475) (-1280.917) [-1280.773] (-1281.333) -- 0:00:14
770000 -- (-1284.887) (-1282.074) (-1280.461) [-1281.768] * (-1279.345) (-1279.564) (-1280.295) [-1283.808] -- 0:00:14
Average standard deviation of split frequencies: 0.009519
770500 -- (-1281.710) (-1284.149) [-1279.988] (-1280.644) * (-1282.894) [-1281.937] (-1279.636) (-1279.591) -- 0:00:14
771000 -- (-1281.800) [-1281.774] (-1280.547) (-1279.216) * (-1279.662) (-1281.025) [-1279.794] (-1283.067) -- 0:00:14
771500 -- (-1286.227) (-1282.828) (-1285.179) [-1280.741] * (-1281.771) (-1280.128) (-1282.155) [-1282.657] -- 0:00:14
772000 -- (-1280.304) (-1281.206) [-1280.372] (-1279.728) * (-1281.971) [-1279.698] (-1285.251) (-1281.113) -- 0:00:14
772500 -- (-1280.377) (-1280.658) [-1283.205] (-1279.481) * (-1281.347) [-1279.916] (-1283.372) (-1280.240) -- 0:00:14
773000 -- (-1282.588) (-1282.644) [-1280.549] (-1279.725) * (-1279.062) [-1280.332] (-1281.434) (-1280.336) -- 0:00:14
773500 -- (-1284.319) (-1280.166) [-1280.507] (-1280.448) * (-1283.408) (-1279.073) (-1282.731) [-1289.876] -- 0:00:14
774000 -- (-1282.025) (-1281.523) (-1282.764) [-1281.466] * (-1283.844) (-1279.236) [-1281.329] (-1289.920) -- 0:00:14
774500 -- [-1281.256] (-1287.224) (-1282.394) (-1280.875) * (-1282.306) [-1279.815] (-1279.746) (-1282.134) -- 0:00:14
775000 -- (-1279.918) (-1280.540) (-1282.217) [-1281.385] * (-1283.642) [-1279.865] (-1280.486) (-1284.363) -- 0:00:14
Average standard deviation of split frequencies: 0.010175
775500 -- (-1281.459) [-1280.149] (-1280.369) (-1283.884) * [-1282.367] (-1286.901) (-1283.739) (-1283.128) -- 0:00:14
776000 -- (-1281.449) (-1280.688) (-1279.693) [-1281.507] * (-1282.386) [-1279.527] (-1282.671) (-1281.250) -- 0:00:14
776500 -- [-1281.618] (-1282.128) (-1279.534) (-1279.467) * (-1280.793) [-1280.421] (-1283.976) (-1279.542) -- 0:00:14
777000 -- (-1283.067) (-1285.796) [-1279.922] (-1280.499) * (-1280.674) (-1281.147) (-1283.320) [-1279.469] -- 0:00:14
777500 -- (-1285.422) (-1279.896) [-1280.015] (-1283.680) * [-1280.510] (-1285.200) (-1281.469) (-1280.805) -- 0:00:14
778000 -- [-1284.482] (-1280.599) (-1282.068) (-1281.165) * [-1282.027] (-1281.895) (-1283.440) (-1282.151) -- 0:00:13
778500 -- [-1281.529] (-1280.932) (-1281.426) (-1281.801) * [-1279.873] (-1283.169) (-1281.910) (-1283.481) -- 0:00:13
779000 -- (-1279.822) (-1280.855) (-1283.574) [-1281.720] * (-1282.860) [-1284.203] (-1287.104) (-1281.544) -- 0:00:13
779500 -- (-1280.402) [-1283.999] (-1284.251) (-1283.228) * (-1280.285) (-1290.264) [-1282.427] (-1284.858) -- 0:00:13
780000 -- (-1281.407) (-1282.028) (-1281.869) [-1284.156] * (-1280.380) (-1281.443) [-1281.261] (-1283.844) -- 0:00:13
Average standard deviation of split frequencies: 0.010379
780500 -- (-1280.447) (-1281.000) (-1281.831) [-1284.503] * (-1282.974) (-1285.311) (-1281.804) [-1280.264] -- 0:00:13
781000 -- (-1281.521) [-1283.353] (-1281.761) (-1281.961) * [-1281.679] (-1287.810) (-1281.493) (-1281.466) -- 0:00:13
781500 -- [-1280.598] (-1282.960) (-1279.201) (-1283.172) * (-1280.808) [-1283.003] (-1283.717) (-1279.995) -- 0:00:13
782000 -- [-1279.868] (-1280.744) (-1282.489) (-1281.042) * (-1281.262) (-1281.551) [-1280.506] (-1279.847) -- 0:00:13
782500 -- (-1281.053) [-1282.384] (-1284.005) (-1281.231) * [-1279.858] (-1281.645) (-1280.466) (-1281.112) -- 0:00:13
783000 -- (-1281.201) (-1284.284) (-1279.838) [-1279.472] * (-1279.389) (-1280.047) [-1282.984] (-1280.287) -- 0:00:13
783500 -- (-1283.668) (-1283.545) (-1281.223) [-1280.182] * (-1283.731) [-1280.681] (-1281.250) (-1280.849) -- 0:00:13
784000 -- (-1280.789) (-1280.942) [-1280.150] (-1279.819) * (-1286.142) (-1281.117) (-1281.148) [-1280.981] -- 0:00:13
784500 -- (-1280.976) (-1282.088) (-1280.779) [-1281.528] * (-1286.652) (-1279.666) (-1282.377) [-1281.138] -- 0:00:13
785000 -- (-1283.412) (-1281.735) (-1287.094) [-1284.043] * [-1281.401] (-1283.903) (-1283.607) (-1279.913) -- 0:00:13
Average standard deviation of split frequencies: 0.010458
785500 -- (-1282.578) (-1284.960) [-1279.965] (-1280.263) * (-1279.506) [-1282.132] (-1283.980) (-1284.197) -- 0:00:13
786000 -- (-1285.505) (-1283.826) [-1279.313] (-1283.744) * (-1279.613) [-1279.227] (-1282.618) (-1284.316) -- 0:00:13
786500 -- (-1281.478) (-1280.918) [-1281.902] (-1281.544) * (-1280.139) [-1279.444] (-1281.212) (-1282.490) -- 0:00:13
787000 -- (-1280.662) [-1280.842] (-1282.086) (-1282.076) * (-1281.950) [-1283.026] (-1280.452) (-1280.342) -- 0:00:13
787500 -- (-1280.761) (-1281.542) (-1283.891) [-1280.688] * (-1283.126) (-1281.502) [-1281.807] (-1281.464) -- 0:00:13
788000 -- (-1285.480) (-1282.785) [-1284.236] (-1281.307) * (-1282.953) (-1279.978) [-1280.836] (-1286.978) -- 0:00:13
788500 -- (-1282.895) (-1280.936) (-1282.005) [-1279.685] * [-1281.687] (-1279.461) (-1281.502) (-1283.871) -- 0:00:13
789000 -- (-1280.824) (-1281.292) [-1282.002] (-1279.682) * (-1279.648) [-1279.501] (-1280.065) (-1280.221) -- 0:00:13
789500 -- (-1282.864) (-1281.295) [-1279.754] (-1282.672) * [-1280.315] (-1280.896) (-1279.938) (-1280.393) -- 0:00:13
790000 -- (-1282.104) [-1282.031] (-1281.664) (-1280.563) * [-1283.826] (-1280.314) (-1281.340) (-1280.393) -- 0:00:13
Average standard deviation of split frequencies: 0.010241
790500 -- (-1281.993) (-1287.687) (-1284.521) [-1282.017] * [-1281.876] (-1281.501) (-1281.592) (-1280.862) -- 0:00:13
791000 -- (-1281.236) [-1281.354] (-1282.552) (-1283.939) * [-1279.485] (-1280.298) (-1284.850) (-1282.583) -- 0:00:13
791500 -- (-1284.001) [-1280.009] (-1280.159) (-1279.947) * (-1279.518) (-1282.609) [-1281.292] (-1280.921) -- 0:00:13
792000 -- (-1282.957) (-1279.889) (-1280.935) [-1279.210] * (-1280.867) (-1280.861) [-1281.101] (-1282.967) -- 0:00:13
792500 -- (-1284.364) [-1280.185] (-1280.059) (-1279.613) * (-1281.013) [-1279.807] (-1281.843) (-1281.606) -- 0:00:13
793000 -- [-1282.459] (-1289.078) (-1280.274) (-1279.617) * (-1279.238) [-1280.294] (-1282.534) (-1279.975) -- 0:00:13
793500 -- (-1283.386) (-1283.604) [-1279.371] (-1283.353) * (-1282.548) (-1281.895) (-1283.452) [-1279.975] -- 0:00:13
794000 -- (-1286.326) (-1284.866) (-1279.021) [-1280.734] * (-1282.179) (-1281.241) (-1286.844) [-1279.467] -- 0:00:12
794500 -- (-1281.035) (-1281.517) (-1280.476) [-1281.063] * (-1282.277) (-1283.929) (-1286.656) [-1279.216] -- 0:00:12
795000 -- (-1282.200) (-1282.887) [-1281.325] (-1282.749) * (-1281.836) (-1280.286) (-1280.921) [-1280.201] -- 0:00:12
Average standard deviation of split frequencies: 0.010549
795500 -- (-1280.682) [-1280.771] (-1281.161) (-1286.006) * (-1281.424) (-1279.418) (-1280.330) [-1279.745] -- 0:00:12
796000 -- (-1279.755) [-1282.413] (-1282.037) (-1282.643) * (-1281.670) (-1279.439) [-1281.942] (-1279.360) -- 0:00:12
796500 -- [-1280.937] (-1283.644) (-1279.835) (-1280.801) * [-1281.261] (-1283.053) (-1281.072) (-1280.698) -- 0:00:12
797000 -- (-1280.112) [-1280.992] (-1280.279) (-1281.148) * (-1280.635) (-1279.951) (-1283.633) [-1282.868] -- 0:00:12
797500 -- (-1280.182) (-1282.024) (-1280.111) [-1281.363] * (-1281.697) (-1279.830) (-1283.267) [-1280.952] -- 0:00:12
798000 -- [-1281.002] (-1283.480) (-1280.285) (-1282.044) * (-1280.574) [-1280.736] (-1282.461) (-1282.848) -- 0:00:12
798500 -- (-1279.572) (-1280.789) (-1284.348) [-1280.304] * (-1280.009) (-1282.073) (-1281.657) [-1281.042] -- 0:00:12
799000 -- [-1279.471] (-1282.857) (-1280.644) (-1281.201) * (-1280.016) (-1280.842) (-1283.434) [-1279.978] -- 0:00:12
799500 -- (-1279.822) (-1281.306) (-1280.293) [-1280.492] * [-1281.026] (-1279.189) (-1283.311) (-1285.294) -- 0:00:12
800000 -- (-1280.190) [-1283.376] (-1279.724) (-1280.923) * (-1279.692) (-1279.197) (-1281.796) [-1281.883] -- 0:00:12
Average standard deviation of split frequencies: 0.009773
800500 -- (-1281.720) [-1281.829] (-1285.143) (-1280.360) * (-1279.678) [-1280.534] (-1279.503) (-1281.521) -- 0:00:12
801000 -- (-1282.890) (-1279.330) (-1283.299) [-1281.425] * [-1284.576] (-1282.537) (-1282.503) (-1284.635) -- 0:00:12
801500 -- (-1284.732) (-1280.752) (-1284.712) [-1280.347] * (-1282.077) (-1280.286) (-1284.827) [-1283.254] -- 0:00:12
802000 -- (-1279.801) (-1281.853) [-1280.770] (-1280.371) * [-1283.657] (-1287.438) (-1282.362) (-1285.423) -- 0:00:12
802500 -- (-1279.973) (-1281.723) [-1279.137] (-1280.176) * (-1285.697) [-1284.301] (-1280.067) (-1281.760) -- 0:00:12
803000 -- [-1282.821] (-1281.965) (-1282.022) (-1280.885) * [-1285.176] (-1279.632) (-1282.025) (-1281.391) -- 0:00:12
803500 -- (-1283.816) (-1281.449) [-1282.886] (-1281.151) * (-1281.373) [-1280.634] (-1281.983) (-1284.142) -- 0:00:12
804000 -- [-1281.009] (-1285.036) (-1279.228) (-1280.737) * (-1282.605) (-1280.268) (-1280.546) [-1279.390] -- 0:00:12
804500 -- (-1279.760) (-1282.547) [-1280.767] (-1284.835) * (-1283.759) (-1282.019) [-1282.993] (-1284.000) -- 0:00:12
805000 -- [-1280.615] (-1284.088) (-1280.525) (-1283.007) * (-1283.532) [-1283.546] (-1282.364) (-1281.375) -- 0:00:12
Average standard deviation of split frequencies: 0.009541
805500 -- [-1281.357] (-1281.728) (-1280.438) (-1280.723) * (-1282.063) (-1283.048) (-1282.119) [-1285.921] -- 0:00:12
806000 -- (-1281.107) [-1279.994] (-1279.626) (-1280.657) * (-1280.852) (-1284.545) [-1280.054] (-1283.465) -- 0:00:12
806500 -- (-1283.774) [-1279.994] (-1279.283) (-1280.066) * [-1280.281] (-1284.513) (-1287.001) (-1281.496) -- 0:00:12
807000 -- (-1281.745) (-1279.190) (-1281.694) [-1281.384] * (-1282.544) (-1285.177) (-1283.796) [-1280.743] -- 0:00:12
807500 -- (-1280.690) (-1280.233) (-1280.399) [-1279.571] * [-1280.325] (-1287.096) (-1285.416) (-1280.968) -- 0:00:12
808000 -- (-1280.294) [-1279.687] (-1281.559) (-1280.253) * (-1283.107) (-1279.556) [-1280.607] (-1282.527) -- 0:00:12
808500 -- [-1279.925] (-1279.642) (-1282.279) (-1280.145) * [-1280.125] (-1280.798) (-1280.538) (-1283.024) -- 0:00:12
809000 -- [-1280.016] (-1280.081) (-1285.216) (-1281.142) * [-1279.749] (-1280.086) (-1280.940) (-1282.039) -- 0:00:12
809500 -- [-1282.055] (-1279.552) (-1282.997) (-1284.016) * [-1280.487] (-1280.777) (-1282.777) (-1282.274) -- 0:00:12
