--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 16:25:58 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0258/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1280.61         -1284.75
2      -1280.59         -1284.04
--------------------------------------
TOTAL    -1280.60         -1284.46
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896865    0.092076    0.337593    1.470771    0.862366   1501.00   1501.00    1.000
r(A<->C){all}   0.161683    0.019339    0.000021    0.451826    0.121522    216.44    232.04    1.001
r(A<->G){all}   0.152552    0.018872    0.000039    0.432625    0.113113    142.01    185.27    1.000
r(A<->T){all}   0.181023    0.022384    0.000089    0.471911    0.145378    244.20    266.00    1.000
r(C<->G){all}   0.172303    0.020963    0.000020    0.453184    0.134847    207.74    229.01    1.000
r(C<->T){all}   0.168443    0.019144    0.000036    0.447495    0.134196    205.63    249.02    1.004
r(G<->T){all}   0.163997    0.018982    0.000050    0.440620    0.129936    171.79    230.64    1.000
pi(A){all}      0.163193    0.000142    0.140809    0.188369    0.163174   1221.66   1259.66    1.000
pi(C){all}      0.254466    0.000195    0.228388    0.282187    0.254734   1359.80   1386.05    1.001
pi(G){all}      0.362526    0.000246    0.334169    0.396336    0.362559   1433.01   1444.64    1.000
pi(T){all}      0.219815    0.000181    0.194175    0.246784    0.219484   1462.57   1481.78    1.000
alpha{1,2}      0.435480    0.242438    0.000221    1.420231    0.259239   1256.66   1329.25    1.000
alpha{3}        0.454286    0.254408    0.000108    1.469810    0.281585   1101.20   1202.36    1.000
pinvar{all}     0.998428    0.000004    0.994915    1.000000    0.999026    784.19   1028.06    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1232.816732
Model 2: PositiveSelection	-1232.816732
Model 0: one-ratio	-1232.817053
Model 7: beta	-1232.816732
Model 8: beta&w>1	-1232.816732


Model 0 vs 1	6.419999999707215E-4

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C2
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C3
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C4
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C5
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C6
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=317 

C1              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C2              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C3              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C4              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C5              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C6              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
                **************************************************

C1              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C2              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C3              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C4              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C5              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C6              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
                **************************************************

C1              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C2              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C3              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C4              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C5              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C6              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
                **************************************************

C1              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C2              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C3              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C4              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C5              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C6              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
                **************************************************

C1              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C2              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C3              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C4              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C5              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C6              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
                **************************************************

C1              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C2              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C3              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C4              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C5              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C6              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
                **************************************************

C1              IVSERDILDGIVLSIAG
C2              IVSERDILDGIVLSIAG
C3              IVSERDILDGIVLSIAG
C4              IVSERDILDGIVLSIAG
C5              IVSERDILDGIVLSIAG
C6              IVSERDILDGIVLSIAG
                *****************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [9510]--->[9510]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.511 Mb, Max= 30.882 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C2              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C3              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C4              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C5              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
C6              VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
                **************************************************

C1              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C2              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C3              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C4              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C5              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
C6              DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
                **************************************************

C1              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C2              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C3              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C4              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C5              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
C6              GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
                **************************************************

C1              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C2              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C3              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C4              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C5              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
C6              GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
                **************************************************

C1              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C2              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C3              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C4              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C5              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
C6              ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
                **************************************************

C1              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C2              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C3              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C4              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C5              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
C6              VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
                **************************************************

C1              IVSERDILDGIVLSIAG
C2              IVSERDILDGIVLSIAG
C3              IVSERDILDGIVLSIAG
C4              IVSERDILDGIVLSIAG
C5              IVSERDILDGIVLSIAG
C6              IVSERDILDGIVLSIAG
                *****************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C2              GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C3              GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C4              GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C5              GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
C6              GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
                **************************************************

C1              GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C2              GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C3              GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C4              GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C5              GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
C6              GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
                **************************************************

C1              GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C2              GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C3              GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C4              GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C5              GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
C6              GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
                **************************************************

C1              GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C2              GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C3              GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C4              GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C5              GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
C6              GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
                **************************************************

C1              AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C2              AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C3              AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C4              AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C5              AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
C6              AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
                **************************************************

C1              GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C2              GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C3              GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C4              GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C5              GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
C6              GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
                **************************************************

C1              GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C2              GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C3              GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C4              GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C5              GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
C6              GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
                **************************************************

C1              AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C2              AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C3              AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C4              AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C5              AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
C6              AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
                **************************************************

C1              CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C2              CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C3              CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C4              CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C5              CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
C6              CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
                **************************************************

C1              GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C2              GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C3              GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C4              GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C5              GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
C6              GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
                **************************************************

C1              CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C2              CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C3              CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C4              CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C5              CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
C6              CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
                **************************************************

C1              CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C2              CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C3              CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C4              CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C5              CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
C6              CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
                **************************************************

C1              GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C2              GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C3              GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C4              GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C5              GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
C6              GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
                **************************************************

C1              TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C2              TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C3              TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C4              TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C5              TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
C6              TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
                **************************************************

C1              ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C2              ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C3              ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C4              ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C5              ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
C6              ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
                **************************************************

C1              GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C2              GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C3              GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C4              GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C5              GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
C6              GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
                **************************************************

C1              GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C2              GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C3              GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C4              GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C5              GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
C6              GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
                **************************************************

C1              TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C2              TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C3              TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C4              TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C5              TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
C6              TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
                **************************************************

C1              ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C2              ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C3              ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C4              ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C5              ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
C6              ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
                **************************************************

C1              G
C2              G
C3              G
C4              G
C5              G
C6              G
                *



>C1
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C2
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C3
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C4
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C5
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C6
GTGAGTCGGGTCGCCGCGATTGACTGTGGTACCAACTCGATTCGGTTGCT
GATTGCCGATGTGGCGGGCAGGAAGTTGCGCGATGTGCATCGTGAGATGA
GGATCGTGCGGCTGGGACAAGGAGTCGACGCAACGGGCGAGTTTGCGCTG
GACGCGATTGCCCGGACCCGGGCCGCGCTGGTCGATTATACTGCGCTGCT
AAGTGCTCACCGCGTCGAACGGGTGCGCATGGTTGCCACGTCGGCCGCGC
GCGATGTCGTCAATCGTGATGTGCTCTTTGCAATGACAGCCGACGTGCTT
GGCACCGTGATCCCTGGATCTGTAGCGGAGGTGATCACCGGGGCCGAGGA
AGCTGACCTGTCTTTTGATGGTGCTGTCGGCGAATTAGATAGCGCTGGTG
CGCCTTTCGTCGTTATCGACTTAGGTGGTGGATCTACCGAGATCGTTCTT
GGTGGTGGTTCGGCGGAGTGCGGGGTCGTGGCGAGCTATTCGGCCGACAT
CGGCTGCGTGCGGCTTACAGAACGTTGTTTGCACTCCGATCCGCCGACAC
CCGAGGAAGTCGCTGCGGCCCGCAAGGTGGTACGTGAACGGCTCGAAGTG
GCATTGCAGATGGTATCGGTTGAGCAAGCACGGACCTGGGTTGGGCTGGC
TGGGACGATGACCACACTGTCTGCCCTGGCACAGAATATGATGACGTACG
ACGCTGCGGCCATTCATCTTTCGCGAGTGCGCGGCAGTGATCTCATGGAA
GTCTGTGACAGGCTGATCGGCATGACGCGCGTACAGCGCGTCGCGCTGCC
GTCGATGCATGCGAGCCGGGCCGACGTGATCGGCGGTGGTGCGGTCCTGG
TCCAGGAGTTGGTGCGCGAGCTGCGTACCTGGGCGGGAATCGACGAGCTG
ATCGTCAGCGAACGTGACATTCTGGATGGCATCGTGCTCTCGATCGCGGG
G
>C1
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C2
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C3
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C4
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C5
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG
>C6
VSRVAAIDCGTNSIRLLIADVAGRKLRDVHREMRIVRLGQGVDATGEFAL
DAIARTRAALVDYTALLSAHRVERVRMVATSAARDVVNRDVLFAMTADVL
GTVIPGSVAEVITGAEEADLSFDGAVGELDSAGAPFVVIDLGGGSTEIVL
GGGSAECGVVASYSADIGCVRLTERCLHSDPPTPEEVAAARKVVRERLEV
ALQMVSVEQARTWVGLAGTMTTLSALAQNMMTYDAAAIHLSRVRGSDLME
VCDRLIGMTRVQRVALPSMHASRADVIGGGAVLVQELVRELRTWAGIDEL
IVSERDILDGIVLSIAG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 951 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579796664
      Setting output file names to "/data/4res/ML0258/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 933870158
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0833317088
      Seed = 1003864462
      Swapseed = 1579796664
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2128.383458 -- -24.965149
         Chain 2 -- -2128.383259 -- -24.965149
         Chain 3 -- -2128.383458 -- -24.965149
         Chain 4 -- -2128.383259 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2128.383582 -- -24.965149
         Chain 2 -- -2128.383582 -- -24.965149
         Chain 3 -- -2128.383582 -- -24.965149
         Chain 4 -- -2128.383458 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2128.383] (-2128.383) (-2128.383) (-2128.383) * [-2128.384] (-2128.384) (-2128.384) (-2128.383) 
        500 -- [-1293.132] (-1289.797) (-1291.381) (-1291.746) * (-1298.160) (-1312.843) (-1291.354) [-1304.538] -- 0:00:00
       1000 -- (-1288.354) (-1296.128) [-1284.822] (-1288.648) * (-1300.945) (-1288.129) [-1296.510] (-1287.299) -- 0:00:00
       1500 -- [-1285.762] (-1296.058) (-1289.401) (-1283.474) * (-1292.326) [-1286.193] (-1289.021) (-1293.383) -- 0:00:00
       2000 -- [-1289.840] (-1297.911) (-1286.842) (-1290.105) * [-1284.734] (-1287.934) (-1291.624) (-1290.243) -- 0:00:00
       2500 -- (-1286.727) (-1293.541) [-1283.673] (-1302.506) * [-1289.686] (-1288.700) (-1293.878) (-1298.710) -- 0:00:00
       3000 -- [-1286.918] (-1286.017) (-1290.765) (-1291.522) * [-1285.894] (-1296.216) (-1286.707) (-1306.821) -- 0:00:00
       3500 -- (-1289.278) [-1287.039] (-1291.040) (-1295.220) * [-1291.091] (-1291.804) (-1292.411) (-1294.366) -- 0:00:00
       4000 -- (-1292.527) [-1286.919] (-1282.426) (-1288.585) * [-1284.992] (-1288.883) (-1289.507) (-1293.455) -- 0:00:00
       4500 -- (-1283.000) [-1287.513] (-1288.136) (-1296.143) * [-1285.391] (-1296.913) (-1289.925) (-1294.317) -- 0:00:00
       5000 -- (-1300.502) (-1286.362) (-1290.364) [-1291.191] * [-1292.711] (-1295.984) (-1290.224) (-1286.765) -- 0:00:00

      Average standard deviation of split frequencies: 0.085710

       5500 -- (-1294.680) (-1296.531) [-1285.916] (-1293.313) * (-1294.239) [-1291.858] (-1296.358) (-1284.750) -- 0:03:00
       6000 -- (-1289.939) (-1293.227) (-1286.864) [-1282.907] * (-1288.229) (-1301.584) [-1285.893] (-1296.913) -- 0:02:45
       6500 -- [-1294.373] (-1296.763) (-1291.636) (-1291.174) * [-1287.983] (-1290.112) (-1291.614) (-1292.027) -- 0:02:32
       7000 -- (-1290.625) [-1284.945] (-1295.656) (-1283.176) * (-1288.892) [-1291.485] (-1285.000) (-1291.181) -- 0:02:21
       7500 -- (-1300.504) [-1289.203] (-1294.286) (-1285.578) * [-1296.043] (-1286.650) (-1289.455) (-1284.992) -- 0:02:12
       8000 -- [-1288.257] (-1290.128) (-1298.185) (-1290.313) * (-1295.296) (-1284.480) [-1286.716] (-1292.896) -- 0:02:04
       8500 -- (-1292.531) [-1287.362] (-1288.412) (-1292.270) * (-1293.017) (-1292.284) [-1291.562] (-1285.546) -- 0:01:56
       9000 -- (-1294.481) (-1289.910) (-1290.961) [-1294.817] * [-1290.729] (-1290.634) (-1294.604) (-1290.403) -- 0:01:50
       9500 -- (-1290.277) [-1292.711] (-1288.927) (-1291.647) * (-1288.091) (-1293.038) [-1289.085] (-1290.598) -- 0:01:44
      10000 -- [-1293.116] (-1291.423) (-1298.176) (-1297.093) * (-1297.897) [-1293.078] (-1288.505) (-1285.383) -- 0:01:39

      Average standard deviation of split frequencies: 0.059662

      10500 -- [-1288.934] (-1290.684) (-1301.611) (-1290.456) * (-1287.798) (-1298.821) (-1296.692) [-1288.186] -- 0:01:34
      11000 -- [-1289.410] (-1291.673) (-1292.320) (-1286.605) * [-1283.882] (-1288.688) (-1290.070) (-1291.660) -- 0:01:29
      11500 -- [-1295.890] (-1290.687) (-1292.622) (-1295.323) * (-1297.855) [-1283.728] (-1286.525) (-1290.628) -- 0:01:25
      12000 -- (-1292.884) (-1291.826) (-1288.528) [-1288.854] * (-1287.821) [-1289.030] (-1297.199) (-1294.570) -- 0:01:22
      12500 -- (-1286.339) (-1289.948) (-1289.729) [-1289.060] * (-1288.334) (-1291.395) (-1289.037) [-1289.844] -- 0:01:19
      13000 -- [-1287.471] (-1286.746) (-1293.529) (-1289.873) * (-1289.783) (-1297.218) (-1296.965) [-1287.163] -- 0:01:15
      13500 -- (-1286.645) (-1289.646) (-1286.589) [-1295.254] * (-1286.657) [-1287.821] (-1288.763) (-1287.339) -- 0:01:13
      14000 -- (-1295.850) (-1295.029) (-1294.065) [-1290.989] * (-1294.322) (-1292.092) (-1290.550) [-1292.149] -- 0:01:10
      14500 -- (-1288.056) [-1289.090] (-1288.221) (-1281.288) * (-1289.703) [-1288.835] (-1294.135) (-1291.941) -- 0:01:07
      15000 -- (-1291.976) (-1299.478) [-1285.600] (-1288.649) * (-1287.214) (-1296.973) [-1286.731] (-1289.464) -- 0:01:05

      Average standard deviation of split frequencies: 0.065941

      15500 -- (-1289.080) [-1285.505] (-1288.830) (-1283.387) * (-1291.967) [-1282.538] (-1300.030) (-1297.029) -- 0:01:03
      16000 -- (-1288.942) (-1297.053) (-1284.871) [-1279.502] * (-1294.431) (-1282.993) [-1289.585] (-1289.343) -- 0:01:01
      16500 -- (-1288.417) (-1286.426) (-1290.510) [-1279.825] * [-1289.843] (-1282.908) (-1296.543) (-1291.296) -- 0:00:59
      17000 -- [-1296.402] (-1290.451) (-1286.581) (-1281.749) * (-1294.710) (-1282.334) [-1299.164] (-1294.454) -- 0:00:57
      17500 -- (-1292.537) (-1297.352) (-1293.925) [-1280.797] * (-1287.056) (-1285.917) [-1283.749] (-1296.608) -- 0:00:56
      18000 -- (-1297.356) [-1288.210] (-1288.555) (-1279.826) * [-1287.836] (-1284.409) (-1291.082) (-1292.440) -- 0:00:54
      18500 -- [-1290.063] (-1290.372) (-1291.135) (-1281.601) * (-1302.005) (-1284.734) (-1293.353) [-1283.701] -- 0:00:53
      19000 -- (-1294.657) (-1288.554) (-1289.554) [-1280.666] * (-1287.150) (-1281.565) [-1295.423] (-1297.198) -- 0:00:51
      19500 -- [-1290.477] (-1290.519) (-1287.875) (-1280.708) * (-1293.489) (-1278.963) [-1288.570] (-1285.286) -- 0:00:50
      20000 -- (-1287.756) (-1289.855) [-1289.701] (-1280.734) * (-1290.214) (-1282.783) [-1288.018] (-1287.685) -- 0:00:49