810000 -- (-1280.267) [-1282.681] (-1281.552) (-1284.380) * (-1281.449) [-1280.895] (-1281.661) (-1284.826) -- 0:00:11
Average standard deviation of split frequencies: 0.009847
810500 -- (-1280.078) (-1280.557) (-1281.734) [-1280.205] * (-1279.542) [-1283.950] (-1280.508) (-1286.474) -- 0:00:11
811000 -- (-1281.786) (-1280.762) [-1280.318] (-1284.426) * (-1280.505) (-1287.511) [-1282.324] (-1281.983) -- 0:00:11
811500 -- (-1281.215) (-1279.673) (-1279.881) [-1283.065] * (-1280.853) (-1282.128) [-1280.356] (-1283.035) -- 0:00:11
812000 -- (-1279.889) (-1279.910) (-1283.384) [-1288.974] * (-1280.537) [-1280.112] (-1279.852) (-1279.792) -- 0:00:11
812500 -- [-1283.943] (-1280.837) (-1281.915) (-1280.855) * (-1288.920) (-1280.249) (-1281.794) [-1283.192] -- 0:00:11
813000 -- (-1280.912) (-1280.511) (-1280.679) [-1281.657] * (-1284.283) (-1280.151) [-1281.978] (-1286.029) -- 0:00:11
813500 -- (-1283.146) [-1280.015] (-1281.717) (-1280.746) * (-1281.751) (-1284.649) [-1280.470] (-1285.531) -- 0:00:11
814000 -- [-1280.484] (-1281.199) (-1284.997) (-1279.782) * [-1281.165] (-1282.253) (-1281.186) (-1283.347) -- 0:00:11
814500 -- [-1282.278] (-1280.256) (-1280.068) (-1286.031) * (-1282.244) (-1280.335) (-1281.448) [-1281.577] -- 0:00:11
815000 -- (-1285.423) (-1280.189) [-1282.864] (-1283.800) * (-1282.631) (-1279.798) [-1281.788] (-1280.680) -- 0:00:11
Average standard deviation of split frequencies: 0.010091
815500 -- (-1282.464) (-1280.189) (-1285.687) [-1281.887] * (-1283.170) [-1279.853] (-1280.049) (-1284.089) -- 0:00:11
816000 -- (-1280.686) (-1280.684) (-1281.075) [-1281.116] * (-1281.026) (-1281.879) [-1281.178] (-1283.377) -- 0:00:11
816500 -- (-1281.815) [-1283.675] (-1281.890) (-1282.001) * (-1280.271) (-1279.927) (-1280.525) [-1282.597] -- 0:00:11
817000 -- (-1283.329) (-1282.488) [-1281.677] (-1281.656) * (-1279.567) (-1280.313) (-1281.338) [-1284.023] -- 0:00:11
817500 -- (-1283.893) (-1282.157) (-1280.530) [-1281.569] * (-1282.838) (-1280.364) [-1280.656] (-1283.236) -- 0:00:11
818000 -- (-1280.794) (-1279.238) (-1282.970) [-1284.792] * [-1280.096] (-1280.071) (-1282.449) (-1280.874) -- 0:00:11
818500 -- [-1279.106] (-1285.891) (-1282.333) (-1285.645) * [-1280.062] (-1280.699) (-1281.304) (-1281.960) -- 0:00:11
819000 -- (-1281.021) (-1279.703) (-1281.326) [-1281.187] * (-1279.790) (-1280.340) (-1282.007) [-1279.358] -- 0:00:11
819500 -- (-1284.541) [-1279.791] (-1281.240) (-1280.814) * (-1280.257) [-1280.556] (-1279.623) (-1281.538) -- 0:00:11
820000 -- (-1283.622) (-1284.197) (-1280.306) [-1282.525] * (-1282.298) (-1280.540) (-1281.675) [-1282.671] -- 0:00:11
Average standard deviation of split frequencies: 0.009688
820500 -- (-1283.070) [-1283.133] (-1289.726) (-1282.169) * [-1281.979] (-1281.180) (-1281.253) (-1280.887) -- 0:00:11
821000 -- (-1284.299) [-1280.689] (-1284.424) (-1280.404) * (-1280.831) (-1288.263) (-1280.294) [-1280.130] -- 0:00:11
821500 -- [-1280.444] (-1281.024) (-1284.279) (-1279.917) * [-1282.880] (-1283.750) (-1280.960) (-1279.374) -- 0:00:11
822000 -- (-1279.943) [-1282.643] (-1280.418) (-1281.647) * (-1283.754) (-1283.188) (-1286.539) [-1280.515] -- 0:00:11
822500 -- (-1281.713) (-1282.899) [-1280.824] (-1281.516) * (-1280.603) (-1283.125) [-1282.324] (-1279.486) -- 0:00:11
823000 -- [-1282.138] (-1280.437) (-1281.260) (-1280.296) * (-1282.874) (-1280.293) (-1280.696) [-1280.386] -- 0:00:11
823500 -- [-1281.355] (-1284.529) (-1280.870) (-1281.499) * (-1284.185) (-1286.075) (-1279.866) [-1281.134] -- 0:00:11
824000 -- (-1283.223) (-1281.640) [-1284.170] (-1281.495) * (-1282.611) [-1280.704] (-1281.340) (-1281.356) -- 0:00:11
824500 -- [-1281.128] (-1284.915) (-1281.270) (-1283.383) * [-1283.493] (-1280.481) (-1279.647) (-1282.699) -- 0:00:11
825000 -- (-1280.208) [-1279.997] (-1279.185) (-1282.655) * (-1283.318) (-1283.476) (-1279.785) [-1280.580] -- 0:00:11
Average standard deviation of split frequencies: 0.009398
825500 -- [-1280.312] (-1281.889) (-1283.137) (-1284.733) * (-1286.765) (-1285.387) (-1285.312) [-1283.028] -- 0:00:10
826000 -- (-1281.179) [-1280.787] (-1281.948) (-1280.225) * (-1284.762) [-1283.068] (-1280.002) (-1280.376) -- 0:00:10
826500 -- [-1279.740] (-1283.030) (-1281.933) (-1281.356) * [-1280.794] (-1280.060) (-1281.146) (-1280.655) -- 0:00:10
827000 -- [-1281.658] (-1281.494) (-1280.266) (-1282.354) * (-1282.878) [-1279.839] (-1281.021) (-1282.540) -- 0:00:10
827500 -- (-1281.806) (-1281.510) [-1283.487] (-1281.134) * [-1281.639] (-1282.376) (-1281.441) (-1290.185) -- 0:00:10
828000 -- (-1281.912) (-1281.166) [-1279.864] (-1281.454) * [-1281.075] (-1280.091) (-1281.933) (-1286.070) -- 0:00:10
828500 -- (-1284.440) (-1279.409) [-1281.168] (-1279.418) * (-1281.527) (-1279.672) [-1283.023] (-1281.118) -- 0:00:10
829000 -- [-1285.729] (-1279.698) (-1280.197) (-1279.818) * [-1281.936] (-1281.248) (-1280.186) (-1283.637) -- 0:00:10
829500 -- (-1281.921) (-1280.381) [-1282.140] (-1285.044) * [-1282.745] (-1279.216) (-1279.860) (-1283.907) -- 0:00:10
830000 -- (-1280.611) [-1280.238] (-1281.230) (-1284.358) * [-1282.153] (-1283.864) (-1282.252) (-1280.274) -- 0:00:10
Average standard deviation of split frequencies: 0.009328
830500 -- (-1282.514) [-1284.921] (-1282.070) (-1285.487) * (-1286.526) [-1284.253] (-1282.827) (-1280.641) -- 0:00:10
831000 -- [-1283.405] (-1281.918) (-1286.888) (-1281.725) * (-1280.160) [-1285.422] (-1283.053) (-1283.690) -- 0:00:10
831500 -- [-1279.961] (-1280.495) (-1286.619) (-1282.178) * (-1279.763) (-1287.110) (-1281.030) [-1282.773] -- 0:00:10
832000 -- (-1279.170) (-1281.528) [-1284.704] (-1285.174) * (-1279.876) (-1284.099) (-1282.355) [-1281.178] -- 0:00:10
832500 -- (-1282.406) [-1282.117] (-1281.333) (-1282.934) * (-1281.609) (-1280.928) (-1282.625) [-1280.987] -- 0:00:10
833000 -- (-1283.957) (-1280.712) (-1280.620) [-1280.843] * (-1280.607) (-1285.039) [-1280.662] (-1281.074) -- 0:00:10
833500 -- [-1284.915] (-1282.442) (-1282.656) (-1281.916) * (-1280.623) [-1284.223] (-1281.853) (-1280.411) -- 0:00:10
834000 -- [-1283.463] (-1280.426) (-1281.346) (-1282.700) * (-1279.982) (-1279.750) (-1282.209) [-1280.066] -- 0:00:10
834500 -- (-1282.588) (-1281.316) [-1280.754] (-1281.476) * (-1282.070) (-1282.191) (-1285.055) [-1279.803] -- 0:00:10
835000 -- (-1282.261) (-1280.878) (-1280.836) [-1279.496] * (-1279.158) (-1282.290) [-1280.021] (-1280.727) -- 0:00:10
Average standard deviation of split frequencies: 0.009234
835500 -- (-1280.842) [-1279.939] (-1279.526) (-1279.871) * (-1281.289) (-1281.839) [-1282.304] (-1281.999) -- 0:00:10
836000 -- (-1282.709) [-1280.930] (-1280.590) (-1279.425) * (-1282.264) (-1281.237) (-1284.245) [-1280.249] -- 0:00:10
836500 -- [-1280.146] (-1282.962) (-1280.886) (-1284.106) * (-1283.706) (-1281.064) [-1281.437] (-1280.138) -- 0:00:10
837000 -- (-1282.487) (-1279.229) (-1282.840) [-1280.744] * [-1281.750] (-1281.500) (-1285.161) (-1280.687) -- 0:00:10
837500 -- (-1279.753) [-1280.837] (-1279.762) (-1281.468) * (-1282.469) [-1279.395] (-1280.810) (-1280.423) -- 0:00:10
838000 -- (-1279.425) (-1282.243) (-1280.865) [-1281.883] * (-1284.180) (-1281.531) (-1281.632) [-1279.220] -- 0:00:10
838500 -- (-1280.119) [-1284.897] (-1280.586) (-1281.917) * (-1283.046) [-1282.123] (-1282.536) (-1279.190) -- 0:00:10
839000 -- [-1280.931] (-1281.454) (-1282.267) (-1280.567) * (-1282.639) (-1286.818) [-1280.817] (-1279.776) -- 0:00:10
839500 -- (-1284.158) [-1284.578] (-1281.785) (-1279.835) * [-1281.991] (-1282.765) (-1279.728) (-1280.542) -- 0:00:10
840000 -- (-1281.721) (-1280.673) [-1280.737] (-1290.239) * (-1282.034) (-1285.384) [-1282.537] (-1280.356) -- 0:00:10
Average standard deviation of split frequencies: 0.009308
840500 -- (-1279.887) (-1280.642) (-1283.747) [-1282.889] * (-1281.256) [-1281.961] (-1286.479) (-1283.008) -- 0:00:10
841000 -- (-1281.839) [-1285.722] (-1279.739) (-1280.953) * (-1282.172) (-1280.652) [-1284.000] (-1283.860) -- 0:00:10
841500 -- (-1279.619) (-1280.769) [-1279.665] (-1280.895) * (-1285.410) [-1281.019] (-1284.342) (-1283.563) -- 0:00:09
842000 -- [-1281.280] (-1281.787) (-1280.752) (-1284.697) * (-1282.974) (-1281.579) (-1283.559) [-1279.319] -- 0:00:09
842500 -- (-1280.827) (-1280.537) (-1280.201) [-1282.754] * [-1280.909] (-1284.063) (-1281.130) (-1280.253) -- 0:00:09
843000 -- [-1283.653] (-1280.435) (-1280.474) (-1285.181) * [-1282.974] (-1285.659) (-1280.128) (-1280.998) -- 0:00:09
843500 -- (-1280.522) (-1281.183) (-1280.388) [-1280.418] * [-1279.816] (-1281.220) (-1279.836) (-1281.101) -- 0:00:09
844000 -- (-1281.549) (-1280.231) [-1279.791] (-1284.138) * [-1280.645] (-1281.296) (-1281.109) (-1280.124) -- 0:00:09
844500 -- (-1280.806) (-1280.862) [-1279.732] (-1283.234) * [-1281.637] (-1287.176) (-1280.221) (-1282.927) -- 0:00:09
845000 -- (-1281.985) [-1279.332] (-1280.223) (-1284.325) * [-1280.181] (-1288.477) (-1280.169) (-1281.650) -- 0:00:09
Average standard deviation of split frequencies: 0.008846
845500 -- (-1280.058) [-1280.671] (-1280.182) (-1279.376) * (-1281.970) (-1280.873) [-1280.440] (-1281.286) -- 0:00:09
846000 -- [-1280.423] (-1279.861) (-1281.276) (-1279.770) * (-1283.302) (-1280.679) (-1280.966) [-1281.440] -- 0:00:09
846500 -- (-1281.240) (-1281.996) (-1282.587) [-1279.362] * (-1282.389) (-1280.892) (-1288.531) [-1281.504] -- 0:00:09
847000 -- (-1282.342) (-1281.769) (-1279.437) [-1280.033] * (-1281.199) (-1280.507) [-1282.021] (-1281.407) -- 0:00:09
847500 -- (-1282.741) (-1286.681) (-1280.459) [-1280.293] * (-1280.784) (-1283.305) [-1279.982] (-1283.025) -- 0:00:09
848000 -- (-1283.399) (-1282.526) (-1281.315) [-1282.049] * (-1279.651) [-1282.608] (-1281.971) (-1281.430) -- 0:00:09
848500 -- (-1280.101) (-1283.468) [-1282.922] (-1279.156) * (-1283.812) (-1281.179) [-1280.833] (-1280.985) -- 0:00:09
849000 -- [-1279.912] (-1285.631) (-1281.890) (-1280.442) * [-1282.901] (-1279.882) (-1281.621) (-1280.012) -- 0:00:09
849500 -- (-1280.460) (-1289.831) [-1281.018] (-1279.760) * (-1281.484) (-1281.138) (-1281.864) [-1279.559] -- 0:00:09
850000 -- (-1285.272) [-1279.729] (-1279.632) (-1281.522) * (-1281.663) [-1282.171] (-1282.870) (-1283.860) -- 0:00:09
Average standard deviation of split frequencies: 0.009178
850500 -- (-1280.150) [-1283.062] (-1281.754) (-1280.842) * (-1281.023) (-1280.792) (-1282.059) [-1280.231] -- 0:00:09
851000 -- (-1280.082) (-1281.269) [-1279.523] (-1279.767) * (-1280.962) [-1281.113] (-1280.947) (-1281.874) -- 0:00:09
851500 -- [-1282.640] (-1279.888) (-1281.379) (-1280.120) * (-1282.232) (-1281.584) [-1280.252] (-1284.613) -- 0:00:09
852000 -- (-1280.575) [-1279.175] (-1281.555) (-1281.352) * (-1282.120) [-1280.912] (-1280.494) (-1281.901) -- 0:00:09
852500 -- (-1279.567) (-1284.818) (-1280.381) [-1283.942] * (-1282.685) (-1281.434) (-1280.257) [-1281.383] -- 0:00:09
853000 -- (-1284.315) (-1281.197) [-1281.626] (-1281.814) * [-1282.657] (-1279.836) (-1281.805) (-1280.307) -- 0:00:09
853500 -- (-1282.497) (-1281.825) [-1281.614] (-1283.250) * (-1283.123) (-1280.633) (-1280.611) [-1281.552] -- 0:00:09
854000 -- (-1280.836) (-1283.293) [-1279.981] (-1281.332) * (-1283.930) (-1279.868) (-1280.393) [-1281.694] -- 0:00:09
854500 -- [-1279.332] (-1280.562) (-1283.273) (-1282.177) * (-1283.176) [-1280.161] (-1280.418) (-1281.759) -- 0:00:09
855000 -- (-1284.042) [-1279.908] (-1283.331) (-1281.540) * (-1279.484) (-1282.269) [-1282.034] (-1283.656) -- 0:00:09
Average standard deviation of split frequencies: 0.009155
855500 -- (-1281.070) [-1279.737] (-1282.938) (-1283.646) * (-1282.814) (-1281.556) [-1282.064] (-1285.080) -- 0:00:09
856000 -- (-1281.023) (-1279.490) [-1282.696] (-1283.231) * (-1282.087) (-1279.140) (-1281.963) [-1282.817] -- 0:00:09
856500 -- (-1279.305) (-1284.349) [-1279.776] (-1283.810) * [-1281.856] (-1284.826) (-1280.195) (-1280.864) -- 0:00:09
857000 -- (-1280.803) [-1281.434] (-1280.929) (-1284.377) * (-1286.360) [-1282.013] (-1280.637) (-1285.567) -- 0:00:09
857500 -- (-1281.754) (-1281.082) [-1285.493] (-1281.775) * (-1281.057) [-1280.638] (-1280.284) (-1287.328) -- 0:00:08
858000 -- (-1285.809) [-1280.681] (-1280.268) (-1282.763) * (-1280.209) [-1285.639] (-1281.802) (-1281.910) -- 0:00:08
858500 -- (-1282.063) (-1287.354) [-1279.146] (-1280.991) * [-1279.999] (-1282.860) (-1281.634) (-1281.393) -- 0:00:08
859000 -- [-1280.508] (-1280.285) (-1279.943) (-1281.137) * (-1279.935) (-1282.380) (-1281.192) [-1279.863] -- 0:00:08
859500 -- [-1281.970] (-1280.088) (-1280.529) (-1280.173) * [-1280.747] (-1282.157) (-1281.099) (-1281.768) -- 0:00:08
860000 -- [-1282.082] (-1283.198) (-1281.636) (-1280.171) * (-1285.148) [-1281.564] (-1285.526) (-1281.043) -- 0:00:08
Average standard deviation of split frequencies: 0.009275
860500 -- (-1281.166) (-1283.012) [-1280.513] (-1281.379) * (-1281.498) (-1281.618) [-1284.344] (-1280.144) -- 0:00:08
861000 -- [-1279.924] (-1279.862) (-1282.045) (-1280.522) * (-1279.815) [-1280.503] (-1284.474) (-1280.208) -- 0:00:08
861500 -- (-1281.379) (-1284.022) [-1281.648] (-1288.249) * (-1289.115) [-1280.789] (-1282.728) (-1280.089) -- 0:00:08
862000 -- (-1282.546) [-1280.275] (-1282.374) (-1281.467) * (-1285.872) (-1281.814) [-1285.556] (-1284.158) -- 0:00:08
862500 -- (-1280.430) (-1280.547) (-1280.733) [-1280.975] * [-1279.435] (-1284.414) (-1282.215) (-1279.592) -- 0:00:08
863000 -- (-1283.345) [-1279.944] (-1280.606) (-1280.469) * (-1282.538) (-1282.830) (-1279.357) [-1283.528] -- 0:00:08
863500 -- (-1282.683) (-1281.387) (-1281.930) [-1279.533] * (-1282.502) [-1281.756] (-1282.012) (-1281.036) -- 0:00:08
864000 -- (-1281.169) (-1282.288) (-1280.895) [-1279.927] * [-1282.093] (-1282.738) (-1281.871) (-1282.041) -- 0:00:08
864500 -- (-1282.843) (-1286.681) [-1283.179] (-1281.017) * (-1283.790) (-1283.850) [-1284.153] (-1281.295) -- 0:00:08
865000 -- (-1281.768) [-1280.736] (-1279.772) (-1280.079) * [-1281.079] (-1285.798) (-1280.559) (-1282.367) -- 0:00:08
Average standard deviation of split frequencies: 0.009036
865500 -- [-1284.807] (-1280.565) (-1282.835) (-1281.416) * [-1281.672] (-1280.380) (-1281.053) (-1279.961) -- 0:00:08
866000 -- (-1280.664) (-1281.387) [-1283.490] (-1280.612) * [-1280.045] (-1281.197) (-1282.639) (-1280.699) -- 0:00:08
866500 -- [-1280.710] (-1281.514) (-1285.208) (-1281.198) * (-1279.989) (-1281.610) [-1281.268] (-1280.387) -- 0:00:08
867000 -- (-1284.281) (-1281.134) [-1280.675] (-1281.242) * (-1280.429) [-1282.787] (-1283.199) (-1279.728) -- 0:00:08
867500 -- (-1283.748) (-1284.468) [-1279.933] (-1283.057) * (-1281.342) (-1283.947) (-1284.390) [-1279.667] -- 0:00:08
868000 -- (-1284.409) (-1280.772) (-1285.051) [-1284.067] * (-1280.409) [-1279.567] (-1280.400) (-1280.111) -- 0:00:08
868500 -- (-1281.677) [-1279.277] (-1280.615) (-1280.833) * (-1280.826) (-1280.893) (-1282.207) [-1283.858] -- 0:00:08
869000 -- [-1279.293] (-1286.934) (-1283.541) (-1281.433) * (-1281.354) [-1282.537] (-1280.084) (-1281.363) -- 0:00:08
869500 -- [-1280.748] (-1286.617) (-1284.030) (-1284.492) * [-1281.125] (-1286.645) (-1281.726) (-1283.484) -- 0:00:08
870000 -- [-1281.040] (-1281.785) (-1283.054) (-1284.664) * [-1281.256] (-1280.802) (-1284.228) (-1281.703) -- 0:00:08
Average standard deviation of split frequencies: 0.009035
870500 -- (-1280.164) [-1280.610] (-1280.473) (-1284.607) * (-1281.401) (-1283.106) [-1280.449] (-1279.412) -- 0:00:08
871000 -- (-1279.641) (-1291.828) [-1280.636] (-1282.175) * (-1281.082) (-1281.399) [-1280.237] (-1279.864) -- 0:00:08
871500 -- (-1281.512) (-1279.245) (-1281.096) [-1282.718] * (-1288.766) (-1284.170) [-1281.168] (-1280.714) -- 0:00:08
872000 -- (-1279.790) (-1280.359) (-1280.668) [-1282.688] * (-1281.817) (-1286.682) [-1282.862] (-1281.087) -- 0:00:08
872500 -- (-1280.319) (-1280.811) (-1283.296) [-1284.589] * (-1283.166) (-1284.990) (-1280.962) [-1279.633] -- 0:00:08
873000 -- (-1280.605) (-1281.729) [-1280.286] (-1281.914) * (-1279.986) (-1280.349) (-1284.703) [-1283.791] -- 0:00:08
873500 -- (-1281.104) (-1280.465) (-1281.072) [-1282.150] * (-1280.953) [-1279.758] (-1281.831) (-1281.770) -- 0:00:07
874000 -- [-1284.123] (-1287.078) (-1281.781) (-1281.560) * [-1280.401] (-1281.187) (-1279.789) (-1283.903) -- 0:00:07
874500 -- (-1280.606) (-1287.948) [-1279.628] (-1280.248) * (-1284.165) (-1281.846) [-1280.155] (-1283.240) -- 0:00:07
875000 -- [-1280.913] (-1280.342) (-1281.990) (-1279.539) * (-1284.026) (-1281.349) [-1281.358] (-1281.007) -- 0:00:07
Average standard deviation of split frequencies: 0.009081
875500 -- (-1280.207) (-1279.956) (-1284.994) [-1279.901] * (-1285.386) [-1283.245] (-1282.150) (-1280.710) -- 0:00:07
876000 -- (-1280.734) [-1279.600] (-1279.171) (-1281.148) * (-1287.903) [-1282.335] (-1282.013) (-1281.632) -- 0:00:07
876500 -- (-1282.492) (-1279.358) [-1279.676] (-1280.064) * (-1282.913) [-1279.399] (-1282.512) (-1279.351) -- 0:00:07
877000 -- (-1281.040) [-1279.251] (-1280.069) (-1282.872) * [-1279.809] (-1281.081) (-1283.041) (-1279.814) -- 0:00:07
877500 -- (-1284.853) (-1281.005) [-1283.127] (-1283.254) * (-1282.025) (-1280.626) [-1283.391] (-1280.669) -- 0:00:07
878000 -- (-1279.472) [-1279.607] (-1283.278) (-1284.055) * (-1283.319) [-1281.261] (-1280.933) (-1281.918) -- 0:00:07
878500 -- (-1281.528) [-1279.752] (-1283.331) (-1282.713) * (-1279.734) (-1281.793) (-1280.140) [-1281.623] -- 0:00:07
879000 -- [-1280.286] (-1279.496) (-1287.228) (-1283.901) * (-1280.557) [-1282.443] (-1281.082) (-1280.585) -- 0:00:07
879500 -- [-1279.752] (-1279.173) (-1284.275) (-1284.340) * (-1282.557) (-1282.189) (-1280.797) [-1280.734] -- 0:00:07
880000 -- [-1281.453] (-1280.508) (-1281.713) (-1281.468) * (-1279.686) [-1280.948] (-1290.304) (-1282.211) -- 0:00:07
Average standard deviation of split frequencies: 0.008921
880500 -- [-1285.371] (-1280.141) (-1282.313) (-1280.962) * (-1281.245) [-1281.649] (-1286.731) (-1280.863) -- 0:00:07
881000 -- (-1280.157) (-1280.142) [-1284.484] (-1281.365) * (-1284.070) (-1281.926) (-1282.230) [-1279.656] -- 0:00:07
881500 -- (-1280.117) (-1284.396) [-1279.923] (-1282.651) * (-1281.185) (-1279.763) (-1279.985) [-1282.738] -- 0:00:07
882000 -- [-1283.119] (-1280.537) (-1281.665) (-1281.544) * (-1282.849) [-1281.463] (-1281.640) (-1280.045) -- 0:00:07
882500 -- (-1279.769) (-1285.985) (-1283.177) [-1281.859] * (-1283.964) (-1281.531) (-1280.702) [-1279.432] -- 0:00:07
883000 -- [-1279.535] (-1281.856) (-1279.598) (-1284.203) * [-1280.688] (-1281.202) (-1279.963) (-1279.456) -- 0:00:07
883500 -- (-1280.642) (-1280.590) (-1280.822) [-1281.025] * (-1281.777) [-1281.244] (-1279.481) (-1280.190) -- 0:00:07
884000 -- (-1280.550) [-1281.509] (-1283.769) (-1282.183) * (-1281.780) (-1282.153) (-1281.999) [-1280.912] -- 0:00:07
884500 -- (-1281.141) (-1281.529) (-1282.665) [-1280.434] * [-1287.448] (-1280.480) (-1282.610) (-1281.613) -- 0:00:07
885000 -- [-1282.552] (-1280.984) (-1285.089) (-1286.624) * (-1286.934) (-1281.472) (-1279.938) [-1280.230] -- 0:00:07
Average standard deviation of split frequencies: 0.008579
885500 -- [-1283.520] (-1281.437) (-1283.159) (-1282.902) * (-1286.579) (-1282.722) [-1283.100] (-1281.620) -- 0:00:07
886000 -- (-1283.737) (-1281.479) [-1283.071] (-1282.640) * (-1281.140) (-1281.864) [-1280.156] (-1284.612) -- 0:00:07
886500 -- [-1279.701] (-1282.837) (-1287.595) (-1283.275) * (-1279.367) [-1282.868] (-1281.858) (-1282.158) -- 0:00:07
887000 -- (-1281.133) (-1280.985) (-1280.113) [-1281.503] * (-1279.141) [-1281.215] (-1284.817) (-1281.577) -- 0:00:07
887500 -- [-1280.293] (-1280.316) (-1279.158) (-1281.735) * [-1280.053] (-1280.492) (-1280.195) (-1280.919) -- 0:00:07
888000 -- (-1279.327) [-1282.914] (-1279.731) (-1281.214) * (-1281.294) (-1280.938) (-1281.059) [-1281.131] -- 0:00:07
888500 -- (-1280.204) [-1280.842] (-1279.473) (-1281.486) * [-1282.159] (-1279.799) (-1281.324) (-1282.435) -- 0:00:07
889000 -- (-1281.682) (-1280.618) (-1280.748) [-1280.451] * (-1281.799) (-1279.537) (-1284.437) [-1279.705] -- 0:00:06
889500 -- (-1281.733) (-1282.574) (-1286.706) [-1280.820] * (-1282.991) (-1281.510) [-1282.105] (-1279.551) -- 0:00:06
890000 -- [-1279.314] (-1281.503) (-1282.724) (-1281.178) * (-1280.059) (-1280.977) (-1283.839) [-1280.700] -- 0:00:06
Average standard deviation of split frequencies: 0.009068
890500 -- (-1281.403) (-1281.674) [-1280.610] (-1280.603) * (-1283.093) [-1280.063] (-1283.878) (-1281.213) -- 0:00:06