      Average standard deviation of split frequencies: 0.063361

      20500 -- (-1302.093) (-1296.845) (-1292.142) [-1279.852] * [-1291.116] (-1281.755) (-1286.943) (-1289.013) -- 0:00:47
      21000 -- (-1291.701) (-1289.850) (-1289.890) [-1283.452] * [-1292.706] (-1283.407) (-1291.740) (-1294.416) -- 0:01:33
      21500 -- (-1281.106) [-1292.005] (-1299.119) (-1281.545) * [-1287.901] (-1283.034) (-1288.586) (-1285.663) -- 0:01:31
      22000 -- (-1281.383) (-1293.311) (-1297.119) [-1282.212] * [-1289.312] (-1281.730) (-1289.084) (-1300.512) -- 0:01:28
      22500 -- (-1282.296) (-1290.762) [-1288.644] (-1286.896) * [-1287.445] (-1282.738) (-1292.863) (-1290.493) -- 0:01:26
      23000 -- (-1289.102) [-1286.147] (-1289.415) (-1280.933) * [-1294.858] (-1284.198) (-1296.214) (-1287.457) -- 0:01:24
      23500 -- (-1282.437) (-1289.718) (-1289.076) [-1280.445] * (-1291.246) (-1284.026) (-1289.623) [-1293.741] -- 0:01:23
      24000 -- (-1283.240) (-1287.417) (-1292.094) [-1282.336] * [-1291.867] (-1281.672) (-1293.128) (-1299.004) -- 0:01:21
      24500 -- (-1282.816) (-1285.120) (-1289.362) [-1280.094] * (-1290.481) [-1283.532] (-1291.572) (-1289.974) -- 0:01:19
      25000 -- (-1283.659) (-1284.550) (-1287.884) [-1280.376] * (-1290.176) (-1284.978) [-1290.680] (-1293.208) -- 0:01:18

      Average standard deviation of split frequencies: 0.050939

      25500 -- (-1280.410) (-1290.010) (-1288.215) [-1280.450] * (-1296.754) (-1282.299) (-1290.821) [-1292.130] -- 0:01:16
      26000 -- (-1280.262) (-1288.651) [-1286.496] (-1282.997) * (-1294.856) (-1290.016) [-1292.298] (-1289.273) -- 0:01:14
      26500 -- [-1280.991] (-1293.934) (-1286.113) (-1279.412) * (-1295.616) (-1284.814) [-1295.253] (-1292.970) -- 0:01:13
      27000 -- (-1280.627) (-1294.086) (-1288.197) [-1279.504] * (-1300.877) [-1284.671] (-1293.130) (-1288.908) -- 0:01:12
      27500 -- (-1281.212) (-1290.051) (-1289.042) [-1280.922] * (-1292.700) (-1280.731) [-1291.970] (-1293.412) -- 0:01:10
      28000 -- [-1280.529] (-1290.310) (-1288.883) (-1280.630) * [-1290.537] (-1281.258) (-1290.508) (-1288.713) -- 0:01:09
      28500 -- (-1280.254) (-1293.882) [-1285.101] (-1280.890) * (-1290.112) [-1281.171] (-1281.637) (-1291.089) -- 0:01:08
      29000 -- [-1282.626] (-1288.858) (-1294.411) (-1280.914) * (-1289.918) [-1282.843] (-1282.187) (-1286.088) -- 0:01:06
      29500 -- (-1284.845) (-1286.881) (-1291.038) [-1279.766] * (-1294.838) (-1281.256) (-1283.934) [-1287.412] -- 0:01:05
      30000 -- (-1278.941) [-1289.858] (-1291.623) (-1280.546) * [-1290.873] (-1281.327) (-1283.877) (-1290.601) -- 0:01:04

      Average standard deviation of split frequencies: 0.042070

      30500 -- (-1279.889) (-1288.961) [-1286.432] (-1281.290) * (-1292.790) [-1281.907] (-1279.532) (-1307.602) -- 0:01:03
      31000 -- (-1279.915) (-1297.183) [-1299.598] (-1282.110) * (-1291.766) (-1280.661) [-1279.284] (-1285.716) -- 0:01:02
      31500 -- (-1283.605) (-1293.251) (-1291.622) [-1283.574] * (-1288.212) [-1284.341] (-1279.333) (-1286.445) -- 0:01:01
      32000 -- (-1279.464) (-1289.310) [-1290.906] (-1281.152) * [-1288.480] (-1285.208) (-1280.236) (-1282.406) -- 0:01:00
      32500 -- (-1280.786) (-1293.533) (-1291.645) [-1280.145] * (-1289.971) (-1283.869) (-1282.611) [-1282.896] -- 0:00:59
      33000 -- [-1280.588] (-1287.045) (-1292.827) (-1280.876) * (-1288.148) (-1283.453) [-1281.035] (-1288.873) -- 0:00:58
      33500 -- (-1282.958) [-1292.738] (-1307.782) (-1283.180) * (-1287.138) (-1279.335) [-1280.985] (-1284.699) -- 0:00:57
      34000 -- (-1279.396) (-1291.032) (-1279.509) [-1283.297] * (-1290.089) (-1281.105) (-1282.287) [-1281.602] -- 0:00:56
      34500 -- (-1280.472) (-1284.644) [-1281.431] (-1280.030) * (-1297.314) (-1281.110) [-1282.921] (-1283.304) -- 0:00:55
      35000 -- [-1279.500] (-1287.424) (-1287.978) (-1279.597) * (-1285.451) (-1279.825) (-1281.563) [-1283.126] -- 0:00:55

      Average standard deviation of split frequencies: 0.041778

      35500 -- (-1279.571) [-1288.901] (-1282.682) (-1282.062) * [-1293.561] (-1280.506) (-1281.790) (-1281.204) -- 0:00:54
      36000 -- (-1279.732) (-1291.369) [-1281.308] (-1283.201) * (-1292.440) (-1280.687) (-1283.125) [-1283.353] -- 0:00:53
      36500 -- (-1282.831) (-1290.303) [-1280.169] (-1281.677) * [-1299.733] (-1282.472) (-1280.673) (-1280.368) -- 0:01:19
      37000 -- (-1280.612) (-1294.439) [-1283.087] (-1280.407) * (-1286.242) [-1281.039] (-1282.339) (-1286.962) -- 0:01:18
      37500 -- (-1282.418) [-1290.973] (-1279.930) (-1280.976) * (-1292.478) [-1282.036] (-1283.983) (-1286.822) -- 0:01:17
      38000 -- (-1281.292) [-1286.044] (-1279.984) (-1280.346) * (-1291.403) (-1281.650) (-1281.157) [-1286.536] -- 0:01:15
      38500 -- (-1282.669) [-1285.615] (-1280.960) (-1280.366) * (-1289.834) [-1282.778] (-1282.351) (-1281.668) -- 0:01:14
      39000 -- (-1279.779) (-1288.933) [-1281.353] (-1281.740) * (-1290.252) (-1283.755) (-1280.576) [-1284.974] -- 0:01:13
      39500 -- (-1280.244) (-1287.043) [-1283.211] (-1281.861) * (-1289.686) (-1284.061) (-1283.824) [-1281.637] -- 0:01:12
      40000 -- (-1281.741) [-1296.347] (-1282.496) (-1282.269) * (-1296.454) (-1284.347) [-1280.170] (-1281.638) -- 0:01:12

      Average standard deviation of split frequencies: 0.045816

      40500 -- (-1281.649) (-1292.479) (-1281.730) [-1281.080] * (-1307.487) (-1284.411) (-1279.988) [-1280.575] -- 0:01:11
      41000 -- (-1284.090) [-1294.950] (-1286.336) (-1280.705) * (-1292.462) (-1287.999) (-1281.577) [-1280.698] -- 0:01:10
      41500 -- (-1282.908) (-1290.743) [-1280.208] (-1280.370) * (-1295.022) [-1281.420] (-1280.099) (-1280.581) -- 0:01:09
      42000 -- (-1282.697) (-1284.471) (-1280.644) [-1280.376] * [-1287.305] (-1282.889) (-1281.573) (-1283.401) -- 0:01:08
      42500 -- (-1286.722) [-1287.899] (-1282.336) (-1280.127) * [-1286.398] (-1282.068) (-1280.649) (-1282.965) -- 0:01:07
      43000 -- (-1281.178) (-1290.430) (-1281.958) [-1281.550] * (-1299.888) (-1281.839) (-1283.740) [-1283.371] -- 0:01:06
      43500 -- (-1280.855) [-1286.432] (-1284.373) (-1279.998) * (-1288.296) (-1283.229) (-1282.014) [-1280.576] -- 0:01:05
      44000 -- (-1281.025) (-1292.137) [-1282.728] (-1279.839) * [-1287.155] (-1285.482) (-1281.352) (-1282.255) -- 0:01:05
      44500 -- (-1282.806) (-1287.712) (-1284.992) [-1280.425] * (-1294.625) (-1285.045) (-1282.760) [-1282.751] -- 0:01:04
      45000 -- (-1280.048) (-1292.910) (-1281.327) [-1282.389] * (-1290.112) [-1286.098] (-1282.826) (-1280.789) -- 0:01:03

      Average standard deviation of split frequencies: 0.036982

      45500 -- (-1282.869) (-1293.262) (-1283.064) [-1281.013] * [-1295.967] (-1288.681) (-1281.541) (-1280.597) -- 0:01:02
      46000 -- (-1280.917) [-1289.796] (-1279.370) (-1280.263) * (-1292.597) (-1287.125) [-1283.682] (-1281.454) -- 0:01:02
      46500 -- (-1281.111) [-1289.085] (-1284.080) (-1280.531) * [-1289.418] (-1283.487) (-1281.763) (-1281.961) -- 0:01:01
      47000 -- (-1281.787) (-1291.510) [-1281.534] (-1281.076) * (-1288.896) [-1282.176] (-1281.217) (-1283.777) -- 0:01:00
      47500 -- (-1281.181) (-1288.635) (-1285.709) [-1284.023] * [-1289.504] (-1281.082) (-1281.042) (-1281.729) -- 0:01:00
      48000 -- (-1281.574) (-1296.033) [-1287.763] (-1280.708) * [-1292.986] (-1283.776) (-1280.926) (-1280.659) -- 0:00:59
      48500 -- (-1284.300) [-1287.601] (-1284.093) (-1282.690) * [-1293.143] (-1282.580) (-1282.757) (-1280.593) -- 0:00:58
      49000 -- [-1279.908] (-1291.269) (-1283.229) (-1279.789) * (-1293.572) [-1280.658] (-1280.994) (-1281.583) -- 0:00:58
      49500 -- (-1283.956) (-1287.062) (-1283.925) [-1283.010] * [-1283.790] (-1281.949) (-1281.829) (-1283.706) -- 0:00:57
      50000 -- (-1281.730) [-1290.035] (-1281.655) (-1280.205) * (-1285.944) (-1282.561) [-1282.549] (-1281.521) -- 0:00:57

      Average standard deviation of split frequencies: 0.032141

      50500 -- (-1279.812) (-1291.218) [-1281.170] (-1279.643) * (-1291.150) (-1281.684) (-1281.867) [-1284.550] -- 0:00:56
      51000 -- (-1281.509) (-1288.101) [-1281.675] (-1283.958) * [-1288.639] (-1284.791) (-1281.055) (-1282.424) -- 0:00:55
      51500 -- (-1282.195) (-1284.855) (-1280.780) [-1279.513] * (-1289.710) (-1282.726) [-1281.115] (-1283.060) -- 0:00:55
      52000 -- [-1280.194] (-1290.437) (-1281.415) (-1281.964) * [-1288.308] (-1283.045) (-1281.098) (-1283.142) -- 0:00:54
      52500 -- (-1280.833) [-1288.890] (-1282.702) (-1280.759) * (-1288.009) (-1285.860) (-1281.483) [-1281.982] -- 0:01:12
      53000 -- (-1278.952) [-1287.902] (-1283.873) (-1281.253) * (-1292.778) (-1284.187) (-1281.387) [-1280.510] -- 0:01:11
      53500 -- (-1279.009) [-1287.446] (-1280.225) (-1282.040) * (-1286.174) (-1281.669) [-1284.178] (-1280.898) -- 0:01:10
      54000 -- (-1280.332) [-1295.498] (-1280.133) (-1281.240) * [-1286.298] (-1279.808) (-1286.786) (-1285.202) -- 0:01:10
      54500 -- [-1283.036] (-1299.264) (-1281.106) (-1279.629) * (-1299.254) [-1280.082] (-1285.808) (-1283.154) -- 0:01:09
      55000 -- [-1283.161] (-1301.340) (-1282.283) (-1279.631) * (-1294.220) (-1280.511) [-1280.265] (-1281.376) -- 0:01:08

      Average standard deviation of split frequencies: 0.029262

      55500 -- (-1280.422) (-1287.842) (-1282.863) [-1279.345] * (-1285.864) [-1280.241] (-1280.474) (-1283.287) -- 0:01:08
      56000 -- (-1281.206) (-1300.123) [-1280.709] (-1280.425) * [-1290.826] (-1279.415) (-1279.495) (-1284.819) -- 0:01:07
      56500 -- (-1280.443) (-1287.321) (-1280.676) [-1281.895] * (-1288.485) (-1280.963) (-1280.053) [-1285.339] -- 0:01:06
      57000 -- (-1282.444) (-1285.910) [-1280.900] (-1282.874) * [-1283.886] (-1280.495) (-1283.142) (-1285.725) -- 0:01:06
      57500 -- (-1280.837) (-1291.447) (-1281.655) [-1280.163] * (-1282.666) [-1280.180] (-1283.113) (-1281.011) -- 0:01:05
      58000 -- (-1283.415) (-1288.231) (-1282.887) [-1280.646] * (-1281.503) (-1279.818) (-1281.879) [-1279.853] -- 0:01:04
      58500 -- [-1282.268] (-1293.193) (-1282.888) (-1284.160) * (-1288.232) (-1280.665) (-1281.876) [-1280.388] -- 0:01:04
      59000 -- (-1282.226) (-1290.559) [-1281.328] (-1280.618) * (-1286.580) (-1280.815) (-1280.468) [-1282.401] -- 0:01:03
      59500 -- (-1281.606) (-1284.454) [-1280.459] (-1280.304) * (-1288.125) (-1280.003) (-1282.524) [-1281.313] -- 0:01:03
      60000 -- (-1281.227) (-1285.502) [-1281.767] (-1286.978) * (-1284.245) (-1279.568) [-1281.461] (-1280.954) -- 0:01:02

      Average standard deviation of split frequencies: 0.029916

      60500 -- [-1281.252] (-1289.061) (-1281.527) (-1291.677) * (-1284.607) (-1281.195) (-1281.195) [-1279.813] -- 0:01:02
      61000 -- (-1280.082) [-1288.440] (-1281.756) (-1284.018) * (-1283.819) (-1284.578) [-1280.428] (-1283.803) -- 0:01:01
      61500 -- (-1281.910) (-1294.510) [-1281.561] (-1280.224) * (-1283.738) (-1284.531) (-1280.773) [-1281.247] -- 0:01:01
      62000 -- [-1280.471] (-1296.504) (-1283.417) (-1279.583) * [-1287.548] (-1280.248) (-1280.673) (-1282.144) -- 0:01:00
      62500 -- [-1279.775] (-1295.691) (-1282.528) (-1282.367) * (-1284.213) (-1282.503) [-1280.630] (-1280.075) -- 0:01:00
      63000 -- (-1284.557) [-1287.349] (-1282.357) (-1281.405) * [-1287.678] (-1286.930) (-1281.199) (-1281.177) -- 0:00:59
      63500 -- (-1284.482) (-1285.800) [-1281.500] (-1281.683) * (-1280.974) (-1285.627) [-1280.336] (-1283.023) -- 0:00:58
      64000 -- (-1283.330) (-1293.212) (-1279.425) [-1279.855] * (-1282.672) (-1279.495) (-1280.588) [-1280.584] -- 0:00:58
      64500 -- (-1284.732) (-1292.299) [-1283.158] (-1281.675) * [-1280.770] (-1279.477) (-1280.554) (-1282.359) -- 0:00:58
      65000 -- [-1280.418] (-1291.599) (-1280.713) (-1279.332) * [-1282.087] (-1279.866) (-1281.640) (-1280.460) -- 0:00:57

      Average standard deviation of split frequencies: 0.025849

      65500 -- (-1282.754) [-1283.352] (-1280.141) (-1280.846) * (-1282.797) (-1281.552) [-1280.118] (-1281.062) -- 0:00:57
      66000 -- (-1282.377) [-1291.414] (-1280.673) (-1281.260) * [-1285.167] (-1281.943) (-1282.093) (-1281.884) -- 0:00:56
      66500 -- (-1280.154) [-1286.122] (-1283.680) (-1279.941) * [-1281.358] (-1282.341) (-1284.612) (-1280.342) -- 0:00:56
      67000 -- (-1281.805) [-1290.476] (-1282.614) (-1280.424) * (-1281.868) [-1284.179] (-1283.259) (-1281.911) -- 0:00:55
      67500 -- [-1281.104] (-1294.614) (-1282.153) (-1280.134) * (-1282.280) (-1286.479) [-1279.983] (-1284.811) -- 0:00:55
      68000 -- (-1282.129) [-1288.987] (-1286.532) (-1281.462) * (-1281.782) (-1282.501) (-1280.877) [-1279.857] -- 0:00:54
      68500 -- [-1280.706] (-1285.723) (-1282.918) (-1279.521) * (-1280.957) (-1282.656) [-1280.176] (-1280.223) -- 0:01:07
      69000 -- (-1280.197) (-1295.030) (-1282.238) [-1279.360] * (-1282.418) (-1281.635) [-1285.258] (-1279.494) -- 0:01:07
      69500 -- (-1281.572) (-1285.239) (-1284.935) [-1284.051] * (-1281.442) (-1281.569) [-1280.312] (-1281.970) -- 0:01:06
      70000 -- (-1286.171) (-1290.225) (-1284.219) [-1279.241] * (-1280.755) (-1282.947) (-1281.831) [-1281.494] -- 0:01:06

      Average standard deviation of split frequencies: 0.021529

      70500 -- [-1280.196] (-1287.810) (-1283.783) (-1280.245) * (-1282.177) (-1282.283) [-1281.346] (-1282.222) -- 0:01:05
      71000 -- (-1280.409) [-1292.143] (-1281.110) (-1280.497) * (-1279.980) (-1284.716) (-1281.301) [-1280.836] -- 0:01:05
      71500 -- (-1279.874) (-1290.355) (-1281.688) [-1281.081] * (-1282.393) [-1283.173] (-1279.400) (-1279.730) -- 0:01:04
      72000 -- (-1280.299) [-1285.391] (-1284.043) (-1282.341) * [-1281.813] (-1293.224) (-1279.460) (-1281.700) -- 0:01:04
      72500 -- [-1279.995] (-1290.993) (-1284.543) (-1283.071) * (-1281.634) (-1285.144) [-1279.708] (-1284.406) -- 0:01:03
      73000 -- (-1281.872) (-1288.894) (-1282.850) [-1281.384] * [-1283.683] (-1284.789) (-1279.550) (-1282.683) -- 0:01:03
      73500 -- (-1279.652) (-1290.598) (-1281.048) [-1282.584] * [-1281.370] (-1282.807) (-1282.573) (-1283.254) -- 0:01:03
      74000 -- [-1281.393] (-1293.114) (-1279.392) (-1282.342) * (-1281.587) (-1283.991) [-1281.217] (-1282.057) -- 0:01:02
      74500 -- (-1284.482) (-1292.634) (-1279.121) [-1284.578] * [-1281.798] (-1286.485) (-1279.056) (-1280.127) -- 0:01:02
      75000 -- (-1281.023) (-1295.484) [-1280.479] (-1287.536) * [-1283.490] (-1281.073) (-1281.936) (-1280.113) -- 0:01:01

      Average standard deviation of split frequencies: 0.021709

      75500 -- (-1283.000) [-1303.168] (-1280.066) (-1285.951) * (-1281.168) (-1282.024) [-1282.310] (-1279.855) -- 0:01:01
      76000 -- (-1281.873) [-1287.689] (-1281.848) (-1280.364) * (-1281.448) (-1282.644) [-1279.507] (-1285.366) -- 0:01:00
      76500 -- (-1280.374) (-1290.876) (-1281.740) [-1280.610] * (-1283.229) (-1286.844) [-1279.974] (-1283.165) -- 0:01:00
      77000 -- (-1281.039) (-1295.054) [-1282.121] (-1280.524) * (-1282.741) (-1287.130) [-1282.626] (-1281.552) -- 0:00:59
      77500 -- (-1280.060) (-1286.791) (-1284.018) [-1279.056] * (-1281.997) (-1286.365) (-1282.425) [-1282.602] -- 0:00:59
      78000 -- (-1280.048) (-1283.809) (-1285.155) [-1279.466] * [-1279.711] (-1286.757) (-1281.226) (-1281.740) -- 0:00:59
      78500 -- (-1281.967) (-1291.908) (-1281.999) [-1280.422] * (-1279.951) (-1281.647) [-1280.591] (-1282.404) -- 0:00:58
      79000 -- (-1280.504) (-1300.424) (-1281.200) [-1279.328] * (-1284.114) (-1284.164) [-1281.113] (-1281.941) -- 0:00:58
      79500 -- (-1283.164) (-1291.670) [-1284.344] (-1285.025) * (-1285.187) (-1281.715) (-1281.097) [-1280.690] -- 0:00:57
      80000 -- [-1288.005] (-1284.175) (-1281.782) (-1280.087) * (-1282.366) (-1282.323) [-1279.799] (-1283.404) -- 0:00:57

      Average standard deviation of split frequencies: 0.025528

      80500 -- (-1289.311) [-1287.581] (-1281.951) (-1280.143) * (-1284.544) [-1280.563] (-1280.339) (-1282.586) -- 0:00:57
      81000 -- (-1280.939) [-1292.611] (-1284.746) (-1279.189) * (-1281.522) [-1279.793] (-1279.371) (-1280.936) -- 0:00:56
      81500 -- (-1280.616) [-1290.194] (-1283.768) (-1279.558) * (-1284.011) [-1280.268] (-1281.761) (-1283.096) -- 0:00:56
      82000 -- [-1280.798] (-1288.785) (-1286.547) (-1282.113) * (-1286.023) [-1280.041] (-1282.618) (-1286.630) -- 0:00:55
      82500 -- (-1282.571) (-1287.680) [-1284.712] (-1281.503) * [-1282.058] (-1281.720) (-1279.398) (-1279.795) -- 0:00:55
      83000 -- [-1281.176] (-1296.870) (-1284.932) (-1281.503) * (-1282.141) [-1281.855] (-1279.932) (-1282.798) -- 0:00:55
      83500 -- (-1282.417) (-1292.944) (-1285.377) [-1281.044] * (-1281.634) [-1288.117] (-1281.749) (-1280.905) -- 0:00:54
      84000 -- (-1285.032) (-1288.073) (-1285.378) [-1282.455] * (-1283.214) (-1287.870) (-1285.130) [-1279.719] -- 0:00:54
      84500 -- (-1281.569) (-1293.097) (-1285.862) [-1280.012] * (-1283.101) [-1280.110] (-1284.955) (-1280.358) -- 0:01:05
      85000 -- [-1280.585] (-1291.156) (-1285.120) (-1280.116) * [-1280.309] (-1282.535) (-1279.539) (-1279.494) -- 0:01:04

      Average standard deviation of split frequencies: 0.025489

      85500 -- (-1281.233) [-1287.936] (-1283.389) (-1281.383) * (-1280.630) (-1282.413) (-1281.766) [-1280.748] -- 0:01:04
      86000 -- (-1281.830) (-1291.950) (-1282.334) [-1281.079] * (-1281.724) [-1284.184] (-1282.841) (-1280.284) -- 0:01:03
      86500 -- [-1281.351] (-1296.544) (-1280.617) (-1280.417) * (-1281.402) (-1284.815) [-1283.971] (-1280.488) -- 0:01:03
      87000 -- (-1279.931) (-1291.785) (-1280.117) [-1279.805] * (-1280.949) [-1281.127] (-1282.406) (-1279.690) -- 0:01:02
      87500 -- (-1280.486) [-1294.602] (-1281.140) (-1281.432) * (-1280.868) (-1280.849) (-1280.181) [-1282.007] -- 0:01:02
      88000 -- (-1280.131) (-1290.370) (-1280.597) [-1282.077] * [-1280.517] (-1282.169) (-1280.722) (-1280.052) -- 0:01:02
      88500 -- (-1282.229) [-1293.782] (-1284.258) (-1282.732) * [-1280.199] (-1282.506) (-1280.031) (-1279.666) -- 0:01:01
      89000 -- [-1283.025] (-1293.948) (-1282.838) (-1284.668) * (-1283.098) (-1282.315) [-1281.310] (-1279.784) -- 0:01:01
      89500 -- (-1280.378) (-1288.283) [-1281.989] (-1281.437) * (-1281.652) (-1281.997) (-1283.536) [-1279.432] -- 0:01:01
      90000 -- [-1279.153] (-1291.394) (-1280.558) (-1280.365) * (-1281.989) [-1280.288] (-1283.475) (-1279.418) -- 0:01:00

      Average standard deviation of split frequencies: 0.029636

      90500 -- (-1279.115) [-1288.146] (-1282.788) (-1280.683) * (-1281.356) (-1281.258) [-1284.385] (-1279.983) -- 0:01:00
      91000 -- (-1282.491) (-1290.247) [-1280.794] (-1280.538) * (-1279.465) (-1282.469) (-1283.450) [-1284.142] -- 0:00:59
      91500 -- (-1281.590) (-1285.749) (-1280.451) [-1279.757] * (-1285.091) [-1280.311] (-1279.821) (-1280.695) -- 0:00:59
      92000 -- (-1281.160) (-1288.563) [-1280.972] (-1281.127) * [-1286.440] (-1280.710) (-1279.338) (-1281.831) -- 0:00:59
      92500 -- [-1279.415] (-1286.542) (-1281.238) (-1280.438) * [-1280.151] (-1280.418) (-1280.673) (-1281.496) -- 0:00:58
      93000 -- [-1279.386] (-1285.574) (-1280.894) (-1281.515) * (-1280.395) (-1280.517) [-1283.659] (-1281.277) -- 0:00:58
      93500 -- [-1281.524] (-1289.473) (-1280.900) (-1282.553) * (-1281.508) [-1282.211] (-1283.882) (-1280.253) -- 0:00:58
      94000 -- (-1283.109) [-1284.535] (-1283.337) (-1281.851) * (-1280.343) (-1281.883) [-1282.099] (-1282.129) -- 0:00:57
      94500 -- (-1283.317) [-1287.774] (-1280.418) (-1282.630) * (-1281.607) (-1279.364) (-1284.677) [-1282.151] -- 0:00:57
      95000 -- (-1280.829) (-1289.943) (-1280.197) [-1281.126] * [-1281.607] (-1280.578) (-1284.978) (-1282.134) -- 0:00:57

      Average standard deviation of split frequencies: 0.027008

      95500 -- (-1279.727) (-1293.619) (-1282.718) [-1281.107] * (-1281.293) [-1280.457] (-1284.280) (-1283.280) -- 0:00:56
      96000 -- (-1282.547) (-1286.432) [-1280.005] (-1280.782) * [-1281.075] (-1281.196) (-1281.166) (-1284.580) -- 0:00:56
      96500 -- (-1280.854) [-1293.896] (-1282.323) (-1287.219) * (-1283.295) (-1279.613) [-1279.665] (-1288.400) -- 0:00:56
      97000 -- (-1280.540) [-1284.438] (-1283.550) (-1287.060) * (-1282.128) [-1283.217] (-1280.461) (-1283.821) -- 0:00:55
      97500 -- [-1281.882] (-1289.883) (-1286.657) (-1283.816) * [-1282.303] (-1281.493) (-1280.725) (-1279.833) -- 0:00:55
      98000 -- (-1282.244) (-1293.442) [-1281.427] (-1281.761) * (-1282.650) (-1285.956) [-1279.779] (-1280.759) -- 0:00:55
      98500 -- [-1281.403] (-1292.495) (-1279.871) (-1283.401) * (-1280.317) (-1280.244) (-1280.151) [-1281.177] -- 0:00:54
      99000 -- [-1280.723] (-1287.280) (-1281.656) (-1283.033) * (-1282.066) [-1279.554] (-1280.569) (-1283.233) -- 0:00:54
      99500 -- (-1280.113) (-1290.071) (-1280.551) [-1283.264] * (-1283.244) [-1279.603] (-1283.459) (-1281.936) -- 0:00:54
      100000 -- (-1279.776) [-1288.516] (-1283.460) (-1282.051) * (-1281.649) (-1280.764) (-1279.933) [-1280.400] -- 0:00:54

      Average standard deviation of split frequencies: 0.026865

      100500 -- (-1280.070) (-1289.621) (-1283.544) [-1282.427] * (-1283.857) (-1282.131) (-1281.435) [-1281.413] -- 0:01:02
      101000 -- (-1282.955) (-1291.106) (-1280.468) [-1281.004] * (-1283.638) [-1284.224] (-1280.235) (-1279.778) -- 0:01:02
      101500 -- (-1284.404) (-1287.540) (-1282.787) [-1280.650] * (-1280.662) (-1283.696) (-1279.808) [-1281.718] -- 0:01:01
      102000 -- [-1279.620] (-1294.389) (-1279.517) (-1280.395) * (-1282.477) (-1282.075) (-1283.198) [-1283.828] -- 0:01:01
      102500 -- (-1282.312) (-1296.518) (-1279.573) [-1280.317] * (-1281.751) (-1281.615) [-1282.555] (-1279.752) -- 0:01:01
      103000 -- (-1281.432) (-1295.297) (-1279.539) [-1281.712] * (-1281.921) (-1280.078) (-1280.620) [-1279.742] -- 0:01:00
      103500 -- [-1281.178] (-1286.931) (-1279.984) (-1279.118) * (-1286.329) [-1280.110] (-1283.055) (-1279.938) -- 0:01:00
      104000 -- (-1279.423) [-1293.567] (-1283.561) (-1279.146) * (-1284.092) [-1280.088] (-1284.409) (-1284.635) -- 0:01:00
      104500 -- (-1279.435) (-1292.787) (-1279.129) [-1279.146] * (-1283.176) [-1280.460] (-1284.751) (-1279.980) -- 0:00:59
      105000 -- (-1280.479) (-1288.876) [-1281.517] (-1281.573) * (-1282.880) [-1283.505] (-1282.829) (-1280.604) -- 0:00:59

      Average standard deviation of split frequencies: 0.024460

      105500 -- (-1284.423) (-1290.584) [-1279.103] (-1281.977) * (-1283.900) [-1282.341] (-1281.387) (-1281.400) -- 0:00:59
      106000 -- (-1283.769) (-1290.554) (-1284.704) [-1280.600] * (-1284.661) (-1282.084) [-1280.128] (-1283.327) -- 0:00:59
      106500 -- (-1283.543) [-1283.395] (-1281.480) (-1279.451) * [-1285.253] (-1284.663) (-1279.903) (-1280.155) -- 0:00:58
      107000 -- [-1283.030] (-1293.404) (-1281.442) (-1279.212) * (-1282.726) [-1281.666] (-1280.181) (-1282.435) -- 0:00:58
      107500 -- (-1281.332) (-1290.687) (-1279.733) [-1279.811] * (-1280.093) [-1280.574] (-1279.650) (-1280.622) -- 0:00:58
      108000 -- (-1281.479) [-1285.605] (-1280.638) (-1279.357) * (-1280.046) (-1280.987) (-1279.648) [-1284.153] -- 0:00:57
      108500 -- (-1280.116) (-1294.791) (-1281.435) [-1279.161] * (-1280.382) (-1280.323) [-1279.487] (-1283.642) -- 0:00:57
      109000 -- [-1280.952] (-1293.637) (-1282.671) (-1279.762) * (-1281.536) (-1279.441) [-1280.558] (-1284.160) -- 0:00:57
      109500 -- (-1280.506) (-1288.853) (-1282.176) [-1279.702] * [-1280.419] (-1280.372) (-1280.541) (-1281.705) -- 0:00:56
      110000 -- (-1280.482) (-1289.489) [-1282.968] (-1279.618) * (-1279.788) [-1279.286] (-1281.465) (-1283.118) -- 0:00:56