891000 -- (-1283.370) (-1284.424) (-1282.563) [-1279.959] * (-1282.547) [-1281.343] (-1280.329) (-1282.301) -- 0:00:06
891500 -- (-1279.861) (-1282.768) (-1280.478) [-1279.804] * (-1280.211) (-1280.727) [-1280.451] (-1281.154) -- 0:00:06
892000 -- (-1281.951) (-1282.774) [-1280.688] (-1280.202) * (-1283.681) [-1279.430] (-1280.721) (-1281.893) -- 0:00:06
892500 -- (-1286.994) [-1283.197] (-1280.415) (-1284.222) * (-1283.095) (-1282.280) (-1287.017) [-1281.514] -- 0:00:06
893000 -- (-1280.489) (-1281.485) [-1279.300] (-1287.062) * (-1280.006) (-1281.615) [-1282.790] (-1280.424) -- 0:00:06
893500 -- [-1279.567] (-1282.116) (-1279.532) (-1282.621) * (-1279.650) (-1283.357) [-1282.288] (-1282.425) -- 0:00:06
894000 -- (-1279.812) (-1285.338) [-1279.914] (-1281.802) * [-1280.678] (-1285.743) (-1286.605) (-1280.714) -- 0:00:06
894500 -- (-1279.272) [-1281.825] (-1279.328) (-1281.458) * (-1280.221) [-1282.380] (-1281.141) (-1281.298) -- 0:00:06
895000 -- (-1279.272) (-1281.056) [-1279.805] (-1279.180) * [-1279.823] (-1281.399) (-1281.174) (-1282.328) -- 0:00:06
Average standard deviation of split frequencies: 0.009084
895500 -- (-1279.253) (-1282.579) (-1279.709) [-1279.052] * [-1279.845] (-1280.377) (-1279.387) (-1280.262) -- 0:00:06
896000 -- [-1282.301] (-1283.380) (-1281.476) (-1279.225) * [-1280.033] (-1282.331) (-1281.289) (-1284.106) -- 0:00:06
896500 -- (-1284.146) (-1279.682) [-1284.028] (-1279.815) * (-1279.378) [-1281.045] (-1280.672) (-1285.195) -- 0:00:06
897000 -- (-1283.474) [-1279.422] (-1281.460) (-1280.973) * [-1280.448] (-1280.343) (-1283.244) (-1281.703) -- 0:00:06
897500 -- (-1284.082) [-1283.261] (-1281.397) (-1280.720) * (-1279.597) (-1283.799) [-1280.751] (-1284.007) -- 0:00:06
898000 -- [-1284.554] (-1282.890) (-1280.866) (-1280.487) * (-1281.699) (-1282.210) [-1280.731] (-1280.260) -- 0:00:06
898500 -- (-1284.312) [-1279.935] (-1280.157) (-1279.632) * (-1279.638) [-1282.303] (-1281.653) (-1281.829) -- 0:00:06
899000 -- (-1280.544) (-1279.341) (-1281.688) [-1282.733] * (-1280.065) (-1283.074) [-1280.462] (-1285.804) -- 0:00:06
899500 -- [-1280.295] (-1281.561) (-1282.185) (-1279.160) * (-1279.351) (-1281.616) [-1283.652] (-1280.618) -- 0:00:06
900000 -- [-1279.326] (-1282.486) (-1281.423) (-1279.216) * (-1285.139) (-1284.056) (-1280.361) [-1282.890] -- 0:00:06
Average standard deviation of split frequencies: 0.008828
900500 -- (-1282.033) (-1283.692) (-1282.148) [-1279.384] * [-1285.128] (-1284.791) (-1279.590) (-1280.331) -- 0:00:06
901000 -- (-1283.776) (-1280.106) (-1284.519) [-1280.754] * (-1281.101) (-1284.599) [-1281.713] (-1280.082) -- 0:00:06
901500 -- [-1279.806] (-1281.959) (-1281.285) (-1280.689) * (-1284.960) (-1279.817) [-1281.138] (-1282.682) -- 0:00:06
902000 -- [-1279.199] (-1279.994) (-1281.148) (-1282.077) * (-1286.317) (-1280.549) [-1281.384] (-1284.585) -- 0:00:06
902500 -- (-1279.875) (-1280.259) [-1283.742] (-1284.276) * (-1283.545) (-1281.163) (-1280.598) [-1281.639] -- 0:00:06
903000 -- [-1281.167] (-1280.891) (-1284.395) (-1280.144) * (-1289.034) [-1280.294] (-1283.215) (-1281.131) -- 0:00:06
903500 -- (-1281.453) [-1280.642] (-1282.106) (-1282.712) * (-1284.491) [-1279.774] (-1282.682) (-1279.479) -- 0:00:06
904000 -- (-1282.829) (-1281.918) (-1280.626) [-1281.409] * [-1281.700] (-1284.477) (-1281.030) (-1281.922) -- 0:00:06
904500 -- (-1282.560) (-1281.762) [-1281.116] (-1282.357) * [-1280.597] (-1280.529) (-1279.550) (-1282.477) -- 0:00:06
905000 -- (-1281.079) (-1282.061) [-1280.207] (-1288.346) * (-1282.865) (-1283.439) [-1279.611] (-1281.570) -- 0:00:05
Average standard deviation of split frequencies: 0.008553
905500 -- (-1280.992) [-1283.294] (-1281.497) (-1282.735) * (-1280.696) [-1284.410] (-1280.600) (-1279.451) -- 0:00:05
906000 -- (-1280.451) [-1283.784] (-1281.858) (-1280.494) * (-1280.496) (-1280.367) (-1280.196) [-1279.949] -- 0:00:05
906500 -- (-1281.228) [-1281.444] (-1283.675) (-1280.753) * [-1282.021] (-1279.513) (-1282.888) (-1281.935) -- 0:00:05
907000 -- (-1279.993) (-1282.313) [-1281.739] (-1285.345) * (-1282.819) (-1285.588) (-1288.295) [-1282.903] -- 0:00:05
907500 -- [-1280.034] (-1282.367) (-1281.078) (-1281.180) * (-1279.803) (-1286.606) [-1284.534] (-1281.854) -- 0:00:05
908000 -- [-1281.866] (-1282.517) (-1279.366) (-1280.888) * (-1280.936) (-1284.427) (-1284.161) [-1281.420] -- 0:00:05
908500 -- (-1279.163) (-1283.936) [-1280.642] (-1282.462) * (-1280.837) (-1283.865) (-1282.585) [-1280.743] -- 0:00:05
909000 -- (-1279.859) (-1281.831) (-1282.432) [-1279.069] * (-1282.005) (-1283.762) (-1280.270) [-1281.430] -- 0:00:05
909500 -- (-1280.377) (-1280.861) [-1282.381] (-1282.846) * [-1281.587] (-1282.335) (-1280.795) (-1282.015) -- 0:00:05
910000 -- (-1279.281) (-1279.223) [-1281.261] (-1281.257) * [-1280.633] (-1280.285) (-1281.586) (-1284.211) -- 0:00:05
Average standard deviation of split frequencies: 0.008412
910500 -- [-1281.496] (-1280.836) (-1280.466) (-1280.579) * (-1284.690) (-1279.489) [-1279.194] (-1280.978) -- 0:00:05
911000 -- (-1279.635) (-1282.627) [-1281.390] (-1280.852) * (-1281.963) (-1279.730) [-1280.322] (-1282.142) -- 0:00:05
911500 -- [-1281.983] (-1285.604) (-1284.977) (-1279.773) * [-1281.913] (-1282.242) (-1282.464) (-1286.643) -- 0:00:05
912000 -- (-1281.432) (-1286.418) [-1279.800] (-1284.718) * [-1281.919] (-1281.208) (-1281.277) (-1281.614) -- 0:00:05
912500 -- [-1281.523] (-1287.176) (-1280.148) (-1286.909) * (-1281.631) (-1281.204) (-1280.356) [-1283.547] -- 0:00:05
913000 -- [-1280.709] (-1283.096) (-1280.883) (-1288.680) * [-1281.954] (-1280.677) (-1280.292) (-1280.657) -- 0:00:05
913500 -- [-1285.030] (-1281.782) (-1282.323) (-1285.013) * (-1280.204) [-1280.138] (-1280.536) (-1282.678) -- 0:00:05
914000 -- (-1281.129) [-1281.509] (-1280.130) (-1281.331) * (-1283.510) [-1279.182] (-1281.264) (-1280.500) -- 0:00:05
914500 -- (-1280.257) [-1280.596] (-1285.463) (-1279.037) * (-1284.659) [-1281.751] (-1284.630) (-1281.850) -- 0:00:05
915000 -- (-1281.022) [-1279.817] (-1279.624) (-1281.189) * (-1280.442) (-1279.151) (-1284.483) [-1280.977] -- 0:00:05
Average standard deviation of split frequencies: 0.008930
915500 -- (-1279.581) [-1280.464] (-1279.573) (-1280.174) * (-1281.732) (-1281.480) [-1283.940] (-1283.229) -- 0:00:05
916000 -- (-1279.950) (-1282.169) [-1279.009] (-1281.493) * (-1279.990) (-1282.247) (-1285.657) [-1282.550] -- 0:00:05
916500 -- (-1283.265) (-1279.783) (-1280.987) [-1284.614] * [-1280.780] (-1280.257) (-1282.532) (-1280.360) -- 0:00:05
917000 -- (-1281.845) (-1281.369) (-1282.883) [-1281.236] * (-1282.218) (-1279.906) [-1280.819] (-1280.897) -- 0:00:05
917500 -- [-1281.844] (-1280.661) (-1281.405) (-1285.633) * (-1279.699) [-1279.892] (-1281.985) (-1280.980) -- 0:00:05
918000 -- (-1282.940) (-1280.981) (-1282.557) [-1280.339] * (-1281.190) [-1279.776] (-1280.681) (-1282.096) -- 0:00:05
918500 -- (-1281.508) [-1282.348] (-1280.189) (-1283.679) * (-1281.933) [-1281.740] (-1289.044) (-1283.446) -- 0:00:05
919000 -- [-1281.127] (-1282.306) (-1279.619) (-1283.091) * (-1280.862) (-1281.528) [-1280.360] (-1287.342) -- 0:00:05
919500 -- (-1279.369) [-1280.149] (-1281.329) (-1281.959) * (-1280.963) [-1279.643] (-1279.285) (-1281.370) -- 0:00:05
920000 -- [-1279.908] (-1279.390) (-1284.169) (-1280.526) * (-1279.968) [-1279.881] (-1279.511) (-1282.425) -- 0:00:05
Average standard deviation of split frequencies: 0.008670
920500 -- (-1280.814) [-1279.407] (-1280.491) (-1280.883) * [-1280.099] (-1280.018) (-1280.149) (-1283.543) -- 0:00:05
921000 -- (-1281.096) (-1281.401) [-1281.122] (-1280.728) * (-1284.575) (-1280.723) [-1279.897] (-1280.371) -- 0:00:04
921500 -- [-1279.761] (-1282.264) (-1281.648) (-1282.429) * (-1281.697) (-1280.848) [-1279.721] (-1280.559) -- 0:00:04
922000 -- [-1280.451] (-1279.931) (-1281.562) (-1283.146) * (-1282.416) [-1280.726] (-1284.514) (-1288.921) -- 0:00:04
922500 -- (-1280.361) (-1280.267) [-1279.869] (-1280.797) * [-1281.523] (-1283.910) (-1284.242) (-1286.133) -- 0:00:04
923000 -- (-1280.469) [-1283.730] (-1283.691) (-1280.204) * (-1282.033) (-1281.777) (-1280.405) [-1283.494] -- 0:00:04
923500 -- (-1280.739) (-1281.470) [-1280.255] (-1279.699) * (-1281.749) (-1282.344) (-1282.795) [-1280.027] -- 0:00:04
924000 -- (-1282.274) (-1285.187) (-1281.256) [-1282.266] * (-1281.305) (-1280.654) [-1281.714] (-1280.468) -- 0:00:04
924500 -- (-1284.227) (-1282.623) [-1281.341] (-1283.397) * [-1282.291] (-1281.393) (-1281.144) (-1281.177) -- 0:00:04
925000 -- [-1280.332] (-1284.245) (-1283.260) (-1279.884) * (-1282.394) (-1281.653) (-1280.682) [-1283.678] -- 0:00:04
Average standard deviation of split frequencies: 0.008272
925500 -- (-1281.726) (-1279.299) (-1281.002) [-1280.279] * (-1281.808) (-1284.705) [-1282.523] (-1283.616) -- 0:00:04
926000 -- (-1282.842) [-1281.566] (-1279.486) (-1281.286) * (-1281.365) (-1282.406) (-1283.304) [-1280.040] -- 0:00:04
926500 -- (-1282.467) [-1280.076] (-1280.925) (-1280.236) * (-1279.973) (-1282.566) [-1280.113] (-1282.866) -- 0:00:04
927000 -- (-1281.699) [-1279.406] (-1281.686) (-1282.386) * (-1281.422) (-1281.855) (-1280.305) [-1282.371] -- 0:00:04
927500 -- (-1282.866) [-1279.569] (-1283.116) (-1286.163) * (-1282.744) [-1281.076] (-1283.400) (-1282.728) -- 0:00:04
928000 -- (-1286.348) (-1282.892) (-1282.013) [-1281.834] * (-1282.114) (-1281.566) (-1280.608) [-1280.455] -- 0:00:04
928500 -- (-1283.390) (-1284.467) (-1283.707) [-1280.790] * (-1280.252) (-1282.502) [-1279.599] (-1280.308) -- 0:00:04
929000 -- (-1279.425) (-1280.351) (-1284.584) [-1279.617] * (-1280.437) [-1279.837] (-1282.564) (-1281.832) -- 0:00:04
929500 -- [-1281.515] (-1281.406) (-1282.399) (-1279.641) * (-1280.872) (-1284.194) (-1279.446) [-1284.207] -- 0:00:04
930000 -- [-1283.895] (-1279.325) (-1279.905) (-1279.589) * (-1280.544) (-1282.119) (-1281.812) [-1282.929] -- 0:00:04
Average standard deviation of split frequencies: 0.008168
930500 -- (-1281.921) [-1279.966] (-1281.366) (-1279.902) * (-1280.916) (-1282.582) [-1280.266] (-1282.431) -- 0:00:04
931000 -- (-1281.659) (-1280.907) (-1279.762) [-1280.739] * [-1281.793] (-1281.272) (-1280.075) (-1281.995) -- 0:00:04