      Average standard deviation of split frequencies: 0.024784

      110500 -- (-1280.668) (-1290.393) [-1280.612] (-1279.214) * [-1279.592] (-1281.790) (-1281.465) (-1281.760) -- 0:00:56
      111000 -- (-1280.381) (-1286.051) [-1280.290] (-1279.159) * (-1280.537) (-1284.185) [-1282.298] (-1281.608) -- 0:00:56
      111500 -- (-1280.527) (-1296.257) [-1280.837] (-1279.275) * [-1281.163] (-1283.453) (-1281.448) (-1283.815) -- 0:00:55
      112000 -- [-1280.544] (-1289.915) (-1280.247) (-1279.670) * [-1283.984] (-1280.992) (-1284.045) (-1283.175) -- 0:00:55
      112500 -- [-1280.731] (-1289.807) (-1280.876) (-1282.838) * (-1280.422) [-1283.883] (-1285.772) (-1281.687) -- 0:00:55
      113000 -- [-1282.897] (-1297.192) (-1280.737) (-1280.839) * [-1280.606] (-1284.626) (-1283.704) (-1279.683) -- 0:00:54
      113500 -- [-1281.215] (-1286.497) (-1280.708) (-1281.471) * [-1279.997] (-1282.679) (-1281.125) (-1279.729) -- 0:00:54
      114000 -- [-1282.621] (-1295.501) (-1283.826) (-1280.980) * (-1282.131) (-1281.209) [-1282.913] (-1281.812) -- 0:00:54
      114500 -- (-1280.722) (-1289.385) (-1284.566) [-1280.160] * [-1281.649] (-1281.804) (-1282.215) (-1281.861) -- 0:00:54
      115000 -- [-1280.750] (-1295.675) (-1282.519) (-1280.082) * (-1281.273) (-1282.369) (-1281.320) [-1280.851] -- 0:00:53

      Average standard deviation of split frequencies: 0.026009

      115500 -- (-1280.747) (-1287.573) [-1282.720] (-1279.972) * (-1281.659) [-1279.468] (-1280.784) (-1281.332) -- 0:00:53
      116000 -- (-1283.159) (-1286.109) (-1279.707) [-1279.752] * (-1287.889) (-1279.939) [-1279.947] (-1280.124) -- 0:00:53
      116500 -- (-1281.867) (-1288.977) (-1282.833) [-1279.502] * [-1279.986] (-1279.508) (-1280.981) (-1280.830) -- 0:01:00
      117000 -- [-1281.828] (-1292.031) (-1280.177) (-1280.022) * (-1281.509) [-1280.239] (-1282.041) (-1280.162) -- 0:01:00
      117500 -- (-1280.849) (-1287.647) (-1279.907) [-1281.426] * (-1280.632) (-1281.224) [-1280.475] (-1281.012) -- 0:01:00
      118000 -- (-1280.833) [-1290.502] (-1279.891) (-1281.356) * (-1281.988) [-1279.861] (-1279.696) (-1281.217) -- 0:00:59
      118500 -- (-1281.106) [-1290.593] (-1279.586) (-1280.096) * (-1282.373) (-1280.358) [-1281.555] (-1280.644) -- 0:00:59
      119000 -- (-1280.710) [-1290.313] (-1279.583) (-1281.773) * (-1284.416) [-1279.950] (-1281.248) (-1280.126) -- 0:00:59
      119500 -- [-1279.750] (-1293.436) (-1280.854) (-1285.585) * (-1281.580) [-1280.449] (-1280.531) (-1281.500) -- 0:00:58
      120000 -- (-1279.837) (-1296.098) [-1281.622] (-1286.214) * (-1281.082) (-1281.436) [-1282.048] (-1280.779) -- 0:00:58

      Average standard deviation of split frequencies: 0.024417

      120500 -- (-1280.295) [-1288.538] (-1282.150) (-1283.765) * [-1281.802] (-1281.335) (-1286.085) (-1280.862) -- 0:00:58
      121000 -- [-1279.397] (-1290.797) (-1279.600) (-1284.848) * (-1282.171) [-1285.806] (-1282.050) (-1284.481) -- 0:00:58
      121500 -- (-1281.075) (-1287.330) [-1279.854] (-1283.195) * (-1281.282) (-1282.916) (-1281.140) [-1281.700] -- 0:00:57
      122000 -- [-1282.737] (-1289.081) (-1280.717) (-1281.168) * [-1279.586] (-1281.859) (-1280.848) (-1283.099) -- 0:00:57
      122500 -- (-1284.470) [-1286.679] (-1279.540) (-1279.594) * [-1279.747] (-1280.850) (-1280.698) (-1281.849) -- 0:00:57
      123000 -- (-1281.677) [-1282.541] (-1282.485) (-1279.528) * (-1280.738) (-1282.592) [-1280.265] (-1281.776) -- 0:00:57
      123500 -- (-1282.487) (-1295.295) [-1279.742] (-1279.967) * (-1281.897) [-1279.597] (-1283.410) (-1280.279) -- 0:00:56
      124000 -- [-1280.224] (-1290.702) (-1280.131) (-1279.580) * [-1280.935] (-1281.903) (-1280.914) (-1281.196) -- 0:00:56
      124500 -- (-1282.406) [-1291.400] (-1285.235) (-1280.855) * (-1283.958) [-1280.914] (-1279.654) (-1280.392) -- 0:00:56
      125000 -- (-1279.437) [-1287.461] (-1279.753) (-1281.527) * (-1280.285) (-1280.313) [-1279.656] (-1285.774) -- 0:00:56

      Average standard deviation of split frequencies: 0.019954

      125500 -- (-1280.162) (-1290.208) [-1280.852] (-1280.493) * [-1279.943] (-1279.422) (-1282.006) (-1287.561) -- 0:00:55
      126000 -- (-1280.237) (-1290.657) (-1280.139) [-1281.579] * [-1279.693] (-1279.497) (-1282.905) (-1287.800) -- 0:00:55
      126500 -- (-1279.661) [-1292.284] (-1280.026) (-1280.460) * (-1280.822) (-1281.021) [-1282.176] (-1289.710) -- 0:00:55
      127000 -- (-1280.932) (-1300.265) (-1285.348) [-1280.002] * (-1283.134) (-1281.853) (-1287.304) [-1282.163] -- 0:00:54
      127500 -- (-1279.385) (-1293.944) (-1283.214) [-1281.096] * (-1282.608) (-1281.518) [-1283.456] (-1282.740) -- 0:00:54
      128000 -- (-1281.113) (-1288.455) [-1284.184] (-1284.010) * (-1280.272) (-1280.904) [-1279.213] (-1281.986) -- 0:00:54
      128500 -- (-1283.169) (-1290.007) [-1283.722] (-1283.405) * (-1281.743) (-1281.839) (-1281.186) [-1284.029] -- 0:00:54
      129000 -- (-1282.593) (-1290.566) [-1282.972] (-1284.119) * (-1279.271) (-1281.379) (-1281.114) [-1280.379] -- 0:00:54
      129500 -- [-1279.958] (-1289.109) (-1281.558) (-1283.158) * (-1280.599) (-1281.780) (-1280.948) [-1280.966] -- 0:00:53
      130000 -- [-1279.905] (-1291.642) (-1283.191) (-1282.458) * (-1279.444) [-1282.919] (-1282.659) (-1279.772) -- 0:00:53

      Average standard deviation of split frequencies: 0.017179

      130500 -- (-1279.344) [-1295.068] (-1280.862) (-1281.267) * (-1279.589) [-1280.838] (-1280.745) (-1280.243) -- 0:00:53
      131000 -- (-1279.495) (-1288.617) (-1280.464) [-1280.970] * [-1279.881] (-1283.562) (-1281.737) (-1281.007) -- 0:00:53
      131500 -- (-1279.462) (-1292.638) (-1282.155) [-1280.701] * (-1281.484) (-1280.653) (-1281.937) [-1281.516] -- 0:00:52
      132000 -- (-1283.260) (-1295.045) (-1279.894) [-1280.911] * (-1283.996) (-1282.132) [-1279.514] (-1281.496) -- 0:00:59
      132500 -- (-1281.298) (-1290.507) [-1280.976] (-1280.562) * (-1288.442) (-1280.808) (-1281.280) [-1283.859] -- 0:00:58
      133000 -- (-1281.913) (-1287.254) [-1280.317] (-1280.128) * (-1284.837) (-1282.050) (-1279.438) [-1283.359] -- 0:00:58
      133500 -- (-1283.654) [-1288.181] (-1281.202) (-1283.199) * [-1282.127] (-1281.588) (-1281.909) (-1281.045) -- 0:00:58
      134000 -- (-1280.597) [-1286.982] (-1281.926) (-1281.621) * [-1280.423] (-1279.678) (-1280.389) (-1281.243) -- 0:00:58
      134500 -- (-1282.007) (-1283.767) [-1281.451] (-1281.820) * [-1283.819] (-1279.781) (-1280.687) (-1281.125) -- 0:00:57
      135000 -- [-1282.033] (-1296.256) (-1280.544) (-1280.948) * (-1283.345) (-1279.452) (-1281.312) [-1283.943] -- 0:00:57

      Average standard deviation of split frequencies: 0.018426

      135500 -- (-1282.642) (-1288.740) [-1280.816] (-1283.218) * [-1283.151] (-1279.710) (-1283.076) (-1284.513) -- 0:00:57
      136000 -- (-1282.818) (-1288.448) (-1280.093) [-1281.161] * (-1283.415) (-1281.816) (-1284.194) [-1283.024] -- 0:00:57
      136500 -- (-1284.246) [-1287.406] (-1279.149) (-1282.034) * [-1282.566] (-1280.787) (-1280.683) (-1280.511) -- 0:00:56
      137000 -- [-1280.851] (-1291.991) (-1279.686) (-1286.142) * (-1281.760) (-1280.029) [-1280.274] (-1280.064) -- 0:00:56
      137500 -- (-1280.238) (-1286.537) [-1282.437] (-1287.104) * (-1282.237) [-1280.029] (-1279.597) (-1279.990) -- 0:00:56
      138000 -- [-1280.240] (-1290.917) (-1282.418) (-1284.917) * [-1281.046] (-1279.188) (-1284.332) (-1281.238) -- 0:00:56
      138500 -- (-1279.088) (-1288.771) [-1281.689] (-1281.733) * (-1280.907) (-1280.707) [-1278.994] (-1282.002) -- 0:00:55
      139000 -- [-1280.048] (-1286.333) (-1280.926) (-1281.140) * [-1280.961] (-1282.608) (-1283.955) (-1281.390) -- 0:00:55
      139500 -- (-1280.816) (-1289.929) [-1279.844] (-1283.541) * [-1281.192] (-1281.244) (-1282.963) (-1281.688) -- 0:00:55
      140000 -- [-1279.194] (-1293.791) (-1282.931) (-1281.443) * [-1283.835] (-1279.761) (-1283.062) (-1280.564) -- 0:00:55

      Average standard deviation of split frequencies: 0.018873

      140500 -- (-1279.411) [-1286.077] (-1282.679) (-1281.595) * [-1280.683] (-1281.279) (-1284.662) (-1280.565) -- 0:00:55
      141000 -- [-1279.499] (-1309.696) (-1280.290) (-1281.005) * (-1283.010) [-1279.459] (-1283.991) (-1281.087) -- 0:00:54
      141500 -- (-1279.538) [-1295.087] (-1280.069) (-1281.139) * (-1282.125) (-1280.045) (-1281.090) [-1280.478] -- 0:00:54
      142000 -- [-1283.271] (-1279.157) (-1279.412) (-1280.302) * (-1284.102) [-1282.349] (-1280.816) (-1281.085) -- 0:00:54
      142500 -- (-1285.459) [-1279.682] (-1282.245) (-1281.389) * (-1281.291) [-1280.804] (-1280.983) (-1281.016) -- 0:00:54
      143000 -- (-1282.967) (-1281.147) [-1280.286] (-1280.548) * [-1281.664] (-1281.071) (-1282.489) (-1282.668) -- 0:00:53
      143500 -- (-1284.845) (-1280.140) (-1279.754) [-1281.247] * (-1280.563) (-1281.131) (-1281.879) [-1282.814] -- 0:00:53
      144000 -- (-1283.349) (-1280.106) (-1284.588) [-1282.727] * (-1280.183) (-1283.660) (-1280.335) [-1282.342] -- 0:00:53
      144500 -- (-1282.312) (-1282.290) (-1280.762) [-1281.059] * [-1280.065] (-1283.652) (-1279.945) (-1292.832) -- 0:00:53
      145000 -- (-1283.862) [-1282.118] (-1281.448) (-1284.471) * [-1279.553] (-1281.466) (-1281.825) (-1286.211) -- 0:00:53

      Average standard deviation of split frequencies: 0.019834

      145500 -- (-1284.895) (-1280.042) (-1283.847) [-1279.431] * [-1279.733] (-1283.223) (-1281.089) (-1282.194) -- 0:00:52
      146000 -- (-1281.819) (-1280.530) (-1280.472) [-1281.180] * (-1280.944) (-1283.856) (-1280.406) [-1281.744] -- 0:00:52
      146500 -- [-1283.982] (-1286.111) (-1280.870) (-1281.397) * (-1279.559) (-1281.783) (-1280.174) [-1279.463] -- 0:00:52
      147000 -- (-1281.516) (-1285.953) [-1280.810] (-1279.926) * (-1282.642) (-1282.630) (-1281.059) [-1279.777] -- 0:00:52
      147500 -- (-1282.925) (-1281.547) (-1280.273) [-1279.283] * (-1283.252) (-1281.217) [-1280.164] (-1282.870) -- 0:00:52
      148000 -- (-1281.726) [-1280.249] (-1286.090) (-1280.320) * (-1282.363) (-1281.771) [-1281.260] (-1289.489) -- 0:00:57
      148500 -- (-1281.289) [-1280.173] (-1286.186) (-1279.230) * (-1280.073) (-1281.498) [-1280.430] (-1282.303) -- 0:00:57
      149000 -- [-1280.302] (-1280.779) (-1280.964) (-1281.601) * (-1281.953) (-1281.448) [-1280.430] (-1282.573) -- 0:00:57
      149500 -- (-1280.995) [-1279.343] (-1280.948) (-1282.359) * (-1282.919) (-1283.561) (-1280.171) [-1281.144] -- 0:00:56
      150000 -- [-1282.074] (-1279.337) (-1279.947) (-1283.382) * (-1284.441) (-1283.755) [-1281.458] (-1283.183) -- 0:00:56

      Average standard deviation of split frequencies: 0.018303

      150500 -- [-1281.492] (-1281.857) (-1280.506) (-1280.245) * (-1284.759) (-1283.248) (-1280.086) [-1281.582] -- 0:00:56
      151000 -- (-1280.197) (-1281.076) [-1280.164] (-1281.812) * [-1280.472] (-1283.088) (-1281.724) (-1281.028) -- 0:00:56
      151500 -- (-1287.269) [-1279.684] (-1279.712) (-1280.275) * (-1288.887) (-1282.314) (-1282.207) [-1280.731] -- 0:00:56
      152000 -- (-1283.390) (-1281.136) (-1282.895) [-1281.066] * [-1283.573] (-1280.279) (-1282.781) (-1283.117) -- 0:00:55
      152500 -- (-1282.642) (-1286.463) [-1284.657] (-1281.862) * (-1279.777) (-1279.831) (-1280.087) [-1283.068] -- 0:00:55
      153000 -- (-1282.342) (-1285.420) [-1285.362] (-1280.511) * (-1282.362) (-1288.521) (-1280.087) [-1282.812] -- 0:00:55
      153500 -- (-1281.632) (-1284.841) (-1281.453) [-1280.087] * [-1281.533] (-1289.473) (-1282.035) (-1285.922) -- 0:00:55
      154000 -- (-1280.356) (-1280.939) [-1281.992] (-1280.974) * (-1283.550) (-1283.305) (-1289.736) [-1280.613] -- 0:00:54
      154500 -- (-1281.217) (-1281.254) [-1279.552] (-1280.840) * (-1283.792) (-1283.180) [-1290.682] (-1280.123) -- 0:00:54
      155000 -- (-1280.863) (-1281.536) [-1280.809] (-1283.088) * (-1280.430) [-1280.087] (-1283.512) (-1280.241) -- 0:00:54

      Average standard deviation of split frequencies: 0.018994

      155500 -- (-1287.628) [-1283.034] (-1280.544) (-1281.999) * (-1280.860) (-1280.087) (-1285.869) [-1280.123] -- 0:00:54
      156000 -- (-1284.078) (-1279.768) (-1282.779) [-1281.108] * (-1282.311) [-1280.087] (-1281.472) (-1279.378) -- 0:00:54
      156500 -- [-1283.809] (-1279.624) (-1281.675) (-1281.494) * (-1283.036) [-1281.940] (-1279.529) (-1281.505) -- 0:00:53
      157000 -- [-1283.912] (-1280.276) (-1282.344) (-1281.119) * [-1282.513] (-1282.257) (-1280.117) (-1282.498) -- 0:00:53
      157500 -- (-1283.965) (-1280.939) (-1281.905) [-1281.553] * (-1281.844) [-1282.295] (-1281.190) (-1281.683) -- 0:00:53
      158000 -- (-1281.022) (-1281.087) [-1281.850] (-1282.918) * [-1281.760] (-1281.729) (-1281.216) (-1281.488) -- 0:00:53
      158500 -- [-1283.971] (-1280.537) (-1282.165) (-1284.283) * (-1282.907) (-1280.904) [-1280.201] (-1282.668) -- 0:00:53
      159000 -- (-1280.885) [-1281.114] (-1282.385) (-1283.557) * (-1282.920) [-1281.221] (-1282.266) (-1283.008) -- 0:00:52
      159500 -- (-1280.143) (-1282.758) (-1281.867) [-1283.719] * [-1282.491] (-1280.484) (-1279.733) (-1286.325) -- 0:00:52
      160000 -- [-1279.657] (-1282.523) (-1285.153) (-1282.574) * (-1281.177) (-1282.207) (-1280.523) [-1286.679] -- 0:00:52

      Average standard deviation of split frequencies: 0.018338

      160500 -- (-1279.737) [-1281.066] (-1284.889) (-1282.888) * (-1282.195) [-1281.559] (-1286.082) (-1284.538) -- 0:00:52
      161000 -- (-1282.604) [-1280.379] (-1284.391) (-1281.693) * [-1282.392] (-1280.611) (-1286.104) (-1287.654) -- 0:00:52
      161500 -- (-1281.914) [-1281.387] (-1285.806) (-1281.749) * (-1280.747) (-1282.881) [-1281.089] (-1290.976) -- 0:00:51
      162000 -- (-1281.128) [-1280.197] (-1284.835) (-1281.674) * [-1281.705] (-1281.342) (-1281.542) (-1284.941) -- 0:00:51
      162500 -- [-1280.699] (-1282.672) (-1283.954) (-1283.452) * (-1283.976) (-1281.067) (-1279.382) [-1280.434] -- 0:00:51
      163000 -- [-1279.850] (-1282.784) (-1282.070) (-1281.259) * (-1284.359) (-1281.819) (-1279.157) [-1282.381] -- 0:00:51
      163500 -- (-1281.005) (-1281.673) (-1279.996) [-1282.086] * (-1284.064) (-1284.925) (-1279.252) [-1284.037] -- 0:00:51
      164000 -- (-1280.680) (-1280.818) (-1279.302) [-1279.997] * (-1282.182) (-1282.226) (-1281.467) [-1281.775] -- 0:00:56
      164500 -- [-1282.895] (-1279.696) (-1278.941) (-1280.235) * (-1282.378) [-1282.131] (-1279.582) (-1282.164) -- 0:00:55
      165000 -- [-1282.113] (-1281.858) (-1279.841) (-1284.796) * (-1284.918) (-1280.377) (-1280.054) [-1281.187] -- 0:00:55

      Average standard deviation of split frequencies: 0.017309

      165500 -- (-1281.714) (-1282.074) (-1280.297) [-1281.954] * (-1282.319) (-1280.814) [-1281.525] (-1282.718) -- 0:00:55
      166000 -- (-1283.008) (-1279.859) (-1279.371) [-1280.645] * (-1283.238) (-1281.703) [-1282.247] (-1287.549) -- 0:00:55
      166500 -- (-1283.181) (-1280.477) [-1279.543] (-1281.239) * (-1284.048) (-1282.519) [-1283.145] (-1282.829) -- 0:00:55
      167000 -- (-1282.244) [-1279.285] (-1281.793) (-1284.179) * (-1284.274) [-1287.808] (-1283.381) (-1281.296) -- 0:00:54
      167500 -- [-1281.749] (-1279.260) (-1279.697) (-1284.664) * (-1287.744) (-1280.878) [-1283.797] (-1283.524) -- 0:00:54
      168000 -- (-1280.649) [-1279.507] (-1280.097) (-1283.054) * (-1280.295) [-1280.852] (-1285.140) (-1281.037) -- 0:00:54
      168500 -- (-1281.477) [-1279.326] (-1284.295) (-1284.444) * (-1280.884) (-1280.242) [-1279.014] (-1282.690) -- 0:00:54
      169000 -- (-1280.969) (-1279.777) (-1280.838) [-1281.300] * (-1280.631) [-1281.767] (-1279.395) (-1281.203) -- 0:00:54
      169500 -- [-1282.525] (-1286.557) (-1283.350) (-1283.062) * (-1280.746) (-1281.209) (-1279.441) [-1280.581] -- 0:00:53
      170000 -- (-1283.192) [-1279.277] (-1281.952) (-1280.339) * (-1280.873) (-1282.359) [-1280.126] (-1282.400) -- 0:00:53

      Average standard deviation of split frequencies: 0.017540

      170500 -- (-1282.907) [-1280.086] (-1282.088) (-1281.805) * (-1281.712) (-1280.862) (-1280.834) [-1284.893] -- 0:00:53
      171000 -- (-1283.256) [-1279.074] (-1280.176) (-1283.571) * (-1281.792) (-1279.681) [-1279.884] (-1283.965) -- 0:00:53
      171500 -- (-1281.021) (-1283.825) [-1281.384] (-1279.561) * [-1281.980] (-1279.700) (-1280.356) (-1282.076) -- 0:00:53
      172000 -- (-1280.344) (-1281.257) (-1280.702) [-1279.914] * [-1283.579] (-1283.635) (-1280.057) (-1281.820) -- 0:00:52
      172500 -- (-1281.499) [-1280.172] (-1283.462) (-1282.037) * (-1285.403) (-1283.604) [-1281.175] (-1279.985) -- 0:00:52
      173000 -- (-1280.693) (-1280.284) [-1282.047] (-1280.955) * (-1282.642) (-1282.526) [-1282.664] (-1281.473) -- 0:00:52
      173500 -- (-1284.050) [-1279.945] (-1282.300) (-1282.223) * (-1281.221) [-1280.244] (-1284.974) (-1281.551) -- 0:00:52
      174000 -- [-1281.906] (-1279.894) (-1285.668) (-1283.779) * (-1282.399) (-1281.284) [-1279.738] (-1280.353) -- 0:00:52
      174500 -- (-1282.159) (-1280.135) [-1285.222] (-1281.310) * (-1280.864) (-1280.649) (-1279.503) [-1280.708] -- 0:00:52
      175000 -- (-1284.347) (-1279.352) [-1282.243] (-1283.245) * (-1279.472) [-1282.208] (-1279.820) (-1280.788) -- 0:00:51

      Average standard deviation of split frequencies: 0.017812

      175500 -- (-1282.112) [-1280.292] (-1279.177) (-1283.695) * [-1280.901] (-1280.756) (-1279.839) (-1281.406) -- 0:00:51
      176000 -- [-1280.890] (-1282.516) (-1279.171) (-1282.980) * (-1280.851) (-1279.847) (-1279.833) [-1281.406] -- 0:00:51
      176500 -- (-1280.877) [-1281.435] (-1279.964) (-1282.065) * (-1282.323) (-1281.682) [-1282.186] (-1284.657) -- 0:00:51
      177000 -- (-1280.456) (-1282.196) (-1279.951) [-1282.440] * [-1281.345] (-1281.090) (-1281.707) (-1281.298) -- 0:00:51
      177500 -- (-1280.893) (-1279.524) [-1279.246] (-1283.394) * [-1289.810] (-1282.375) (-1285.409) (-1280.582) -- 0:00:50
      178000 -- (-1285.167) (-1280.086) (-1279.108) [-1280.644] * (-1280.778) [-1279.950] (-1281.857) (-1283.445) -- 0:00:50
      178500 -- (-1284.422) (-1280.798) (-1280.953) [-1288.868] * (-1280.043) (-1282.684) (-1280.607) [-1280.149] -- 0:00:50
      179000 -- [-1281.593] (-1279.679) (-1279.168) (-1286.652) * (-1281.509) (-1280.552) (-1282.621) [-1279.797] -- 0:00:50
      179500 -- (-1282.019) (-1283.191) (-1280.809) [-1283.872] * (-1282.462) (-1282.766) [-1283.219] (-1281.981) -- 0:00:54
      180000 -- (-1280.922) (-1279.804) [-1280.766] (-1281.759) * (-1281.958) [-1279.406] (-1282.292) (-1283.921) -- 0:00:54

      Average standard deviation of split frequencies: 0.018265

      180500 -- [-1280.621] (-1279.937) (-1280.715) (-1281.514) * (-1280.503) [-1279.418] (-1280.778) (-1281.208) -- 0:00:54
      181000 -- [-1281.553] (-1280.682) (-1280.960) (-1280.110) * (-1280.402) [-1279.312] (-1283.025) (-1280.664) -- 0:00:54
      181500 -- (-1282.758) [-1280.749] (-1280.768) (-1281.462) * [-1280.839] (-1279.505) (-1280.248) (-1281.191) -- 0:00:54
      182000 -- (-1286.295) (-1284.717) (-1281.356) [-1280.172] * (-1279.796) [-1280.700] (-1280.518) (-1281.263) -- 0:00:53
      182500 -- (-1284.010) [-1284.915] (-1281.434) (-1280.910) * [-1279.212] (-1282.997) (-1281.724) (-1280.240) -- 0:00:53
      183000 -- [-1279.911] (-1281.697) (-1281.602) (-1282.106) * (-1279.429) (-1282.958) (-1283.177) [-1282.799] -- 0:00:53
      183500 -- (-1284.288) (-1280.206) [-1284.110] (-1284.876) * (-1279.429) (-1284.659) (-1280.342) [-1282.210] -- 0:00:53
      184000 -- [-1280.530] (-1279.581) (-1281.307) (-1283.061) * [-1281.447] (-1282.514) (-1280.302) (-1284.507) -- 0:00:53
      184500 -- (-1282.873) (-1282.750) (-1280.003) [-1281.761] * (-1281.193) [-1282.392] (-1281.037) (-1281.076) -- 0:00:53
      185000 -- (-1281.178) [-1280.020] (-1281.820) (-1283.823) * [-1283.351] (-1284.272) (-1279.106) (-1280.399) -- 0:00:52

      Average standard deviation of split frequencies: 0.017361

      185500 -- (-1283.093) [-1282.677] (-1281.659) (-1286.190) * (-1280.980) (-1282.674) [-1280.835] (-1282.806) -- 0:00:52
      186000 -- (-1283.614) (-1283.348) (-1282.261) [-1285.525] * [-1283.725] (-1280.955) (-1280.332) (-1283.454) -- 0:00:52
      186500 -- [-1280.522] (-1282.239) (-1283.416) (-1282.234) * [-1281.425] (-1279.735) (-1280.628) (-1288.483) -- 0:00:52
      187000 -- (-1284.518) [-1281.368] (-1282.784) (-1282.132) * (-1280.048) (-1280.609) [-1281.818] (-1281.719) -- 0:00:52
      187500 -- (-1281.308) (-1281.286) (-1282.063) [-1281.902] * (-1280.899) (-1280.886) (-1281.657) [-1281.114] -- 0:00:52
      188000 -- [-1281.647] (-1282.552) (-1279.852) (-1283.094) * [-1279.961] (-1281.406) (-1283.865) (-1282.121) -- 0:00:51
      188500 -- (-1282.032) [-1280.964] (-1279.650) (-1282.200) * [-1279.298] (-1281.816) (-1281.201) (-1282.190) -- 0:00:51
      189000 -- (-1283.302) (-1282.991) (-1280.626) [-1283.939] * (-1283.792) (-1283.311) (-1281.868) [-1280.707] -- 0:00:51
      189500 -- [-1285.189] (-1284.409) (-1282.689) (-1283.243) * (-1283.094) (-1279.666) (-1282.810) [-1282.331] -- 0:00:51
      190000 -- [-1280.367] (-1283.529) (-1282.439) (-1280.035) * (-1280.307) (-1279.813) (-1281.122) [-1279.592] -- 0:00:51

      Average standard deviation of split frequencies: 0.016936

      190500 -- (-1283.772) (-1285.379) [-1281.363] (-1279.804) * (-1279.843) [-1281.173] (-1281.618) (-1280.587) -- 0:00:50
      191000 -- (-1283.227) (-1289.460) (-1281.025) [-1280.102] * (-1281.874) (-1281.119) (-1283.187) [-1281.471] -- 0:00:50
      191500 -- [-1284.451] (-1282.387) (-1280.952) (-1281.119) * [-1280.701] (-1279.788) (-1282.763) (-1283.000) -- 0:00:50
      192000 -- (-1281.705) (-1282.563) (-1280.773) [-1281.561] * (-1280.251) [-1281.499] (-1283.507) (-1281.775) -- 0:00:50
      192500 -- [-1281.244] (-1282.490) (-1281.680) (-1285.950) * [-1281.455] (-1283.778) (-1281.352) (-1280.693) -- 0:00:50
      193000 -- [-1281.096] (-1279.443) (-1282.834) (-1282.593) * (-1280.274) [-1283.928] (-1280.422) (-1281.367) -- 0:00:50
      193500 -- [-1278.973] (-1280.092) (-1282.713) (-1282.657) * [-1280.549] (-1282.666) (-1279.400) (-1279.698) -- 0:00:50
      194000 -- [-1279.213] (-1281.698) (-1280.980) (-1280.266) * (-1281.175) [-1281.907] (-1285.079) (-1283.405) -- 0:00:49
      194500 -- (-1279.741) [-1281.386] (-1281.318) (-1280.266) * (-1280.141) (-1281.461) (-1285.079) [-1283.148] -- 0:00:49
      195000 -- (-1281.219) (-1281.205) (-1281.233) [-1280.455] * (-1281.862) (-1280.094) (-1283.049) [-1279.695] -- 0:00:49

      Average standard deviation of split frequencies: 0.016168

      195500 -- (-1282.366) [-1280.731] (-1282.519) (-1279.848) * (-1281.333) (-1281.307) (-1287.024) [-1279.651] -- 0:00:53
      196000 -- (-1283.646) [-1281.505] (-1279.307) (-1280.561) * (-1280.430) (-1279.857) (-1287.352) [-1280.222] -- 0:00:53
      196500 -- (-1284.008) [-1280.605] (-1281.579) (-1280.374) * (-1280.699) (-1281.404) (-1281.203) [-1280.316] -- 0:00:53
      197000 -- (-1284.322) [-1280.130] (-1280.212) (-1279.968) * (-1281.392) (-1283.651) (-1280.445) [-1280.244] -- 0:00:52
      197500 -- (-1281.197) [-1279.728] (-1281.022) (-1280.339) * [-1279.421] (-1281.309) (-1280.938) (-1282.496) -- 0:00:52
      198000 -- [-1280.732] (-1282.704) (-1280.564) (-1280.117) * (-1279.925) [-1280.724] (-1280.828) (-1280.583) -- 0:00:52
      198500 -- [-1283.185] (-1281.698) (-1282.805) (-1280.570) * (-1281.439) [-1280.723] (-1281.229) (-1283.255) -- 0:00:52
      199000 -- (-1282.287) (-1281.268) [-1282.754] (-1280.128) * (-1280.748) [-1287.731] (-1285.875) (-1279.858) -- 0:00:52
      199500 -- (-1280.809) (-1283.994) [-1281.430] (-1281.850) * [-1281.196] (-1282.729) (-1285.521) (-1283.721) -- 0:00:52
      200000 -- (-1279.429) (-1281.468) [-1281.776] (-1282.137) * (-1281.849) [-1281.493] (-1281.277) (-1281.712) -- 0:00:51

      Average standard deviation of split frequencies: 0.015975

      200500 -- (-1279.266) [-1281.468] (-1283.239) (-1280.473) * [-1282.269] (-1283.418) (-1281.917) (-1287.570) -- 0:00:51
      201000 -- (-1282.845) (-1284.884) [-1280.100] (-1281.118) * (-1287.912) (-1281.611) [-1282.834] (-1281.977) -- 0:00:51
      201500 -- (-1283.382) (-1284.770) [-1285.131] (-1281.084) * (-1287.443) (-1287.361) (-1280.962) [-1286.860] -- 0:00:51
      202000 -- [-1283.007] (-1282.958) (-1281.248) (-1281.364) * (-1285.125) (-1284.101) (-1280.446) [-1281.044] -- 0:00:51
      202500 -- (-1280.653) [-1280.902] (-1283.630) (-1283.961) * (-1284.646) [-1282.514] (-1280.487) (-1281.484) -- 0:00:51
      203000 -- (-1281.326) (-1282.343) (-1283.258) [-1280.000] * (-1283.610) (-1279.259) (-1280.280) [-1281.746] -- 0:00:51
      203500 -- [-1281.229] (-1280.468) (-1284.268) (-1280.336) * (-1281.109) (-1281.561) (-1280.367) [-1282.589] -- 0:00:50
      204000 -- (-1280.102) [-1280.243] (-1279.821) (-1280.214) * (-1280.193) (-1283.443) [-1279.888] (-1282.452) -- 0:00:50
      204500 -- (-1280.015) (-1280.945) [-1281.849] (-1282.388) * (-1280.406) [-1283.609] (-1280.280) (-1283.080) -- 0:00:50
      205000 -- (-1279.664) [-1280.223] (-1284.984) (-1280.139) * [-1282.337] (-1284.144) (-1280.068) (-1281.735) -- 0:00:50