931500 -- (-1279.894) (-1282.897) [-1279.335] (-1282.417) * [-1280.669] (-1282.912) (-1280.029) (-1281.182) -- 0:00:04
932000 -- (-1281.791) (-1281.000) (-1280.198) [-1279.599] * (-1281.322) [-1284.713] (-1280.292) (-1281.763) -- 0:00:04
932500 -- (-1279.820) (-1281.014) (-1278.969) [-1280.990] * (-1280.145) (-1284.691) (-1280.964) [-1281.650] -- 0:00:04
933000 -- (-1280.019) (-1283.349) [-1279.768] (-1287.198) * [-1280.503] (-1279.478) (-1279.890) (-1282.302) -- 0:00:04
933500 -- (-1280.372) [-1284.026] (-1281.866) (-1281.661) * (-1281.586) (-1282.390) [-1280.389] (-1283.217) -- 0:00:04
934000 -- [-1286.640] (-1281.724) (-1281.010) (-1281.264) * (-1282.655) [-1280.585] (-1283.775) (-1282.110) -- 0:00:04
934500 -- (-1279.976) (-1287.686) [-1281.772] (-1280.714) * (-1282.768) (-1279.131) [-1284.679] (-1280.066) -- 0:00:04
935000 -- [-1279.911] (-1283.079) (-1282.904) (-1279.727) * (-1282.270) (-1280.637) [-1284.614] (-1280.194) -- 0:00:04
Average standard deviation of split frequencies: 0.008621
935500 -- [-1282.297] (-1279.676) (-1281.678) (-1281.723) * (-1282.173) (-1279.789) (-1281.438) [-1279.527] -- 0:00:04
936000 -- (-1282.613) (-1280.620) [-1280.888] (-1284.658) * (-1282.138) (-1281.631) [-1281.264] (-1280.077) -- 0:00:04
936500 -- (-1284.624) [-1280.528] (-1285.953) (-1283.016) * (-1283.085) (-1281.078) [-1279.563] (-1280.189) -- 0:00:04
937000 -- [-1281.845] (-1281.906) (-1284.915) (-1282.948) * (-1284.599) [-1282.436] (-1279.763) (-1280.051) -- 0:00:03
937500 -- [-1280.423] (-1284.608) (-1280.413) (-1282.466) * (-1282.281) (-1280.987) [-1280.313] (-1280.668) -- 0:00:03
938000 -- [-1280.944] (-1279.281) (-1279.895) (-1285.559) * [-1283.864] (-1280.350) (-1288.696) (-1279.412) -- 0:00:03
938500 -- [-1279.216] (-1280.934) (-1279.702) (-1280.031) * (-1281.783) (-1281.757) (-1279.471) [-1281.541] -- 0:00:03
939000 -- (-1284.874) (-1280.852) [-1281.805] (-1280.577) * (-1282.669) (-1283.530) (-1279.378) [-1284.466] -- 0:00:03
939500 -- (-1285.157) [-1281.181] (-1282.124) (-1280.687) * (-1283.490) (-1280.789) [-1279.369] (-1283.525) -- 0:00:03
940000 -- (-1283.449) (-1280.919) (-1280.925) [-1281.782] * (-1282.636) (-1282.304) [-1283.123] (-1282.742) -- 0:00:03
Average standard deviation of split frequencies: 0.008453
940500 -- (-1282.635) (-1281.931) [-1281.006] (-1281.272) * (-1284.086) (-1281.336) (-1283.458) [-1282.798] -- 0:00:03
941000 -- (-1284.000) (-1283.279) [-1280.407] (-1282.602) * [-1280.831] (-1281.458) (-1280.975) (-1282.139) -- 0:00:03
941500 -- (-1283.921) [-1280.061] (-1285.338) (-1280.540) * [-1283.088] (-1287.370) (-1281.212) (-1283.898) -- 0:00:03
942000 -- (-1284.157) [-1280.413] (-1283.169) (-1283.582) * (-1286.569) (-1282.435) [-1281.223] (-1279.679) -- 0:00:03
942500 -- (-1283.353) [-1279.787] (-1282.076) (-1285.144) * (-1285.230) (-1281.165) (-1281.701) [-1280.537] -- 0:00:03
943000 -- [-1282.547] (-1280.730) (-1282.513) (-1280.722) * (-1289.354) [-1280.770] (-1283.032) (-1280.386) -- 0:00:03
943500 -- [-1279.735] (-1280.869) (-1281.471) (-1280.743) * (-1280.813) [-1281.723] (-1281.135) (-1284.895) -- 0:00:03
944000 -- [-1280.587] (-1280.454) (-1280.470) (-1280.489) * (-1285.201) (-1281.072) (-1282.975) [-1281.987] -- 0:00:03
944500 -- (-1279.802) [-1280.437] (-1281.003) (-1281.146) * (-1284.551) [-1279.433] (-1280.307) (-1283.308) -- 0:00:03
945000 -- (-1279.648) [-1280.292] (-1285.781) (-1280.243) * [-1279.309] (-1279.735) (-1282.979) (-1282.535) -- 0:00:03
Average standard deviation of split frequencies: 0.008671
945500 -- (-1289.396) (-1282.003) (-1282.465) [-1279.664] * (-1280.184) [-1280.040] (-1281.296) (-1279.756) -- 0:00:03
946000 -- (-1280.031) (-1281.791) [-1279.547] (-1280.187) * (-1280.268) [-1280.468] (-1280.357) (-1281.146) -- 0:00:03
946500 -- (-1280.462) [-1282.393] (-1281.284) (-1279.828) * [-1282.199] (-1279.576) (-1281.089) (-1280.519) -- 0:00:03
947000 -- (-1279.610) (-1279.951) (-1282.864) [-1280.286] * (-1280.272) (-1279.847) [-1280.753] (-1281.267) -- 0:00:03
947500 -- [-1279.607] (-1279.908) (-1280.248) (-1280.088) * (-1280.574) (-1281.136) (-1280.850) [-1283.004] -- 0:00:03
948000 -- (-1282.028) (-1280.341) [-1280.197] (-1281.972) * [-1281.184] (-1283.157) (-1281.630) (-1282.216) -- 0:00:03
948500 -- (-1280.688) [-1281.116] (-1281.389) (-1282.882) * (-1280.926) (-1279.607) [-1280.422] (-1280.058) -- 0:00:03
949000 -- (-1282.686) (-1282.535) [-1280.493] (-1280.498) * [-1281.148] (-1280.496) (-1283.552) (-1279.339) -- 0:00:03
949500 -- (-1280.451) [-1282.656] (-1287.254) (-1281.625) * [-1280.992] (-1279.839) (-1281.040) (-1281.486) -- 0:00:03
950000 -- [-1279.405] (-1280.295) (-1280.641) (-1281.817) * (-1279.588) (-1282.103) (-1280.060) [-1280.385] -- 0:00:03
Average standard deviation of split frequencies: 0.008793
950500 -- [-1279.405] (-1279.732) (-1283.733) (-1280.663) * (-1280.986) (-1281.309) [-1280.684] (-1280.180) -- 0:00:03
951000 -- (-1280.264) (-1283.635) (-1285.559) [-1281.025] * (-1284.511) (-1281.189) (-1280.949) [-1283.978] -- 0:00:03
951500 -- [-1279.982] (-1282.437) (-1279.759) (-1279.888) * [-1286.131] (-1284.842) (-1279.546) (-1279.875) -- 0:00:03
952000 -- (-1282.868) [-1281.672] (-1284.406) (-1279.459) * (-1284.846) (-1280.411) (-1279.819) [-1280.969] -- 0:00:03
952500 -- [-1283.978] (-1280.571) (-1279.600) (-1281.103) * (-1287.883) (-1281.986) [-1280.382] (-1281.094) -- 0:00:02
953000 -- [-1281.796] (-1284.512) (-1279.618) (-1279.676) * (-1284.009) (-1282.758) [-1280.016] (-1280.706) -- 0:00:02
953500 -- (-1282.142) [-1283.357] (-1282.361) (-1287.369) * (-1283.220) (-1288.669) (-1280.930) [-1280.308] -- 0:00:02
954000 -- [-1281.059] (-1280.882) (-1282.164) (-1286.280) * (-1279.530) (-1286.057) (-1284.418) [-1279.954] -- 0:00:02
954500 -- (-1282.117) [-1279.775] (-1282.222) (-1282.345) * (-1280.165) (-1286.001) [-1280.570] (-1284.094) -- 0:00:02
955000 -- (-1282.670) (-1280.765) [-1279.290] (-1279.116) * [-1282.187] (-1284.623) (-1280.154) (-1281.759) -- 0:00:02
Average standard deviation of split frequencies: 0.008876
955500 -- (-1281.994) (-1281.764) [-1279.859] (-1280.293) * (-1281.824) [-1280.550] (-1280.577) (-1280.419) -- 0:00:02
956000 -- [-1285.379] (-1282.933) (-1279.760) (-1279.936) * (-1281.261) (-1280.041) [-1279.847] (-1279.546) -- 0:00:02
956500 -- [-1282.781] (-1279.610) (-1281.568) (-1281.456) * (-1279.734) [-1280.728] (-1281.678) (-1279.733) -- 0:00:02
957000 -- (-1284.080) [-1280.868] (-1279.220) (-1284.208) * (-1279.947) [-1279.493] (-1283.782) (-1282.722) -- 0:00:02
957500 -- (-1281.167) (-1285.055) [-1280.244] (-1283.574) * [-1283.356] (-1280.820) (-1280.209) (-1282.125) -- 0:00:02
958000 -- (-1281.063) (-1282.140) (-1281.217) [-1283.798] * (-1281.694) [-1280.613] (-1280.192) (-1285.261) -- 0:00:02
958500 -- [-1281.789] (-1282.458) (-1280.934) (-1282.772) * [-1280.662] (-1282.534) (-1279.873) (-1285.647) -- 0:00:02
959000 -- (-1283.183) (-1284.267) (-1281.551) [-1281.608] * (-1282.136) (-1281.954) (-1280.282) [-1281.439] -- 0:00:02
959500 -- (-1283.170) (-1280.384) (-1281.750) [-1279.963] * [-1279.623] (-1288.025) (-1281.883) (-1281.333) -- 0:00:02
960000 -- (-1281.230) (-1278.972) (-1281.946) [-1280.511] * (-1279.921) [-1283.102] (-1282.161) (-1284.851) -- 0:00:02
Average standard deviation of split frequencies: 0.009094
960500 -- (-1282.801) (-1279.279) (-1281.412) [-1281.803] * [-1280.496] (-1280.105) (-1281.716) (-1279.361) -- 0:00:02
961000 -- (-1284.819) [-1279.962] (-1279.874) (-1280.090) * (-1282.331) (-1284.567) (-1280.968) [-1281.901] -- 0:00:02
961500 -- (-1279.480) (-1284.288) (-1280.680) [-1280.301] * (-1279.968) (-1279.554) [-1284.602] (-1284.043) -- 0:00:02
962000 -- (-1280.180) (-1286.036) [-1282.772] (-1280.285) * (-1280.488) (-1279.690) [-1281.577] (-1281.397) -- 0:00:02
962500 -- [-1285.613] (-1279.909) (-1282.041) (-1279.631) * [-1280.299] (-1283.667) (-1283.339) (-1279.085) -- 0:00:02
963000 -- (-1288.263) [-1282.055] (-1282.366) (-1279.714) * (-1282.079) (-1281.857) (-1279.532) [-1279.498] -- 0:00:02
963500 -- (-1287.516) [-1284.829] (-1281.210) (-1280.382) * (-1279.927) (-1280.266) [-1280.742] (-1283.577) -- 0:00:02
964000 -- [-1280.155] (-1280.191) (-1279.814) (-1280.546) * (-1280.632) (-1283.295) (-1280.617) [-1282.328] -- 0:00:02
964500 -- (-1281.591) (-1279.875) [-1280.703] (-1281.973) * (-1284.508) (-1282.102) [-1283.396] (-1282.499) -- 0:00:02
965000 -- [-1280.354] (-1283.473) (-1280.640) (-1281.973) * (-1282.795) (-1282.127) (-1282.917) [-1280.402] -- 0:00:02
Average standard deviation of split frequencies: 0.008621
965500 -- (-1279.912) (-1280.210) [-1281.856] (-1282.003) * (-1283.515) (-1283.633) [-1282.090] (-1281.792) -- 0:00:02
966000 -- (-1280.604) [-1282.309] (-1280.388) (-1280.828) * (-1282.114) (-1282.803) [-1284.769] (-1282.061) -- 0:00:02
966500 -- (-1279.115) (-1283.866) (-1283.013) [-1280.824] * [-1284.463] (-1280.836) (-1280.171) (-1280.126) -- 0:00:02
967000 -- (-1280.902) (-1285.815) (-1281.919) [-1280.916] * [-1281.525] (-1282.715) (-1280.517) (-1282.076) -- 0:00:02
967500 -- (-1281.396) [-1283.354] (-1283.505) (-1281.686) * (-1279.426) [-1281.094] (-1282.173) (-1282.831) -- 0:00:02
968000 -- (-1283.800) (-1280.375) [-1280.164] (-1282.084) * [-1280.274] (-1279.679) (-1282.974) (-1281.224) -- 0:00:02
968500 -- (-1281.698) (-1281.117) (-1279.615) [-1284.910] * (-1280.611) [-1281.719] (-1283.052) (-1280.986) -- 0:00:01
969000 -- (-1280.975) (-1279.739) [-1281.757] (-1282.739) * (-1280.629) (-1281.349) (-1283.149) [-1283.362] -- 0:00:01
969500 -- (-1282.127) [-1279.453] (-1281.270) (-1283.127) * (-1287.610) (-1279.595) (-1282.030) [-1279.751] -- 0:00:01
970000 -- (-1285.597) [-1282.249] (-1284.727) (-1282.023) * (-1282.003) (-1280.128) (-1281.051) [-1280.836] -- 0:00:01
Average standard deviation of split frequencies: 0.008450
970500 -- (-1281.159) (-1282.665) (-1282.840) [-1281.172] * (-1282.395) (-1281.157) (-1281.713) [-1280.149] -- 0:00:01
971000 -- [-1279.611] (-1284.904) (-1282.280) (-1279.651) * (-1284.620) [-1280.790] (-1280.382) (-1281.271) -- 0:00:01
971500 -- [-1280.433] (-1282.048) (-1279.666) (-1279.372) * (-1281.259) [-1280.119] (-1282.286) (-1284.717) -- 0:00:01