      Average standard deviation of split frequencies: 0.016133

      205500 -- (-1287.251) (-1279.729) [-1281.093] (-1279.675) * (-1282.720) (-1282.539) (-1282.154) [-1281.383] -- 0:00:50
      206000 -- (-1284.549) [-1280.173] (-1282.119) (-1281.085) * (-1280.480) (-1283.750) [-1280.873] (-1280.968) -- 0:00:50
      206500 -- (-1279.450) (-1280.372) (-1282.086) [-1280.734] * (-1280.955) (-1279.921) (-1281.951) [-1280.674] -- 0:00:49
      207000 -- (-1283.584) (-1280.006) [-1281.357] (-1281.021) * (-1280.204) (-1280.335) (-1280.070) [-1282.260] -- 0:00:49
      207500 -- (-1284.374) (-1281.214) [-1280.412] (-1282.637) * [-1281.161] (-1282.937) (-1280.033) (-1279.812) -- 0:00:49
      208000 -- (-1282.399) [-1279.794] (-1280.909) (-1282.074) * [-1281.651] (-1282.659) (-1281.719) (-1279.726) -- 0:00:49
      208500 -- (-1282.326) [-1279.508] (-1280.169) (-1283.714) * (-1282.174) [-1281.014] (-1286.336) (-1282.546) -- 0:00:49
      209000 -- (-1279.238) (-1279.451) [-1281.631] (-1285.258) * (-1283.360) (-1279.288) [-1280.712] (-1285.441) -- 0:00:49
      209500 -- (-1283.413) (-1279.881) [-1281.629] (-1280.600) * (-1281.431) (-1279.571) (-1280.729) [-1281.354] -- 0:00:49
      210000 -- (-1280.207) (-1281.454) (-1285.900) [-1281.029] * (-1280.794) [-1279.664] (-1281.106) (-1281.893) -- 0:00:48

      Average standard deviation of split frequencies: 0.016447

      210500 -- (-1280.732) (-1281.809) (-1281.317) [-1280.437] * (-1281.563) [-1279.621] (-1279.292) (-1280.148) -- 0:00:48
      211000 -- (-1281.291) (-1281.590) [-1279.654] (-1279.931) * (-1281.084) (-1279.421) [-1280.638] (-1279.728) -- 0:00:48
      211500 -- (-1281.189) [-1281.390] (-1283.034) (-1279.686) * (-1280.937) (-1280.539) [-1281.011] (-1283.036) -- 0:00:52
      212000 -- [-1283.735] (-1281.529) (-1281.493) (-1280.381) * [-1281.247] (-1287.126) (-1280.650) (-1279.094) -- 0:00:52
      212500 -- (-1283.046) [-1281.822] (-1280.720) (-1281.621) * (-1283.641) (-1281.815) [-1280.595] (-1280.203) -- 0:00:51
      213000 -- (-1280.076) (-1280.033) (-1280.062) [-1280.328] * (-1281.496) (-1282.520) [-1280.877] (-1281.321) -- 0:00:51
      213500 -- [-1279.373] (-1279.888) (-1279.204) (-1280.284) * (-1283.823) [-1280.939] (-1281.144) (-1281.231) -- 0:00:51
      214000 -- (-1279.484) [-1280.190] (-1279.468) (-1283.580) * (-1284.927) (-1279.209) (-1279.958) [-1282.093] -- 0:00:51
      214500 -- (-1279.666) (-1280.799) [-1281.168] (-1283.931) * (-1287.149) (-1281.961) [-1279.316] (-1284.206) -- 0:00:51
      215000 -- (-1283.072) (-1279.449) [-1281.618] (-1281.060) * (-1284.910) (-1283.334) [-1280.795] (-1282.799) -- 0:00:51

      Average standard deviation of split frequencies: 0.015713

      215500 -- (-1279.274) (-1282.598) (-1279.243) [-1283.000] * (-1280.817) [-1281.565] (-1280.260) (-1279.807) -- 0:00:50
      216000 -- (-1280.417) (-1280.946) [-1279.384] (-1282.644) * (-1281.536) (-1284.619) (-1282.434) [-1279.763] -- 0:00:50
      216500 -- (-1285.801) (-1280.592) (-1279.622) [-1281.974] * (-1280.349) (-1280.589) [-1282.018] (-1279.693) -- 0:00:50
      217000 -- [-1283.460] (-1287.628) (-1281.388) (-1281.902) * [-1282.859] (-1283.785) (-1284.723) (-1279.704) -- 0:00:50
      217500 -- (-1284.449) (-1281.291) [-1279.119] (-1283.157) * (-1281.112) (-1286.247) (-1281.997) [-1282.532] -- 0:00:50
      218000 -- [-1284.549] (-1281.839) (-1286.685) (-1283.552) * [-1281.642] (-1280.205) (-1280.269) (-1283.456) -- 0:00:50
      218500 -- (-1282.978) (-1286.808) (-1281.742) [-1279.936] * (-1287.293) [-1280.515] (-1281.121) (-1281.050) -- 0:00:50
      219000 -- [-1280.976] (-1292.764) (-1283.692) (-1282.135) * (-1281.952) (-1282.641) (-1282.952) [-1280.045] -- 0:00:49
      219500 -- (-1281.231) (-1285.226) (-1283.162) [-1282.091] * (-1282.133) (-1283.578) [-1280.077] (-1281.182) -- 0:00:49
      220000 -- (-1280.456) (-1282.166) (-1283.367) [-1281.039] * (-1281.525) (-1281.054) [-1281.936] (-1280.947) -- 0:00:49

      Average standard deviation of split frequencies: 0.015629

      220500 -- (-1284.975) [-1280.996] (-1284.992) (-1281.528) * (-1282.263) (-1280.527) (-1281.177) [-1280.875] -- 0:00:49
      221000 -- (-1282.628) [-1281.566] (-1283.053) (-1281.505) * (-1281.982) [-1282.860] (-1281.950) (-1280.946) -- 0:00:49
      221500 -- (-1284.798) (-1280.528) [-1280.540] (-1281.453) * (-1280.123) (-1280.543) [-1281.740] (-1282.514) -- 0:00:49
      222000 -- (-1281.169) (-1282.654) [-1281.206] (-1281.911) * [-1280.806] (-1280.413) (-1279.454) (-1280.122) -- 0:00:49
      222500 -- [-1281.413] (-1283.277) (-1280.087) (-1281.645) * (-1281.176) (-1281.692) (-1282.035) [-1280.088] -- 0:00:48
      223000 -- (-1281.518) (-1280.047) [-1280.852] (-1280.277) * (-1287.668) (-1281.514) [-1282.233] (-1280.299) -- 0:00:48
      223500 -- (-1281.367) [-1280.176] (-1280.719) (-1280.263) * (-1282.885) [-1281.566] (-1281.149) (-1280.243) -- 0:00:48
      224000 -- (-1280.681) [-1280.936] (-1281.481) (-1281.127) * (-1279.960) (-1279.827) [-1281.290] (-1280.261) -- 0:00:48
      224500 -- [-1282.530] (-1279.855) (-1280.400) (-1281.708) * (-1281.536) [-1281.776] (-1282.589) (-1280.667) -- 0:00:48
      225000 -- (-1283.820) (-1282.715) (-1280.411) [-1283.269] * (-1284.718) (-1287.398) [-1280.402] (-1281.355) -- 0:00:48

      Average standard deviation of split frequencies: 0.015331

      225500 -- (-1282.947) (-1280.324) (-1281.547) [-1281.291] * [-1280.973] (-1282.777) (-1280.046) (-1281.462) -- 0:00:48
      226000 -- [-1284.516] (-1284.582) (-1283.820) (-1281.466) * (-1279.617) (-1284.534) [-1280.838] (-1284.363) -- 0:00:47
      226500 -- (-1282.356) (-1282.218) [-1281.426] (-1280.282) * (-1280.785) (-1281.661) (-1280.318) [-1279.428] -- 0:00:47
      227000 -- (-1280.325) (-1281.693) [-1286.736] (-1279.778) * (-1280.971) [-1283.386] (-1279.688) (-1280.730) -- 0:00:47
      227500 -- (-1282.181) (-1281.007) [-1282.230] (-1282.648) * (-1281.403) (-1283.121) [-1280.243] (-1279.237) -- 0:00:50
      228000 -- (-1281.833) [-1283.664] (-1282.797) (-1284.451) * (-1281.822) [-1281.147] (-1280.243) (-1280.630) -- 0:00:50
      228500 -- (-1282.115) [-1283.141] (-1281.421) (-1283.178) * (-1282.888) (-1282.967) (-1280.825) [-1281.563] -- 0:00:50
      229000 -- [-1281.250] (-1280.168) (-1282.333) (-1281.349) * (-1282.707) (-1280.983) (-1282.397) [-1283.196] -- 0:00:50
      229500 -- (-1282.857) [-1280.684] (-1280.741) (-1280.934) * (-1281.989) [-1281.563] (-1280.637) (-1283.025) -- 0:00:50
      230000 -- (-1284.240) (-1281.249) (-1282.169) [-1280.990] * [-1280.000] (-1282.225) (-1280.077) (-1281.111) -- 0:00:50

      Average standard deviation of split frequencies: 0.016564

      230500 -- (-1283.234) (-1279.845) [-1282.395] (-1281.913) * (-1284.149) (-1280.548) [-1279.377] (-1283.555) -- 0:00:50
      231000 -- [-1282.933] (-1280.783) (-1280.977) (-1284.730) * (-1283.272) (-1280.358) [-1279.397] (-1285.916) -- 0:00:49
      231500 -- (-1285.915) (-1280.036) (-1281.521) [-1281.518] * (-1280.714) (-1281.225) (-1280.399) [-1285.507] -- 0:00:49
      232000 -- (-1284.575) (-1281.453) (-1281.637) [-1282.854] * (-1279.676) (-1283.354) [-1282.114] (-1286.907) -- 0:00:49
      232500 -- (-1284.496) (-1281.655) [-1281.744] (-1281.992) * (-1280.528) [-1279.976] (-1284.639) (-1283.356) -- 0:00:49
      233000 -- (-1282.897) (-1283.785) (-1280.399) [-1283.250] * (-1280.547) [-1280.716] (-1279.929) (-1281.432) -- 0:00:49
      233500 -- (-1282.761) [-1284.157] (-1280.469) (-1282.358) * (-1281.996) (-1280.066) (-1279.638) [-1283.843] -- 0:00:49
      234000 -- (-1280.684) (-1280.152) [-1280.336] (-1285.024) * (-1280.217) (-1280.951) (-1280.732) [-1283.136] -- 0:00:49
      234500 -- [-1280.265] (-1281.325) (-1279.754) (-1285.461) * (-1281.779) [-1282.515] (-1283.310) (-1282.802) -- 0:00:48
      235000 -- (-1279.540) [-1282.211] (-1280.721) (-1284.082) * [-1282.408] (-1279.866) (-1280.094) (-1283.014) -- 0:00:48

      Average standard deviation of split frequencies: 0.017533

      235500 -- (-1281.710) [-1280.723] (-1279.716) (-1279.713) * (-1282.078) (-1280.211) (-1281.346) [-1282.034] -- 0:00:48
      236000 -- (-1279.894) (-1283.225) [-1279.927] (-1280.166) * (-1282.200) (-1280.761) [-1284.554] (-1280.995) -- 0:00:48
      236500 -- (-1280.244) (-1283.059) [-1279.713] (-1279.993) * [-1279.694] (-1283.277) (-1280.024) (-1280.930) -- 0:00:48
      237000 -- (-1283.294) (-1281.999) [-1280.746] (-1279.993) * (-1282.552) (-1282.502) [-1284.167] (-1280.571) -- 0:00:48
      237500 -- (-1282.029) (-1283.336) [-1280.236] (-1282.541) * (-1280.829) [-1281.751] (-1284.580) (-1281.344) -- 0:00:48
      238000 -- (-1280.994) [-1281.408] (-1281.563) (-1280.966) * (-1279.886) (-1282.978) (-1280.702) [-1283.512] -- 0:00:48
      238500 -- [-1280.051] (-1280.031) (-1287.486) (-1279.412) * [-1279.782] (-1283.313) (-1281.733) (-1283.853) -- 0:00:47
      239000 -- (-1288.618) (-1280.620) (-1283.101) [-1281.207] * [-1280.212] (-1286.134) (-1282.334) (-1284.498) -- 0:00:47
      239500 -- (-1280.449) (-1280.418) (-1282.081) [-1281.163] * (-1280.913) [-1281.552] (-1282.035) (-1280.718) -- 0:00:47
      240000 -- (-1280.398) (-1281.210) [-1284.307] (-1284.640) * (-1283.379) (-1282.355) [-1279.814] (-1281.198) -- 0:00:47

      Average standard deviation of split frequencies: 0.019152

      240500 -- (-1281.430) (-1283.969) [-1285.126] (-1279.540) * (-1280.764) (-1280.800) (-1280.390) [-1280.375] -- 0:00:47
      241000 -- (-1286.842) (-1282.979) [-1282.704] (-1284.130) * [-1280.538] (-1280.400) (-1281.479) (-1279.742) -- 0:00:47
      241500 -- (-1282.388) (-1286.268) [-1283.158] (-1279.998) * (-1281.202) (-1280.885) [-1281.204] (-1279.952) -- 0:00:47
      242000 -- (-1279.625) [-1282.755] (-1281.570) (-1282.259) * [-1279.906] (-1280.106) (-1282.297) (-1281.094) -- 0:00:46
      242500 -- [-1279.626] (-1285.836) (-1281.041) (-1282.158) * (-1281.003) [-1280.398] (-1282.032) (-1279.511) -- 0:00:46
      243000 -- (-1282.460) (-1284.460) (-1280.807) [-1279.363] * (-1280.847) (-1284.756) [-1281.000] (-1280.397) -- 0:00:46
      243500 -- (-1282.407) (-1283.199) [-1280.140] (-1281.222) * (-1283.366) [-1280.616] (-1282.248) (-1282.259) -- 0:00:49
      244000 -- (-1284.852) (-1280.760) (-1284.003) [-1280.611] * (-1282.266) [-1283.524] (-1282.803) (-1281.845) -- 0:00:49
      244500 -- (-1282.080) (-1282.817) (-1282.732) [-1280.298] * (-1282.728) [-1279.863] (-1282.153) (-1282.323) -- 0:00:49
      245000 -- (-1283.459) (-1284.396) [-1280.011] (-1281.835) * (-1281.086) (-1284.568) (-1282.220) [-1280.579] -- 0:00:49

      Average standard deviation of split frequencies: 0.017459

      245500 -- [-1284.699] (-1283.801) (-1280.026) (-1282.630) * (-1280.700) (-1280.287) [-1282.830] (-1280.450) -- 0:00:49
      246000 -- (-1282.718) [-1280.026] (-1280.017) (-1281.062) * (-1279.811) [-1280.824] (-1282.631) (-1279.791) -- 0:00:49
      246500 -- (-1281.436) (-1283.316) (-1286.680) [-1281.495] * (-1280.567) (-1281.162) (-1281.208) [-1280.032] -- 0:00:48
      247000 -- (-1281.459) (-1283.640) (-1282.140) [-1281.456] * (-1287.073) (-1280.718) [-1281.212] (-1280.165) -- 0:00:48
      247500 -- (-1283.134) (-1286.483) [-1282.920] (-1284.075) * (-1280.945) (-1281.335) (-1281.514) [-1280.237] -- 0:00:48
      248000 -- (-1280.136) (-1281.195) (-1281.412) [-1279.843] * (-1280.616) [-1282.729] (-1280.300) (-1280.313) -- 0:00:48
      248500 -- (-1280.784) (-1281.192) (-1280.885) [-1279.791] * (-1283.282) (-1279.809) [-1279.221] (-1281.528) -- 0:00:48
      249000 -- (-1279.864) [-1281.119] (-1284.236) (-1281.859) * (-1283.761) (-1284.041) [-1279.487] (-1281.525) -- 0:00:48
      249500 -- (-1280.206) (-1283.156) [-1281.455] (-1279.460) * (-1283.067) (-1283.358) (-1279.807) [-1283.984] -- 0:00:48
      250000 -- (-1284.366) (-1282.740) [-1281.608] (-1284.366) * (-1282.248) (-1283.590) [-1280.079] (-1281.869) -- 0:00:48