972000 -- (-1281.281) (-1279.522) (-1281.473) [-1281.321] * (-1285.420) (-1279.779) [-1281.593] (-1279.887) -- 0:00:01
972500 -- [-1282.124] (-1280.227) (-1279.524) (-1281.329) * (-1281.249) (-1287.133) (-1281.462) [-1279.873] -- 0:00:01
973000 -- (-1280.635) (-1280.528) (-1284.877) [-1283.486] * (-1281.039) [-1280.064] (-1279.989) (-1279.764) -- 0:00:01
973500 -- (-1280.263) [-1280.122] (-1281.920) (-1280.749) * [-1279.257] (-1283.300) (-1281.869) (-1282.436) -- 0:00:01
974000 -- [-1280.193] (-1280.213) (-1282.417) (-1280.443) * (-1280.919) [-1281.610] (-1284.412) (-1281.453) -- 0:00:01
974500 -- (-1281.048) [-1280.621] (-1284.559) (-1279.820) * (-1282.691) (-1288.486) [-1279.853] (-1281.826) -- 0:00:01
975000 -- (-1280.671) (-1283.023) (-1280.827) [-1279.263] * (-1283.798) (-1284.378) [-1280.188] (-1280.820) -- 0:00:01
Average standard deviation of split frequencies: 0.008630
975500 -- [-1281.485] (-1282.162) (-1281.919) (-1280.355) * [-1281.231] (-1286.629) (-1280.083) (-1282.678) -- 0:00:01
976000 -- (-1281.892) (-1281.366) (-1283.601) [-1280.940] * (-1284.387) (-1287.245) [-1279.715] (-1280.344) -- 0:00:01
976500 -- [-1279.975] (-1281.035) (-1279.924) (-1281.272) * (-1285.064) (-1283.504) (-1281.657) [-1280.006] -- 0:00:01
977000 -- [-1281.120] (-1280.072) (-1280.080) (-1280.378) * [-1279.880] (-1282.699) (-1280.330) (-1285.017) -- 0:00:01
977500 -- [-1281.629] (-1284.036) (-1281.856) (-1282.272) * (-1280.670) (-1282.211) (-1280.914) [-1280.819] -- 0:00:01
978000 -- [-1280.584] (-1282.228) (-1286.138) (-1281.258) * (-1281.590) (-1280.860) (-1281.309) [-1281.862] -- 0:00:01
978500 -- (-1284.070) (-1283.269) (-1280.673) [-1280.134] * (-1283.342) (-1281.080) [-1279.683] (-1280.154) -- 0:00:01
979000 -- [-1281.935] (-1281.281) (-1280.946) (-1282.339) * (-1280.588) [-1280.689] (-1280.871) (-1281.945) -- 0:00:01
979500 -- (-1282.339) (-1284.127) [-1281.022] (-1281.586) * (-1286.063) (-1281.540) [-1280.161] (-1280.741) -- 0:00:01
980000 -- (-1281.066) [-1284.656] (-1279.998) (-1279.920) * (-1279.429) [-1283.236] (-1281.540) (-1281.217) -- 0:00:01
Average standard deviation of split frequencies: 0.009037
980500 -- (-1281.933) (-1284.328) [-1281.801] (-1288.498) * (-1279.781) (-1282.210) (-1285.139) [-1282.454] -- 0:00:01
981000 -- (-1282.052) [-1279.784] (-1279.676) (-1286.722) * (-1279.455) [-1280.017] (-1280.377) (-1280.350) -- 0:00:01
981500 -- (-1287.412) (-1280.212) [-1280.885] (-1282.866) * (-1279.223) (-1279.897) [-1280.156] (-1282.447) -- 0:00:01
982000 -- (-1284.019) (-1279.743) (-1279.776) [-1282.798] * [-1279.396] (-1283.182) (-1282.156) (-1280.173) -- 0:00:01
982500 -- [-1280.767] (-1282.494) (-1280.154) (-1281.007) * (-1280.313) [-1284.365] (-1282.318) (-1281.277) -- 0:00:01
983000 -- (-1283.487) [-1280.471] (-1282.370) (-1282.441) * (-1279.884) (-1280.589) (-1281.539) [-1280.820] -- 0:00:01
983500 -- (-1281.411) (-1279.183) (-1283.238) [-1281.885] * (-1282.917) (-1280.814) [-1279.929] (-1280.462) -- 0:00:01
984000 -- (-1282.310) (-1279.613) [-1282.480] (-1280.394) * (-1282.524) (-1281.030) (-1281.809) [-1279.826] -- 0:00:01
984500 -- (-1286.249) [-1280.523] (-1282.309) (-1285.480) * [-1281.467] (-1279.560) (-1279.875) (-1279.705) -- 0:00:00
985000 -- (-1283.441) (-1282.338) (-1280.641) [-1281.786] * (-1280.660) [-1281.438] (-1280.137) (-1282.963) -- 0:00:00
Average standard deviation of split frequencies: 0.008829
985500 -- (-1280.430) (-1280.634) [-1280.606] (-1281.153) * [-1279.496] (-1280.317) (-1282.550) (-1279.842) -- 0:00:00
986000 -- (-1280.966) (-1279.706) [-1279.500] (-1282.927) * (-1282.627) [-1281.617] (-1281.937) (-1281.923) -- 0:00:00
986500 -- (-1280.143) [-1281.762] (-1281.052) (-1280.677) * (-1279.815) [-1279.896] (-1284.584) (-1279.663) -- 0:00:00
987000 -- (-1279.484) (-1283.572) (-1282.802) [-1279.851] * (-1280.448) (-1279.792) (-1280.172) [-1280.160] -- 0:00:00
987500 -- (-1279.968) (-1280.307) (-1280.872) [-1280.211] * (-1280.511) (-1281.722) (-1279.805) [-1283.584] -- 0:00:00
988000 -- (-1283.714) (-1281.939) (-1279.658) [-1281.038] * [-1280.187] (-1279.639) (-1281.379) (-1280.984) -- 0:00:00
988500 -- (-1281.885) [-1281.485] (-1279.311) (-1280.338) * (-1281.200) [-1280.141] (-1281.195) (-1284.121) -- 0:00:00
989000 -- (-1281.550) (-1280.763) (-1281.635) [-1284.716] * (-1281.925) (-1281.060) [-1279.988] (-1282.677) -- 0:00:00
989500 -- (-1281.073) (-1281.727) [-1282.200] (-1286.508) * (-1285.010) [-1279.528] (-1280.401) (-1281.444) -- 0:00:00
990000 -- (-1280.184) (-1280.903) (-1279.987) [-1280.937] * (-1281.569) [-1280.905] (-1279.427) (-1282.411) -- 0:00:00
Average standard deviation of split frequencies: 0.008407
990500 -- [-1279.853] (-1282.827) (-1279.557) (-1280.035) * (-1279.570) [-1282.212] (-1279.467) (-1285.741) -- 0:00:00
991000 -- (-1280.616) [-1280.247] (-1279.646) (-1281.292) * [-1282.512] (-1279.870) (-1280.923) (-1280.153) -- 0:00:00
991500 -- (-1281.713) [-1279.975] (-1280.251) (-1280.809) * [-1280.349] (-1281.773) (-1283.105) (-1279.696) -- 0:00:00
992000 -- (-1281.072) (-1281.926) (-1280.214) [-1282.820] * (-1283.224) [-1280.378] (-1280.103) (-1284.518) -- 0:00:00
992500 -- (-1279.481) [-1282.995] (-1282.749) (-1281.291) * (-1280.716) (-1281.787) [-1282.841] (-1280.196) -- 0:00:00
993000 -- (-1284.833) [-1282.625] (-1280.985) (-1280.234) * (-1281.718) (-1280.893) [-1280.296] (-1281.038) -- 0:00:00
993500 -- (-1281.128) (-1281.953) [-1282.093] (-1281.483) * (-1281.526) [-1281.496] (-1281.634) (-1283.511) -- 0:00:00
994000 -- (-1282.577) [-1279.641] (-1280.757) (-1280.303) * [-1280.527] (-1283.523) (-1279.517) (-1286.875) -- 0:00:00
994500 -- (-1281.059) (-1280.391) (-1279.911) [-1280.901] * [-1280.618] (-1280.229) (-1281.876) (-1279.048) -- 0:00:00
995000 -- (-1279.861) (-1283.174) [-1280.145] (-1280.847) * (-1281.000) (-1280.005) (-1281.031) [-1279.328] -- 0:00:00
Average standard deviation of split frequencies: 0.008803
995500 -- (-1283.003) (-1282.365) [-1280.997] (-1282.530) * (-1284.339) (-1279.590) (-1280.729) [-1280.104] -- 0:00:00
996000 -- (-1282.057) (-1285.033) (-1282.704) [-1282.958] * (-1280.624) [-1279.365] (-1280.933) (-1281.193) -- 0:00:00
996500 -- (-1284.811) (-1280.771) (-1280.132) [-1281.741] * (-1280.859) (-1281.291) [-1281.503] (-1285.064) -- 0:00:00
997000 -- (-1279.916) [-1282.475] (-1281.249) (-1282.462) * (-1283.291) (-1281.238) (-1279.576) [-1281.875] -- 0:00:00
997500 -- (-1279.800) (-1282.371) (-1283.309) [-1283.587] * [-1279.207] (-1281.978) (-1279.624) (-1280.653) -- 0:00:00
998000 -- [-1279.351] (-1281.130) (-1281.728) (-1282.839) * (-1279.119) (-1281.710) (-1282.437) [-1281.035] -- 0:00:00
998500 -- (-1279.765) (-1281.521) [-1280.246] (-1281.366) * (-1280.238) (-1281.472) (-1279.710) [-1282.949] -- 0:00:00
999000 -- (-1285.714) (-1284.206) [-1283.752] (-1280.462) * [-1280.356] (-1285.109) (-1282.401) (-1281.656) -- 0:00:00
999500 -- (-1284.373) [-1282.859] (-1283.175) (-1280.703) * [-1282.210] (-1285.542) (-1280.574) (-1281.754) -- 0:00:00
1000000 -- [-1281.416] (-1284.234) (-1281.620) (-1287.943) * (-1281.088) (-1282.144) (-1280.654) [-1280.573] -- 0:00:00
Average standard deviation of split frequencies: 0.008888
Analysis completed in 1 mins 3 seconds
Analysis used 61.55 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1278.92
Likelihood of best state for "cold" chain of run 2 was -1278.92
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.4 % ( 58 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.1 % ( 39 %) Dirichlet(Pi{all})
27.4 % ( 23 %) Slider(Pi{all})
78.3 % ( 52 %) Multiplier(Alpha{1,2})
77.6 % ( 52 %) Multiplier(Alpha{3})
17.6 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.4 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
25.8 % ( 32 %) Dirichlet(Pi{all})
27.8 % ( 29 %) Slider(Pi{all})
78.7 % ( 57 %) Multiplier(Alpha{1,2})
77.5 % ( 42 %) Multiplier(Alpha{3})
18.3 % ( 20 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 32 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.7 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166442 0.82 0.67
3 | 166077 167006 0.84
4 | 167100 166825 166550
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166906 0.82 0.67
3 | 166517 166254 0.83
4 | 166689 166749 166885
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1280.43
| 1 |
| 1 |
| 21 2 2 |
| 2 2 1 2 |
|2 1 2 2 1 * 2|
| 1 2 1 1 121 2 1 1*1 1 |
| 2 2 2 1 11 2 * 2 2221 2 1 12 |
|1 21 212 2 2 12 2 22 |
| 1 22 2 22 2 1 2 2 1 1 1 1 1 |
| 11 2 2*12 1 2 1 2 2 2 1 1|
| 1 111 2 1 1 1 1 1 2 2 |
| * 1 1 212 |
| 2 1 111 |
| |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1282.30
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1280.61 -1284.75
2 -1280.59 -1284.04
--------------------------------------
TOTAL -1280.60 -1284.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896865 0.092076 0.337593 1.470771 0.862366 1501.00 1501.00 1.000
r(A<->C){all} 0.161683 0.019339 0.000021 0.451826 0.121522 216.44 232.04 1.001
r(A<->G){all} 0.152552 0.018872 0.000039 0.432625 0.113113 142.01 185.27 1.000
r(A<->T){all} 0.181023 0.022384 0.000089 0.471911 0.145378 244.20 266.00 1.000
r(C<->G){all} 0.172303 0.020963 0.000020 0.453184 0.134847 207.74 229.01 1.000
r(C<->T){all} 0.168443 0.019144 0.000036 0.447495 0.134196 205.63 249.02 1.004
r(G<->T){all} 0.163997 0.018982 0.000050 0.440620 0.129936 171.79 230.64 1.000
pi(A){all} 0.163193 0.000142 0.140809 0.188369 0.163174 1221.66 1259.66 1.000
pi(C){all} 0.254466 0.000195 0.228388 0.282187 0.254734 1359.80 1386.05 1.001
pi(G){all} 0.362526 0.000246 0.334169 0.396336 0.362559 1433.01 1444.64 1.000
pi(T){all} 0.219815 0.000181 0.194175 0.246784 0.219484 1462.57 1481.78 1.000
alpha{1,2} 0.435480 0.242438 0.000221 1.420231 0.259239 1256.66 1329.25 1.000
alpha{3} 0.454286 0.254408 0.000108 1.469810 0.281585 1101.20 1202.36 1.000
pinvar{all} 0.998428 0.000004 0.994915 1.000000 0.999026 784.19 1028.06 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ..*..*
9 -- .****.
10 -- .***.*
11 -- .**...
12 -- .*.***
13 -- ....**
14 -- ..**..
15 -- .**.**
16 -- .*...*
17 -- ..****
18 -- ...*.*
19 -- .*..*.
20 -- ..*.*.