      Average standard deviation of split frequencies: 0.017343

      250500 -- [-1280.328] (-1286.031) (-1281.768) (-1283.521) * (-1279.416) (-1281.449) [-1280.159] (-1281.938) -- 0:00:47
      251000 -- (-1284.205) (-1279.403) (-1279.642) [-1284.657] * (-1280.092) [-1279.735] (-1279.485) (-1283.403) -- 0:00:47
      251500 -- (-1282.587) [-1280.328] (-1280.731) (-1279.522) * (-1280.722) (-1282.242) [-1281.294] (-1282.056) -- 0:00:47
      252000 -- (-1282.171) (-1281.418) (-1281.504) [-1281.453] * [-1281.155] (-1283.181) (-1283.281) (-1282.532) -- 0:00:47
      252500 -- [-1281.936] (-1282.236) (-1280.516) (-1282.640) * (-1283.673) [-1283.402] (-1280.049) (-1283.657) -- 0:00:47
      253000 -- (-1279.935) [-1283.135] (-1280.522) (-1284.104) * (-1284.991) (-1283.317) (-1281.525) [-1281.852] -- 0:00:47
      253500 -- (-1279.763) (-1280.354) [-1281.693] (-1284.411) * (-1282.170) (-1281.030) [-1280.966] (-1282.164) -- 0:00:47
      254000 -- (-1280.860) [-1280.987] (-1280.617) (-1283.259) * (-1280.716) (-1281.868) (-1280.546) [-1282.602] -- 0:00:46
      254500 -- (-1280.626) (-1280.292) [-1281.305] (-1281.393) * (-1283.173) (-1281.799) [-1281.453] (-1282.864) -- 0:00:46
      255000 -- (-1279.816) (-1282.011) [-1280.745] (-1280.009) * (-1282.890) (-1281.746) [-1282.683] (-1280.921) -- 0:00:46

      Average standard deviation of split frequencies: 0.015959

      255500 -- [-1281.194] (-1281.311) (-1281.496) (-1281.437) * (-1282.461) (-1280.313) [-1281.098] (-1280.026) -- 0:00:46
      256000 -- (-1283.315) (-1283.973) (-1282.007) [-1280.133] * (-1282.284) (-1283.721) (-1280.538) [-1280.155] -- 0:00:46
      256500 -- [-1283.464] (-1283.135) (-1285.463) (-1280.135) * [-1281.999] (-1283.461) (-1279.491) (-1279.643) -- 0:00:46
      257000 -- (-1282.400) (-1282.936) (-1283.529) [-1279.103] * (-1282.329) (-1284.448) [-1279.772] (-1282.442) -- 0:00:46
      257500 -- (-1280.306) (-1287.134) [-1281.679] (-1279.497) * (-1280.396) (-1284.908) [-1279.170] (-1281.742) -- 0:00:46
      258000 -- (-1281.370) (-1283.980) (-1280.197) [-1280.914] * (-1281.797) (-1280.008) [-1279.426] (-1281.033) -- 0:00:46
      258500 -- (-1281.023) (-1280.534) (-1282.764) [-1280.260] * (-1279.606) [-1279.823] (-1281.457) (-1280.088) -- 0:00:45
      259000 -- (-1281.231) (-1281.218) (-1283.298) [-1281.230] * (-1280.138) [-1279.758] (-1280.905) (-1280.044) -- 0:00:45
      259500 -- (-1280.705) (-1280.200) [-1282.265] (-1282.202) * (-1282.639) (-1280.936) [-1280.419] (-1280.220) -- 0:00:48
      260000 -- [-1279.500] (-1281.005) (-1280.762) (-1281.320) * [-1283.537] (-1280.183) (-1280.423) (-1281.527) -- 0:00:48

      Average standard deviation of split frequencies: 0.015271

      260500 -- (-1280.479) (-1280.960) [-1280.573] (-1280.757) * (-1283.507) [-1282.233] (-1281.026) (-1285.908) -- 0:00:48
      261000 -- (-1282.445) (-1280.195) [-1281.512] (-1283.601) * (-1282.406) (-1282.619) (-1281.052) [-1280.357] -- 0:00:48
      261500 -- (-1281.347) (-1281.041) (-1281.195) [-1282.001] * (-1285.430) (-1280.819) [-1281.191] (-1280.700) -- 0:00:48
      262000 -- (-1281.602) (-1283.060) (-1281.034) [-1282.551] * (-1281.586) [-1279.443] (-1289.281) (-1280.413) -- 0:00:47
      262500 -- (-1279.382) (-1282.619) (-1281.171) [-1280.527] * (-1284.538) [-1281.350] (-1289.205) (-1283.003) -- 0:00:47
      263000 -- [-1279.899] (-1282.431) (-1282.307) (-1280.751) * [-1281.430] (-1283.503) (-1283.360) (-1283.355) -- 0:00:47
      263500 -- (-1280.734) [-1284.178] (-1280.844) (-1282.051) * (-1286.335) (-1282.150) (-1280.844) [-1282.556] -- 0:00:47
      264000 -- (-1280.918) (-1279.643) [-1279.810] (-1287.091) * (-1280.340) [-1280.687] (-1280.293) (-1283.224) -- 0:00:47
      264500 -- (-1282.755) [-1279.593] (-1280.178) (-1284.850) * (-1279.744) [-1281.233] (-1279.720) (-1280.327) -- 0:00:47
      265000 -- (-1282.242) (-1280.578) [-1279.775] (-1284.772) * [-1280.162] (-1281.302) (-1280.932) (-1280.274) -- 0:00:47

      Average standard deviation of split frequencies: 0.015064

      265500 -- (-1281.777) (-1286.565) (-1279.609) [-1281.157] * (-1281.395) [-1281.179] (-1281.514) (-1279.965) -- 0:00:47
      266000 -- (-1284.627) (-1280.151) (-1279.658) [-1281.282] * (-1281.639) (-1284.501) [-1280.476] (-1280.136) -- 0:00:46
      266500 -- (-1281.062) [-1280.234] (-1281.066) (-1280.894) * [-1285.592] (-1281.827) (-1279.831) (-1282.523) -- 0:00:46
      267000 -- [-1281.488] (-1279.987) (-1282.982) (-1280.864) * [-1280.569] (-1283.196) (-1279.759) (-1279.639) -- 0:00:46
      267500 -- (-1282.855) [-1280.483] (-1281.879) (-1280.478) * (-1284.018) [-1280.957] (-1280.884) (-1282.115) -- 0:00:46
      268000 -- (-1280.863) (-1286.867) [-1279.889] (-1282.682) * (-1280.244) (-1280.757) (-1281.006) [-1282.161] -- 0:00:46
      268500 -- (-1280.118) (-1281.436) [-1280.114] (-1279.394) * (-1281.609) [-1280.928] (-1280.390) (-1280.643) -- 0:00:46
      269000 -- (-1279.914) (-1283.001) (-1283.336) [-1280.412] * (-1280.053) (-1280.170) (-1280.762) [-1280.954] -- 0:00:46
      269500 -- (-1279.977) (-1280.291) (-1282.600) [-1281.372] * [-1279.850] (-1282.045) (-1282.137) (-1282.515) -- 0:00:46
      270000 -- (-1281.770) (-1280.635) (-1281.120) [-1279.424] * (-1280.625) (-1283.773) (-1290.803) [-1285.596] -- 0:00:45

      Average standard deviation of split frequencies: 0.014707

      270500 -- (-1280.419) (-1280.055) (-1281.505) [-1279.618] * (-1280.114) (-1281.065) [-1279.937] (-1281.262) -- 0:00:45
      271000 -- (-1279.942) (-1281.766) (-1281.464) [-1279.638] * (-1280.081) (-1283.442) [-1279.091] (-1281.979) -- 0:00:45
      271500 -- (-1279.052) [-1280.264] (-1279.515) (-1280.696) * (-1283.465) [-1284.467] (-1280.217) (-1280.124) -- 0:00:45
      272000 -- (-1279.433) (-1280.173) (-1279.339) [-1279.590] * (-1281.255) [-1281.642] (-1280.615) (-1279.170) -- 0:00:45
      272500 -- (-1284.725) (-1280.074) [-1279.686] (-1285.433) * (-1281.996) (-1282.135) (-1280.837) [-1279.966] -- 0:00:45
      273000 -- (-1279.808) [-1280.730] (-1279.848) (-1281.645) * (-1281.996) [-1279.958] (-1285.242) (-1279.990) -- 0:00:45
      273500 -- [-1279.593] (-1280.574) (-1279.760) (-1279.919) * [-1279.682] (-1280.509) (-1280.689) (-1280.831) -- 0:00:45
      274000 -- (-1282.204) (-1280.720) (-1281.157) [-1280.205] * (-1279.705) [-1280.894] (-1279.616) (-1283.016) -- 0:00:45
      274500 -- (-1280.928) (-1280.757) (-1282.135) [-1281.671] * [-1279.705] (-1280.380) (-1282.654) (-1281.741) -- 0:00:44
      275000 -- (-1280.056) (-1282.377) (-1282.547) [-1280.213] * (-1282.024) (-1281.844) [-1280.516] (-1281.558) -- 0:00:44

      Average standard deviation of split frequencies: 0.014613

      275500 -- [-1281.560] (-1282.466) (-1285.019) (-1282.736) * (-1281.663) (-1279.773) [-1280.397] (-1281.375) -- 0:00:47
      276000 -- (-1280.769) (-1280.738) [-1285.019] (-1280.633) * (-1282.251) [-1279.113] (-1279.938) (-1281.141) -- 0:00:47
      276500 -- (-1281.929) (-1283.341) (-1283.179) [-1281.386] * [-1283.221] (-1279.224) (-1280.548) (-1279.595) -- 0:00:47
      277000 -- [-1279.489] (-1281.835) (-1282.944) (-1284.084) * (-1284.086) (-1279.215) [-1280.122] (-1282.811) -- 0:00:46
      277500 -- (-1280.711) (-1281.822) [-1279.398] (-1280.429) * (-1285.187) (-1282.811) [-1279.542] (-1283.486) -- 0:00:46
      278000 -- [-1282.608] (-1281.481) (-1279.056) (-1282.621) * [-1283.008] (-1283.208) (-1280.916) (-1281.719) -- 0:00:46
      278500 -- (-1285.152) [-1281.678] (-1279.971) (-1280.397) * (-1282.484) (-1282.094) [-1279.889] (-1280.635) -- 0:00:46
      279000 -- [-1280.716] (-1282.406) (-1280.464) (-1281.340) * (-1281.531) (-1280.626) [-1280.126] (-1281.658) -- 0:00:46
      279500 -- (-1280.113) [-1282.004] (-1280.261) (-1280.486) * (-1283.968) (-1282.872) (-1281.850) [-1281.011] -- 0:00:46
      280000 -- (-1279.868) [-1286.937] (-1281.142) (-1280.110) * (-1281.732) [-1283.983] (-1284.224) (-1281.094) -- 0:00:46

      Average standard deviation of split frequencies: 0.016049

      280500 -- (-1280.641) (-1282.408) [-1280.963] (-1282.363) * (-1281.325) [-1280.422] (-1288.049) (-1282.940) -- 0:00:46
      281000 -- [-1282.041] (-1285.115) (-1279.473) (-1280.214) * (-1281.251) (-1282.053) [-1285.954] (-1283.437) -- 0:00:46
      281500 -- (-1283.982) (-1285.848) (-1279.921) [-1280.393] * [-1282.217] (-1280.029) (-1283.309) (-1279.111) -- 0:00:45
      282000 -- (-1280.420) (-1288.495) (-1279.704) [-1280.276] * (-1282.355) [-1280.411] (-1283.397) (-1282.920) -- 0:00:45
      282500 -- [-1281.649] (-1286.275) (-1279.703) (-1282.545) * (-1282.179) (-1282.197) (-1279.864) [-1283.864] -- 0:00:45
      283000 -- (-1281.601) (-1287.379) [-1283.199] (-1282.568) * (-1281.088) (-1284.756) (-1279.345) [-1285.637] -- 0:00:45
      283500 -- (-1282.138) (-1287.336) (-1279.927) [-1284.113] * [-1283.992] (-1282.690) (-1285.193) (-1281.055) -- 0:00:45
      284000 -- [-1281.155] (-1283.921) (-1281.032) (-1284.121) * (-1279.402) [-1280.305] (-1285.461) (-1281.326) -- 0:00:45
      284500 -- (-1281.397) (-1286.020) (-1279.640) [-1283.864] * (-1280.909) (-1281.891) [-1282.587] (-1283.754) -- 0:00:45
      285000 -- [-1279.966] (-1281.321) (-1280.546) (-1283.964) * (-1280.874) [-1281.037] (-1281.515) (-1283.193) -- 0:00:45

      Average standard deviation of split frequencies: 0.016391

      285500 -- (-1284.409) (-1281.278) (-1281.718) [-1279.857] * [-1280.388] (-1280.133) (-1282.752) (-1285.100) -- 0:00:45
      286000 -- (-1283.099) (-1283.047) [-1282.215] (-1281.283) * (-1282.520) (-1280.978) (-1279.576) [-1282.021] -- 0:00:44
      286500 -- (-1283.907) (-1286.617) [-1283.400] (-1283.218) * [-1282.940] (-1281.837) (-1279.968) (-1280.257) -- 0:00:44
      287000 -- (-1281.796) [-1283.402] (-1283.816) (-1281.901) * [-1282.781] (-1282.117) (-1281.319) (-1280.004) -- 0:00:44
      287500 -- [-1280.822] (-1284.828) (-1283.617) (-1282.171) * (-1284.178) (-1281.866) [-1284.211] (-1283.499) -- 0:00:44
      288000 -- [-1279.881] (-1281.989) (-1284.472) (-1281.826) * (-1281.639) [-1280.526] (-1283.529) (-1283.515) -- 0:00:44
      288500 -- (-1280.326) [-1283.943] (-1284.933) (-1283.104) * [-1281.036] (-1282.906) (-1282.279) (-1282.246) -- 0:00:44
      289000 -- (-1281.945) [-1282.221] (-1281.344) (-1281.903) * (-1282.837) (-1281.804) [-1281.231] (-1281.060) -- 0:00:44
      289500 -- (-1282.436) (-1281.593) [-1284.348] (-1284.824) * (-1283.076) (-1280.482) (-1281.755) [-1280.415] -- 0:00:44
      290000 -- (-1281.538) [-1281.592] (-1281.340) (-1284.860) * (-1280.519) (-1280.760) [-1281.484] (-1280.369) -- 0:00:44

      Average standard deviation of split frequencies: 0.017157

      290500 -- (-1280.288) [-1280.178] (-1281.338) (-1286.315) * (-1281.793) (-1280.624) (-1280.496) [-1280.774] -- 0:00:43
      291000 -- (-1279.847) (-1281.628) [-1280.221] (-1281.617) * [-1279.281] (-1280.741) (-1282.968) (-1279.900) -- 0:00:43
      291500 -- [-1282.896] (-1280.233) (-1280.184) (-1281.427) * (-1281.195) (-1280.077) [-1281.735] (-1279.465) -- 0:00:46
      292000 -- (-1282.854) (-1279.944) [-1282.147] (-1282.754) * (-1282.455) [-1283.248] (-1280.095) (-1279.490) -- 0:00:46
      292500 -- [-1286.762] (-1280.892) (-1281.300) (-1283.211) * (-1282.041) (-1281.913) [-1280.658] (-1280.017) -- 0:00:45
      293000 -- (-1285.308) (-1281.364) [-1282.112] (-1283.574) * (-1289.495) (-1283.527) (-1280.187) [-1280.066] -- 0:00:45
      293500 -- (-1282.818) (-1281.381) (-1281.417) [-1281.469] * (-1282.254) [-1280.429] (-1281.180) (-1280.027) -- 0:00:45
      294000 -- (-1284.408) (-1280.291) (-1281.319) [-1280.285] * (-1284.770) (-1280.868) (-1281.045) [-1280.321] -- 0:00:45
      294500 -- (-1281.556) [-1280.108] (-1281.961) (-1281.039) * (-1283.034) (-1279.811) (-1279.652) [-1283.179] -- 0:00:45
      295000 -- (-1281.159) (-1283.030) (-1279.864) [-1281.480] * (-1282.660) (-1281.353) (-1279.797) [-1282.044] -- 0:00:45