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 461 0.153564 0.001413 0.152565 0.154564 2
8 445 0.148235 0.005182 0.144570 0.151899 2
9 439 0.146236 0.004240 0.143238 0.149234 2
10 437 0.145570 0.016488 0.133911 0.157229 2
11 434 0.144570 0.018844 0.131246 0.157895 2
12 431 0.143571 0.001413 0.142572 0.144570 2
13 430 0.143238 0.014133 0.133245 0.153231 2
14 428 0.142572 0.009422 0.135909 0.149234 2
15 424 0.141239 0.001884 0.139907 0.142572 2
16 424 0.141239 0.012248 0.132578 0.149900 2
17 418 0.139241 0.016017 0.127915 0.150566 2
18 417 0.138907 0.001413 0.137908 0.139907 2
19 414 0.137908 0.002827 0.135909 0.139907 2
20 407 0.135576 0.021199 0.120586 0.150566 2
21 398 0.132578 0.006595 0.127915 0.137242 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099992 0.010191 0.000036 0.290827 0.069713 1.000 2
length{all}[2] 0.099276 0.010493 0.000017 0.302967 0.065660 1.000 2
length{all}[3] 0.098868 0.009303 0.000001 0.289937 0.069874 1.000 2
length{all}[4] 0.100063 0.010019 0.000045 0.293615 0.071137 1.000 2
length{all}[5] 0.099561 0.010278 0.000017 0.297156 0.069067 1.000 2
length{all}[6] 0.102687 0.010130 0.000016 0.310244 0.072098 1.000 2
length{all}[7] 0.101043 0.008608 0.000026 0.294001 0.070175 0.998 2
length{all}[8] 0.104969 0.010661 0.000023 0.287444 0.074235 0.998 2
length{all}[9] 0.095855 0.008987 0.000514 0.266194 0.068988 1.000 2
length{all}[10] 0.098780 0.007329 0.000508 0.259522 0.078431 0.999 2
length{all}[11] 0.088729 0.007838 0.000164 0.260386 0.060211 0.998 2
length{all}[12] 0.100863 0.010301 0.001276 0.305355 0.068359 1.009 2
length{all}[13] 0.095180 0.009302 0.000478 0.286735 0.063330 1.005 2
length{all}[14] 0.098418 0.009697 0.000074 0.277279 0.069856 0.998 2
length{all}[15] 0.091922 0.009501 0.000221 0.283711 0.059285 1.000 2
length{all}[16] 0.099155 0.009129 0.000426 0.302264 0.075567 0.998 2
length{all}[17] 0.100234 0.009217 0.000223 0.273598 0.070947 0.998 2
length{all}[18] 0.095740 0.008868 0.000375 0.273995 0.069277 0.998 2
length{all}[19] 0.096860 0.009075 0.000024 0.280825 0.068054 0.999 2
length{all}[20] 0.099747 0.010725 0.000325 0.285573 0.064346 0.998 2
length{all}[21] 0.101529 0.010091 0.000197 0.310799 0.075272 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008888
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 951
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 317 / 317 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 317 / 317 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106265 0.038280 0.056619 0.103465 0.012343 0.055299 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1348.996054
Iterating by ming2
Initial: fx= 1348.996054
x= 0.10627 0.03828 0.05662 0.10346 0.01234 0.05530 0.30000 1.30000
1 h-m-p 0.0000 0.0000 761.2859 ++ 1326.177308 m 0.0000 13 | 1/8
2 h-m-p 0.0002 0.0042 119.6377 +++ 1300.125619 m 0.0042 25 | 2/8
3 h-m-p 0.0000 0.0000 1748.3255 ++ 1295.453399 m 0.0000 36 | 3/8
4 h-m-p 0.0001 0.0012 387.1382 ++ 1266.931094 m 0.0012 47 | 4/8
5 h-m-p 0.0000 0.0000 247.5301 ++ 1265.784198 m 0.0000 58 | 5/8
6 h-m-p 0.0003 0.0062 11.8804 +++ 1263.185887 m 0.0062 70 | 6/8
7 h-m-p 0.0117 0.1029 4.3602 -------------.. | 6/8
8 h-m-p 0.0000 0.0003 296.3729 +++ 1232.817064 m 0.0003 104 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 ++ 1232.817064 m 8.0000 115 | 7/8
10 h-m-p 0.0160 8.0000 0.0020 +++++ 1232.817056 m 8.0000 130 | 7/8
11 h-m-p 0.0409 8.0000 0.3872 ------------C 1232.817056 0 0.0000 154 | 7/8
12 h-m-p 0.0160 8.0000 0.0000 ----N 1232.817056 0 0.0000 170 | 7/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1232.817056 m 8.0000 185 | 7/8
14 h-m-p 0.0160 8.0000 0.3803 -------------.. | 7/8
15 h-m-p 0.0160 8.0000 0.0005 +++++ 1232.817055 m 8.0000 223 | 7/8
16 h-m-p 0.0160 8.0000 0.3771 -----------Y 1232.817055 0 0.0000 246 | 7/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 1232.817055 m 8.0000 261 | 7/8
18 h-m-p 0.0160 8.0000 0.4149 -------------.. | 7/8
19 h-m-p 0.0160 8.0000 0.0005 +++++ 1232.817053 m 8.0000 299 | 7/8
20 h-m-p 0.0160 8.0000 0.3734 -----------C 1232.817053 0 0.0000 322 | 7/8
21 h-m-p 0.0160 8.0000 0.0000 -----------Y 1232.817053 0 0.0000 345 | 7/8
22 h-m-p 0.0160 8.0000 0.0000 ---------Y 1232.817053 0 0.0000 366
Out..
lnL = -1232.817053
367 lfun, 367 eigenQcodon, 2202 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.050922 0.054440 0.070386 0.013449 0.047393 0.073197 0.000100 0.591864 0.268029
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.698227
np = 9
lnL0 = -1325.401436
Iterating by ming2
Initial: fx= 1325.401436
x= 0.05092 0.05444 0.07039 0.01345 0.04739 0.07320 0.00011 0.59186 0.26803
1 h-m-p 0.0000 0.0000 709.1822 ++ 1324.228780 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 398.9289 +++ 1301.185108 m 0.0002 27 | 2/9
3 h-m-p 0.0001 0.0004 184.3389 ++ 1256.548276 m 0.0004 39 | 3/9
4 h-m-p 0.0006 0.0030 74.2676 ++ 1233.578735 m 0.0030 51 | 4/9
5 h-m-p 0.0000 0.0000 2240.4184 ++ 1233.503655 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 610.4196 ++ 1232.943990 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0000 4383.4387 ++ 1232.817005 m 0.0000 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 1232.817005 m 8.0000 99 | 7/9
9 h-m-p 0.0048 2.4166 0.3626 ---------C 1232.817005 0 0.0000 122 | 7/9
10 h-m-p 0.0160 8.0000 0.0008 +++++ 1232.817000 m 8.0000 139 | 7/9
11 h-m-p 0.0295 5.3289 0.2225 --------------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0008 +++++ 1232.816995 m 8.0000 182 | 7/9
13 h-m-p 0.0285 5.4363 0.2196 -----------Y 1232.816995 0 0.0000 207 | 7/9
14 h-m-p 0.0102 5.0857 0.0348 +++++ 1232.816760 m 5.0857 224 | 8/9
15 h-m-p 0.6485 6.1955 0.1587 -------------Y 1232.816760 0 0.0000 251 | 8/9
16 h-m-p 0.0160 8.0000 0.0001 +++++ 1232.816758 m 8.0000 267 | 8/9
17 h-m-p 0.0096 4.7837 0.2057 -------------.. | 8/9
18 h-m-p 0.0160 8.0000 0.0016 +++++ 1232.816737 m 8.0000 307 | 8/9
19 h-m-p 0.0617 4.7971 0.2078 -------------Y 1232.816737 0 0.0000 333 | 8/9
20 h-m-p 0.0160 8.0000 0.0000 ---Y 1232.816737 0 0.0001 349 | 8/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 1232.816737 m 8.0000 365 | 8/9
22 h-m-p 0.0101 5.0541 0.1973 -------------.. | 8/9
23 h-m-p 0.0032 1.6057 0.0017 +++++ 1232.816732 m 1.6057 405 | 9/9
24 h-m-p 0.0160 8.0000 0.0000 Y 1232.816732 0 0.0160 418
Out..
lnL = -1232.816732
419 lfun, 1257 eigenQcodon, 5028 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.024464 0.048309 0.076064 0.052555 0.033001 0.033289 0.000100 1.357363 0.367584 0.291337 2.244553
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.725061
np = 11
lnL0 = -1311.054583
Iterating by ming2
Initial: fx= 1311.054583
x= 0.02446 0.04831 0.07606 0.05255 0.03300 0.03329 0.00011 1.35736 0.36758 0.29134 2.24455
1 h-m-p 0.0000 0.0000 675.8746 ++ 1309.688727 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0011 210.0325 ++++ 1265.426846 m 0.0011 32 | 2/11
3 h-m-p 0.0000 0.0000 1571.2411 ++ 1254.380810 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0000 306.9788 ++ 1253.989886 m 0.0000 60 | 4/11
5 h-m-p 0.0000 0.0000 2618.4872 ++ 1250.258401 m 0.0000 74 | 5/11
6 h-m-p 0.0005 0.0037 20.6307 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 504.5976 ++ 1241.679753 m 0.0000 111 | 6/11
8 h-m-p 0.0012 0.0528 11.3056 -----------.. | 6/11
9 h-m-p 0.0000 0.0000 423.5062 ++ 1239.363105 m 0.0000 148 | 7/11
10 h-m-p 0.0160 8.0000 7.7540 -------------.. | 7/11
11 h-m-p 0.0000 0.0001 300.4218 ++ 1232.817139 m 0.0001 187 | 8/11
12 h-m-p 0.2423 8.0000 0.0000 +++ 1232.817139 m 8.0000 202 | 8/11
13 h-m-p 0.0160 8.0000 0.0254 --------Y 1232.817139 0 0.0000 227 | 8/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 1232.817139 m 8.0000 247 | 8/11
15 h-m-p 0.0160 8.0000 3.9321 -------------.. | 8/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 1232.817139 m 8.0000 292 | 8/11
17 h-m-p 0.0160 8.0000 0.2794 +++++ 1232.816839 m 8.0000 312 | 8/11
18 h-m-p 0.0173 0.0864 13.3469 ++ 1232.816764 m 0.0864 329 | 9/11
19 h-m-p 1.6000 8.0000 0.5927 ++ 1232.816732 m 8.0000 343 | 9/11
20 h-m-p 1.6000 8.0000 0.0384 ++ 1232.816732 m 8.0000 359 | 9/11
21 h-m-p 0.3721 8.0000 0.8259 +++ 1232.816732 m 8.0000 376 | 9/11
22 h-m-p 1.6000 8.0000 0.0105 --C 1232.816732 0 0.0250 394 | 9/11
23 h-m-p 1.2500 8.0000 0.0002 -N 1232.816732 0 0.0781 411 | 9/11
24 h-m-p 0.0067 3.3348 25.7226 +++Y 1232.816732 0 0.4269 430 | 9/11
25 h-m-p 1.6000 8.0000 0.0000 Y 1232.816732 0 1.6000 444 | 9/11
26 h-m-p 0.0160 8.0000 0.0000 Y 1232.816732 0 0.0160 460
Out..
lnL = -1232.816732
461 lfun, 1844 eigenQcodon, 8298 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1232.865144 S = -1232.817711 -0.018313
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:04
did 20 / 56 patterns 0:04
did 30 / 56 patterns 0:04
did 40 / 56 patterns 0:04
did 50 / 56 patterns 0:04
did 56 / 56 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.013600 0.025697 0.017824 0.109297 0.056626 0.089224 0.000100 1.093628 1.991789
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.050176
np = 9
lnL0 = -1325.358169
Iterating by ming2
Initial: fx= 1325.358169
x= 0.01360 0.02570 0.01782 0.10930 0.05663 0.08922 0.00011 1.09363 1.99179
1 h-m-p 0.0000 0.0000 709.8318 ++ 1324.573068 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0075 67.2690 +++++ 1303.186296 m 0.0075 29 | 2/9
3 h-m-p 0.0000 0.0000 15717.0888 ++ 1290.329808 m 0.0000 41 | 3/9
4 h-m-p 0.0000 0.0000 6612.1809 +
QuantileBeta(0.15, 0.00500, 2.18027) = 1.207746e-160 2000 rounds
+ 1276.399896 m 0.0000 53
QuantileBeta(0.15, 0.00500, 2.18027) = 1.207746e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18027) = 1.207746e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18027) = 1.207746e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18027) = 1.207746e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18027) = 1.207746e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18027) = 1.207746e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18027) = 1.207746e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18027) = 1.207745e-160 2000 rounds
| 4/9
5 h-m-p 0.0000 0.0000 194.2039
QuantileBeta(0.15, 0.00500, 2.18041) = 1.207649e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18083) = 1.207356e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18097) = 1.207259e-160 2000 rounds
+ 1274.576016 m 0.0000 65
QuantileBeta(0.15, 0.00500, 2.18097) = 1.207259e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18097) = 1.207259e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18097) = 1.207259e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18097) = 1.207259e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18097) = 1.207259e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18097) = 1.207259e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18097) = 1.207259e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18097) = 1.207258e-160 2000 rounds
| 5/9
6 h-m-p 0.0001 0.0039 21.7699
QuantileBeta(0.15, 0.00500, 2.17932) = 1.208408e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17439) = 1.211868e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15466) = 1.225906e-160 2000 rounds
++ 1266.802975 m 0.0039 78 | 6/9
7 h-m-p 0.0361 8.0000 1.8381
QuantileBeta(0.15, 0.00500, 2.16424) = 1.219048e-160 2000 rounds
--------------.. | 6/9
8 h-m-p 0.0000 0.0001 389.4251 ++ 1248.632306 m 0.0001 114 | 7/9
9 h-m-p 0.0326 8.0000 0.9656 --------------.. | 7/9
10 h-m-p 0.0000 0.0002 276.5709 +++ 1232.816732 m 0.0002 153 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 1232.816732 0 1.6000 165 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 N 1232.816732 0 0.0160 178
Out..
lnL = -1232.816732
179 lfun, 1969 eigenQcodon, 10740 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.094766 0.091712 0.048865 0.103324 0.037420 0.092340 0.000100 0.900000 0.840647 1.881474 2.507825
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.203697
np = 11
lnL0 = -1358.681997
Iterating by ming2
Initial: fx= 1358.681997
x= 0.09477 0.09171 0.04887 0.10332 0.03742 0.09234 0.00011 0.90000 0.84065 1.88147 2.50783
1 h-m-p 0.0000 0.0000 591.5719 ++ 1358.340728 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 1627.2886 ++ 1302.117767 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0000 29986.9853 ++ 1287.091524 m 0.0000 44 | 3/11
4 h-m-p 0.0006 0.0151 56.0561 +++ 1234.799299 m 0.0151 59 | 4/11
5 h-m-p 0.0000 0.0001 1585.9112 ++ 1233.202705 m 0.0001 73 | 5/11
6 h-m-p 0.0001 0.0004 593.2096 ++ 1232.840027 m 0.0004 87 | 6/11
7 h-m-p 0.0000 0.0000 6983.8986 ++ 1232.817221 m 0.0000 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0013 --------Y 1232.817221 0 0.0000 123 | 7/11
9 h-m-p 0.0160 8.0000 0.0002 +++++ 1232.817220 m 8.0000 144 | 7/11
10 h-m-p 0.0049 2.4667 0.4526 ---------C 1232.817220 0 0.0000 171 | 7/11
11 h-m-p 0.0160 8.0000 0.0002 +++++ 1232.817220 m 8.0000 192 | 7/11
12 h-m-p 0.0077 3.8489 0.5161 ------------Y 1232.817220 0 0.0000 222 | 7/11
13 h-m-p 0.0160 8.0000 0.0007 -----------N 1232.817220 0 0.0000 251 | 7/11
14 h-m-p 0.0160 8.0000 0.0033 +++++ 1232.817216 m 8.0000 272 | 7/11
15 h-m-p 0.0593 3.3877 0.4382 -----------C 1232.817216 0 0.0000 301 | 7/11
16 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0004 +++++ 1232.817215 m 8.0000 351 | 7/11
18 h-m-p 0.0135 2.8959 0.2446 -----------Y 1232.817215 0 0.0000 380 | 7/11
19 h-m-p 0.0160 8.0000 0.0014 +++++ 1232.817210 m 8.0000 401 | 7/11
20 h-m-p 0.0425 2.8858 0.2705 -----------C 1232.817210 0 0.0000 430 | 7/11
21 h-m-p 0.0160 8.0000 0.0004 +++++ 1232.817210 m 8.0000 451 | 7/11
22 h-m-p 0.0096 3.3752 0.2962 ------------Y 1232.817210 0 0.0000 481 | 7/11
23 h-m-p 0.0160 8.0000 0.0012 +++++ 1232.817207 m 8.0000 502 | 7/11
24 h-m-p 0.0337 3.4714 0.2835 --------------.. | 7/11
25 h-m-p 0.0160 8.0000 0.0005 +++++ 1232.817205 m 8.0000 553 | 7/11
26 h-m-p 0.0156 3.1527 0.2319 -----------C 1232.817205 0 0.0000 582 | 7/11
27 h-m-p 0.0160 8.0000 0.0003 +++++ 1232.817204 m 8.0000 603 | 7/11
28 h-m-p 0.0064 3.2050 0.6171 ------------.. | 7/11
29 h-m-p 0.0160 8.0000 0.0005 +++++ 1232.817203 m 8.0000 652 | 7/11
30 h-m-p 0.0161 3.2010 0.2298 -----------Y 1232.817203 0 0.0000 681 | 7/11
31 h-m-p 0.0160 8.0000 0.0051 +++++ 1232.817183 m 8.0000 702 | 7/11
32 h-m-p 0.1587 3.1826 0.2576 --------------Y 1232.817183 0 0.0000 734 | 7/11
33 h-m-p 0.0160 8.0000 0.0039 +++++ 1232.817166 m 8.0000 755 | 7/11
34 h-m-p 0.1244 3.4310 0.2502 ---------------.. | 7/11
35 h-m-p 0.0160 8.0000 0.0006 +++++ 1232.817163 m 8.0000 807 | 7/11
36 h-m-p 0.0262 4.1286 0.1955 ------------C 1232.817163 0 0.0000 837 | 7/11
37 h-m-p 0.0019 0.9373 0.2141 +++++ 1232.816884 m 0.9373 858 | 8/11
38 h-m-p 0.7955 8.0000 0.0292 ------------N 1232.816884 0 0.0000 888 | 8/11
39 h-m-p 0.0160 8.0000 0.0025 +++++ 1232.816878 m 8.0000 908 | 8/11
40 h-m-p 0.0247 4.3778 0.7937 ------------Y 1232.816878 0 0.0000 937 | 8/11
41 h-m-p 0.0160 8.0000 0.0001 ----------N 1232.816878 0 0.0000 964 | 8/11
42 h-m-p 0.0160 8.0000 0.0007 +++++ 1232.816876 m 8.0000 984 | 8/11
43 h-m-p 0.0160 8.0000 0.4191 ------------Y 1232.816876 0 0.0000 1013 | 8/11
44 h-m-p 0.0160 8.0000 0.0020 -------------.. | 8/11
45 h-m-p 0.0160 8.0000 0.0004 +++++ 1232.816874 m 8.0000 1061 | 8/11
46 h-m-p 0.0160 8.0000 0.4341 ----------Y 1232.816874 0 0.0000 1088 | 8/11
47 h-m-p 0.0160 8.0000 0.0002 +++++ 1232.816874 m 8.0000 1108 | 8/11
48 h-m-p 0.0160 8.0000 0.4457 -------------.. | 8/11
49 h-m-p 0.0160 8.0000 0.0004 +++++ 1232.816872 m 8.0000 1156 | 8/11
50 h-m-p 0.0160 8.0000 0.4309 -----------Y 1232.816872 0 0.0000 1184 | 8/11
51 h-m-p 0.0145 7.2534 0.0344 ++++
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
+ 1232.816732 m 7.2534 1204
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14212) = 1.234992e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14188) = 1.235168e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
| 9/11
52 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235095e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
+ 1232.816732 m 8.0000 1221
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14210) = 1.235011e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14186) = 1.235187e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
| 9/11
53 h-m-p 0.1332 8.0000 0.0006
QuantileBeta(0.15, 0.00500, 2.14200) = 1.235080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235095e-160 2000 rounds
C 1232.816732 0 0.0333 1237
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14210) = 1.235006e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14186) = 1.235182e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
| 9/11
54 h-m-p 0.0713 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235095e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
Y 1232.816732 0 0.0000 1258
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
Out..
lnL = -1232.816732
1259 lfun, 15108 eigenQcodon, 83094 P(t)
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1232.879384 S = -1232.817711 -0.027419
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:28
did 20 / 56 patterns 0:28
did 30 / 56 patterns 0:29
did 40 / 56 patterns 0:29
did 50 / 56 patterns 0:29
did 56 / 56 patterns 0:29
QuantileBeta(0.15, 0.00500, 2.14198) = 1.235094e-160 2000 rounds
Time used: 0:29
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0258/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 317
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 4 4 4 4 4 4 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 3 3 3 3 3 3
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 2 2 2 2 2 2 | His CAT 3 3 3 3 3 3 | Arg CGT 6 6 6 6 6 6
CTC 4 4 4 4 4 4 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 9 9 9 9 9 9
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 15 15 15 15 15 15 | CCG 3 3 3 3 3 3 | CAG 4 4 4 4 4 4 | CGG 10 10 10 10 10 10
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 6 6 6 6 6 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 3 3 3 3 3 3
ATC 12 12 12 12 12 12 | ACC 8 8 8 8 8 8 | AAC 1 1 1 1 1 1 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 4 4 4 4 4 4 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 10 10 10 10 10 10 | ACG 5 5 5 5 5 5 | AAG 2 2 2 2 2 2 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 7 7 7 7 7 7 | Asp GAT 10 10 10 10 10 10 | Gly GGT 10 10 10 10 10 10
GTC 15 15 15 15 15 15 | GCC 13 13 13 13 13 13 | GAC 12 12 12 12 12 12 | GGC 9 9 9 9 9 9
GTA 4 4 4 4 4 4 | GCA 5 5 5 5 5 5 | Glu GAA 9 9 9 9 9 9 | GGA 5 5 5 5 5 5
GTG 17 17 17 17 17 17 | GCG 18 18 18 18 18 18 | GAG 11 11 11 11 11 11 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907637_1_265_MLBR_RS01305
position 1: T:0.10726 C:0.21136 A:0.19243 G:0.48896
position 2: T:0.32808 C:0.25237 A:0.19243 G:0.22713
position 3: T:0.22397 C:0.29968 A:0.10410 G:0.37224
Average T:0.21977 C:0.25447 A:0.16299 G:0.36278
#2: NC_002677_1_NP_301313_1_185_ML0258
position 1: T:0.10726 C:0.21136 A:0.19243 G:0.48896
position 2: T:0.32808 C:0.25237 A:0.19243 G:0.22713
position 3: T:0.22397 C:0.29968 A:0.10410 G:0.37224
Average T:0.21977 C:0.25447 A:0.16299 G:0.36278
#3: NZ_LVXE01000009_1_WP_010907637_1_2840_A3216_RS04630
position 1: T:0.10726 C:0.21136 A:0.19243 G:0.48896
position 2: T:0.32808 C:0.25237 A:0.19243 G:0.22713
position 3: T:0.22397 C:0.29968 A:0.10410 G:0.37224
Average T:0.21977 C:0.25447 A:0.16299 G:0.36278
#4: NZ_LYPH01000016_1_WP_010907637_1_539_A8144_RS02530
position 1: T:0.10726 C:0.21136 A:0.19243 G:0.48896
position 2: T:0.32808 C:0.25237 A:0.19243 G:0.22713
position 3: T:0.22397 C:0.29968 A:0.10410 G:0.37224
Average T:0.21977 C:0.25447 A:0.16299 G:0.36278
#5: NZ_CP029543_1_WP_010907637_1_264_DIJ64_RS01365
position 1: T:0.10726 C:0.21136 A:0.19243 G:0.48896
position 2: T:0.32808 C:0.25237 A:0.19243 G:0.22713
position 3: T:0.22397 C:0.29968 A:0.10410 G:0.37224
Average T:0.21977 C:0.25447 A:0.16299 G:0.36278
#6: NZ_AP014567_1_WP_010907637_1_273_JK2ML_RS01410
position 1: T:0.10726 C:0.21136 A:0.19243 G:0.48896
position 2: T:0.32808 C:0.25237 A:0.19243 G:0.22713
position 3: T:0.22397 C:0.29968 A:0.10410 G:0.37224
Average T:0.21977 C:0.25447 A:0.16299 G:0.36278
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 24 | Tyr Y TAT 12 | Cys C TGT 18
TTC 6 | TCC 6 | TAC 6 | TGC 12
Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 48 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 12 | His H CAT 18 | Arg R CGT 36
CTC 24 | CCC 6 | CAC 12 | CGC 54
CTA 6 | CCA 0 | Gln Q CAA 12 | CGA 6
CTG 90 | CCG 18 | CAG 24 | CGG 60
------------------------------------------------------------------------------
Ile I ATT 36 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 18
ATC 72 | ACC 48 | AAC 6 | AGC 24
ATA 0 | ACA 24 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 60 | ACG 30 | AAG 12 | AGG 18
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 42 | Asp D GAT 60 | Gly G GGT 60
GTC 90 | GCC 78 | GAC 72 | GGC 54
GTA 24 | GCA 30 | Glu E GAA 54 | GGA 30
GTG 102 | GCG 108 | GAG 66 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10726 C:0.21136 A:0.19243 G:0.48896
position 2: T:0.32808 C:0.25237 A:0.19243 G:0.22713
position 3: T:0.22397 C:0.29968 A:0.10410 G:0.37224
Average T:0.21977 C:0.25447 A:0.16299 G:0.36278
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1232.817053 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.349018
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907637_1_265_MLBR_RS01305: 0.000004, NC_002677_1_NP_301313_1_185_ML0258: 0.000004, NZ_LVXE01000009_1_WP_010907637_1_2840_A3216_RS04630: 0.000004, NZ_LYPH01000016_1_WP_010907637_1_539_A8144_RS02530: 0.000004, NZ_CP029543_1_WP_010907637_1_264_DIJ64_RS01365: 0.000004, NZ_AP014567_1_WP_010907637_1_273_JK2ML_RS01410: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.34902
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 682.5 268.5 0.3490 0.0000 0.0000 0.0 0.0
7..2 0.000 682.5 268.5 0.3490 0.0000 0.0000 0.0 0.0
7..3 0.000 682.5 268.5 0.3490 0.0000 0.0000 0.0 0.0
7..4 0.000 682.5 268.5 0.3490 0.0000 0.0000 0.0 0.0
7..5 0.000 682.5 268.5 0.3490 0.0000 0.0000 0.0 0.0
7..6 0.000 682.5 268.5 0.3490 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1232.816732 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907637_1_265_MLBR_RS01305: 0.000004, NC_002677_1_NP_301313_1_185_ML0258: 0.000004, NZ_LVXE01000009_1_WP_010907637_1_2840_A3216_RS04630: 0.000004, NZ_LYPH01000016_1_WP_010907637_1_539_A8144_RS02530: 0.000004, NZ_CP029543_1_WP_010907637_1_264_DIJ64_RS01365: 0.000004, NZ_AP014567_1_WP_010907637_1_273_JK2ML_RS01410: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1232.816732 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907637_1_265_MLBR_RS01305: 0.000004, NC_002677_1_NP_301313_1_185_ML0258: 0.000004, NZ_LVXE01000009_1_WP_010907637_1_2840_A3216_RS04630: 0.000004, NZ_LYPH01000016_1_WP_010907637_1_539_A8144_RS02530: 0.000004, NZ_CP029543_1_WP_010907637_1_264_DIJ64_RS01365: 0.000004, NZ_AP014567_1_WP_010907637_1_273_JK2ML_RS01410: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907637_1_265_MLBR_RS01305)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1232.816732 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 2.118062
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907637_1_265_MLBR_RS01305: 0.000004, NC_002677_1_NP_301313_1_185_ML0258: 0.000004, NZ_LVXE01000009_1_WP_010907637_1_2840_A3216_RS04630: 0.000004, NZ_LYPH01000016_1_WP_010907637_1_539_A8144_RS02530: 0.000004, NZ_CP029543_1_WP_010907637_1_264_DIJ64_RS01365: 0.000004, NZ_AP014567_1_WP_010907637_1_273_JK2ML_RS01410: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 2.11806
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1232.816732 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.141983 2.897502
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907637_1_265_MLBR_RS01305: 0.000004, NC_002677_1_NP_301313_1_185_ML0258: 0.000004, NZ_LVXE01000009_1_WP_010907637_1_2840_A3216_RS04630: 0.000004, NZ_LYPH01000016_1_WP_010907637_1_539_A8144_RS02530: 0.000004, NZ_CP029543_1_WP_010907637_1_264_DIJ64_RS01365: 0.000004, NZ_AP014567_1_WP_010907637_1_273_JK2ML_RS01410: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.14198
(p1 = 0.00001) w = 2.89750
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.89750
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 682.5 268.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907637_1_265_MLBR_RS01305)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:29