      Average standard deviation of split frequencies: 0.015423

      295500 -- (-1281.149) (-1280.484) (-1282.489) [-1280.372] * (-1282.802) [-1283.086] (-1280.261) (-1283.595) -- 0:00:45
      296000 -- [-1281.505] (-1280.468) (-1280.981) (-1286.152) * (-1287.833) (-1281.591) (-1281.967) [-1279.765] -- 0:00:45
      296500 -- [-1282.924] (-1279.911) (-1281.140) (-1282.847) * [-1281.380] (-1285.089) (-1280.591) (-1280.246) -- 0:00:45
      297000 -- (-1282.900) (-1281.096) (-1283.891) [-1282.464] * (-1281.036) [-1283.483] (-1281.907) (-1281.694) -- 0:00:44
      297500 -- (-1281.386) (-1279.673) [-1282.274] (-1281.887) * [-1283.747] (-1280.894) (-1280.530) (-1282.098) -- 0:00:44
      298000 -- [-1280.216] (-1283.116) (-1281.142) (-1281.051) * (-1283.995) [-1279.629] (-1279.500) (-1279.842) -- 0:00:44
      298500 -- (-1279.894) (-1282.638) (-1279.598) [-1282.386] * (-1281.381) (-1280.113) [-1279.497] (-1280.237) -- 0:00:44
      299000 -- (-1282.495) (-1282.911) [-1279.985] (-1281.220) * [-1281.221] (-1280.707) (-1280.968) (-1280.730) -- 0:00:44
      299500 -- (-1281.064) (-1282.587) (-1280.416) [-1281.463] * (-1282.323) (-1280.829) [-1279.161] (-1280.711) -- 0:00:44
      300000 -- (-1281.055) (-1283.873) (-1284.279) [-1280.563] * (-1283.109) (-1284.488) (-1282.232) [-1283.008] -- 0:00:44

      Average standard deviation of split frequencies: 0.015596

      300500 -- [-1281.506] (-1283.703) (-1285.003) (-1282.122) * [-1281.758] (-1282.135) (-1279.379) (-1283.501) -- 0:00:44
      301000 -- (-1281.762) [-1282.172] (-1283.451) (-1286.003) * [-1280.864] (-1283.865) (-1281.087) (-1281.283) -- 0:00:44
      301500 -- (-1284.372) [-1282.189] (-1283.652) (-1288.417) * [-1280.612] (-1280.613) (-1280.278) (-1282.437) -- 0:00:44
      302000 -- (-1281.072) (-1281.387) [-1281.287] (-1280.021) * [-1280.390] (-1284.890) (-1280.853) (-1281.042) -- 0:00:43
      302500 -- (-1280.372) (-1283.137) (-1280.352) [-1281.159] * (-1283.894) (-1284.874) (-1280.853) [-1280.518] -- 0:00:43
      303000 -- (-1280.452) [-1281.641] (-1279.804) (-1279.266) * (-1286.298) (-1291.963) (-1280.927) [-1280.396] -- 0:00:43
      303500 -- [-1279.589] (-1280.243) (-1279.947) (-1281.845) * [-1281.250] (-1280.414) (-1280.122) (-1288.586) -- 0:00:43
      304000 -- (-1281.516) (-1283.550) (-1279.451) [-1279.936] * [-1279.283] (-1279.798) (-1280.600) (-1284.788) -- 0:00:43
      304500 -- (-1280.062) (-1281.088) (-1279.640) [-1281.679] * (-1280.495) (-1283.363) [-1279.694] (-1284.969) -- 0:00:43
      305000 -- (-1281.366) (-1281.547) [-1279.722] (-1280.689) * (-1280.934) (-1281.922) (-1281.615) [-1280.964] -- 0:00:43

      Average standard deviation of split frequencies: 0.013942

      305500 -- (-1281.511) (-1283.423) [-1280.612] (-1280.978) * (-1284.490) (-1282.314) [-1279.122] (-1284.649) -- 0:00:43
      306000 -- (-1279.499) (-1281.463) [-1282.509] (-1281.488) * (-1286.010) (-1280.026) [-1282.007] (-1280.986) -- 0:00:43
      306500 -- [-1281.313] (-1285.898) (-1281.810) (-1280.549) * (-1282.904) (-1282.227) (-1280.596) [-1280.376] -- 0:00:42
      307000 -- (-1281.697) (-1280.454) (-1281.174) [-1280.622] * (-1283.638) (-1283.506) [-1281.309] (-1281.315) -- 0:00:42
      307500 -- [-1279.716] (-1280.345) (-1281.935) (-1281.215) * (-1284.909) [-1282.176] (-1280.860) (-1280.436) -- 0:00:45
      308000 -- (-1280.197) (-1280.933) [-1282.502] (-1282.932) * (-1283.106) (-1280.597) [-1280.984] (-1280.096) -- 0:00:44
      308500 -- [-1280.298] (-1280.337) (-1283.381) (-1280.880) * (-1281.278) (-1280.391) (-1286.186) [-1280.107] -- 0:00:44
      309000 -- (-1280.394) [-1281.270] (-1284.857) (-1280.337) * (-1287.142) (-1280.561) (-1283.794) [-1279.621] -- 0:00:44
      309500 -- (-1280.834) [-1283.638] (-1282.947) (-1281.442) * (-1282.525) [-1283.804] (-1282.602) (-1283.012) -- 0:00:44
      310000 -- (-1282.259) (-1283.917) (-1284.666) [-1281.170] * (-1284.325) (-1280.988) (-1289.317) [-1281.944] -- 0:00:44

      Average standard deviation of split frequencies: 0.014264

      310500 -- (-1282.022) [-1282.396] (-1283.023) (-1282.174) * (-1283.221) (-1279.504) [-1282.431] (-1284.416) -- 0:00:44
      311000 -- (-1279.681) [-1279.300] (-1285.280) (-1280.175) * (-1283.813) [-1279.519] (-1280.857) (-1280.043) -- 0:00:44
      311500 -- (-1279.681) (-1280.923) (-1282.319) [-1282.008] * (-1283.563) [-1279.417] (-1279.775) (-1280.043) -- 0:00:44
      312000 -- [-1280.472] (-1283.834) (-1286.784) (-1282.873) * [-1280.769] (-1280.981) (-1280.530) (-1280.822) -- 0:00:44
      312500 -- (-1283.727) (-1279.319) [-1283.328] (-1280.615) * [-1283.120] (-1280.196) (-1279.587) (-1280.866) -- 0:00:44
      313000 -- (-1280.449) [-1279.543] (-1279.439) (-1284.885) * (-1281.872) (-1280.172) [-1280.352] (-1280.358) -- 0:00:43
      313500 -- (-1281.415) (-1287.637) (-1279.868) [-1284.541] * (-1282.690) (-1280.124) (-1282.411) [-1281.421] -- 0:00:43
      314000 -- [-1280.093] (-1280.669) (-1280.447) (-1281.533) * [-1280.478] (-1280.828) (-1280.614) (-1281.467) -- 0:00:43
      314500 -- [-1280.028] (-1281.458) (-1279.600) (-1281.900) * [-1280.580] (-1280.746) (-1281.461) (-1281.388) -- 0:00:43
      315000 -- (-1279.583) (-1281.019) (-1279.891) [-1281.607] * (-1281.658) (-1281.452) (-1281.206) [-1280.590] -- 0:00:43

      Average standard deviation of split frequencies: 0.015166

      315500 -- (-1281.064) (-1279.605) (-1279.211) [-1282.777] * [-1280.093] (-1282.976) (-1281.880) (-1279.457) -- 0:00:43
      316000 -- (-1279.942) (-1279.524) [-1279.214] (-1284.594) * (-1280.143) [-1287.792] (-1282.010) (-1281.702) -- 0:00:43
      316500 -- (-1284.327) (-1281.281) [-1280.309] (-1281.895) * (-1280.680) (-1285.068) (-1281.519) [-1281.701] -- 0:00:43
      317000 -- (-1286.068) (-1283.305) (-1281.202) [-1280.614] * (-1283.221) (-1282.227) [-1281.069] (-1279.142) -- 0:00:43
      317500 -- (-1282.118) (-1281.986) [-1281.748] (-1280.487) * (-1283.917) (-1282.378) (-1285.002) [-1279.140] -- 0:00:42
      318000 -- (-1281.978) [-1283.123] (-1282.630) (-1285.059) * (-1280.254) [-1280.988] (-1283.490) (-1280.525) -- 0:00:42
      318500 -- [-1280.155] (-1282.173) (-1281.978) (-1284.643) * [-1281.622] (-1281.020) (-1283.782) (-1281.000) -- 0:00:42
      319000 -- [-1280.789] (-1281.242) (-1283.323) (-1280.306) * (-1283.699) (-1280.939) [-1279.493] (-1281.013) -- 0:00:42
      319500 -- [-1280.736] (-1284.960) (-1282.478) (-1280.948) * (-1282.338) [-1281.061] (-1280.928) (-1283.697) -- 0:00:42
      320000 -- (-1281.785) [-1283.737] (-1283.630) (-1281.874) * (-1284.124) (-1281.176) [-1280.478] (-1281.182) -- 0:00:42

      Average standard deviation of split frequencies: 0.015272

      320500 -- (-1281.801) (-1281.750) [-1285.617] (-1280.174) * [-1279.654] (-1281.188) (-1281.383) (-1283.707) -- 0:00:42
      321000 -- [-1280.751] (-1283.220) (-1285.644) (-1282.166) * (-1280.084) (-1282.090) (-1284.269) [-1282.504] -- 0:00:42
      321500 -- (-1284.581) (-1279.682) (-1280.971) [-1281.263] * [-1281.469] (-1285.104) (-1284.923) (-1281.869) -- 0:00:42
      322000 -- (-1282.714) (-1279.809) (-1281.625) [-1280.578] * (-1279.354) [-1280.876] (-1287.025) (-1283.598) -- 0:00:42
      322500 -- (-1284.274) (-1279.940) (-1283.768) [-1280.773] * (-1282.611) (-1281.133) (-1283.683) [-1282.283] -- 0:00:42
      323000 -- (-1285.003) (-1279.606) (-1279.494) [-1282.302] * [-1281.372] (-1282.772) (-1280.986) (-1283.178) -- 0:00:41
      323500 -- (-1280.890) (-1280.398) [-1280.404] (-1281.570) * [-1279.887] (-1283.802) (-1281.882) (-1280.809) -- 0:00:43
      324000 -- (-1281.809) (-1281.797) (-1280.212) [-1283.170] * [-1279.681] (-1283.294) (-1281.615) (-1281.211) -- 0:00:43
      324500 -- (-1279.576) (-1284.705) [-1279.727] (-1281.115) * (-1280.727) [-1282.832] (-1281.281) (-1280.885) -- 0:00:43
      325000 -- (-1284.260) [-1283.691] (-1280.054) (-1279.612) * (-1281.074) (-1283.036) (-1280.198) [-1281.341] -- 0:00:43

      Average standard deviation of split frequencies: 0.014677

      325500 -- (-1282.192) (-1281.861) (-1280.350) [-1281.875] * (-1281.353) [-1284.081] (-1279.736) (-1280.214) -- 0:00:43
      326000 -- (-1280.468) (-1281.725) [-1280.758] (-1283.897) * [-1283.676] (-1283.383) (-1279.736) (-1281.497) -- 0:00:43
      326500 -- (-1288.169) (-1282.141) [-1279.505] (-1286.473) * (-1283.062) [-1283.813] (-1279.753) (-1281.092) -- 0:00:43
      327000 -- (-1283.719) (-1283.015) (-1279.583) [-1282.670] * (-1281.895) [-1282.639] (-1280.101) (-1280.755) -- 0:00:43
      327500 -- (-1281.291) [-1282.233] (-1280.154) (-1285.881) * (-1280.528) (-1283.276) (-1280.101) [-1280.162] -- 0:00:43
      328000 -- (-1283.058) [-1281.069] (-1280.056) (-1282.332) * (-1280.673) (-1283.513) (-1281.410) [-1280.307] -- 0:00:43
      328500 -- (-1282.145) [-1284.619] (-1289.208) (-1281.720) * (-1281.529) [-1280.784] (-1281.337) (-1282.918) -- 0:00:42
      329000 -- (-1282.684) [-1280.436] (-1282.213) (-1282.551) * (-1281.379) [-1281.990] (-1282.183) (-1282.129) -- 0:00:42
      329500 -- (-1283.416) (-1281.275) [-1283.330] (-1282.334) * [-1281.354] (-1280.024) (-1284.299) (-1280.165) -- 0:00:42
      330000 -- (-1281.693) [-1279.959] (-1286.686) (-1283.985) * [-1280.026] (-1279.777) (-1284.287) (-1279.882) -- 0:00:42

      Average standard deviation of split frequencies: 0.014781

      330500 -- (-1281.583) (-1279.732) (-1283.663) [-1281.639] * [-1281.304] (-1282.675) (-1282.166) (-1280.853) -- 0:00:42
      331000 -- (-1280.958) [-1279.514] (-1281.310) (-1281.340) * (-1280.629) (-1279.763) (-1281.936) [-1287.857] -- 0:00:42
      331500 -- (-1280.833) (-1280.944) [-1281.316] (-1281.131) * [-1282.145] (-1281.437) (-1282.935) (-1281.519) -- 0:00:42
      332000 -- (-1280.292) (-1281.713) [-1281.070] (-1283.697) * (-1280.566) (-1283.508) (-1281.523) [-1279.908] -- 0:00:42
      332500 -- (-1279.408) [-1281.384] (-1282.127) (-1281.037) * (-1283.122) (-1282.299) [-1281.420] (-1280.392) -- 0:00:42
      333000 -- (-1281.575) [-1286.294] (-1283.563) (-1281.156) * [-1285.360] (-1282.124) (-1280.870) (-1280.017) -- 0:00:42
      333500 -- [-1281.813] (-1280.674) (-1280.299) (-1279.813) * (-1286.432) (-1285.543) [-1282.889] (-1280.317) -- 0:00:41
      334000 -- (-1282.574) (-1281.679) (-1280.491) [-1280.634] * (-1279.795) [-1281.601] (-1284.264) (-1281.435) -- 0:00:41
      334500 -- (-1281.948) [-1282.826] (-1282.379) (-1282.801) * [-1280.311] (-1282.287) (-1282.889) (-1280.464) -- 0:00:41
      335000 -- [-1281.564] (-1283.376) (-1281.431) (-1283.710) * (-1280.865) (-1282.380) [-1284.055] (-1282.915) -- 0:00:41

      Average standard deviation of split frequencies: 0.014399

      335500 -- (-1281.614) (-1286.258) (-1280.245) [-1284.856] * (-1280.782) (-1282.322) (-1280.355) [-1283.147] -- 0:00:41
      336000 -- (-1280.870) (-1283.306) (-1281.337) [-1279.926] * [-1281.537] (-1279.785) (-1281.725) (-1280.752) -- 0:00:41
      336500 -- (-1280.338) (-1280.959) [-1282.279] (-1280.653) * (-1280.386) [-1284.431] (-1280.937) (-1279.859) -- 0:00:41
      337000 -- (-1280.411) [-1281.371] (-1280.516) (-1280.030) * (-1282.289) (-1279.751) [-1281.316] (-1282.998) -- 0:00:41
      337500 -- (-1280.132) [-1280.849] (-1282.042) (-1286.890) * (-1280.951) (-1279.751) (-1280.344) [-1285.153] -- 0:00:41
      338000 -- (-1280.733) (-1281.018) (-1283.756) [-1281.080] * (-1282.968) (-1281.550) (-1281.238) [-1280.740] -- 0:00:41
      338500 -- (-1281.129) [-1281.064] (-1283.407) (-1280.129) * [-1281.517] (-1280.605) (-1285.531) (-1280.551) -- 0:00:41
      339000 -- (-1280.379) [-1282.875] (-1283.320) (-1280.026) * (-1280.464) (-1284.519) [-1285.761] (-1280.977) -- 0:00:40
      339500 -- (-1280.322) (-1281.984) [-1285.480] (-1280.380) * (-1281.030) (-1280.568) [-1283.592] (-1282.137) -- 0:00:42
      340000 -- (-1279.907) (-1280.445) (-1281.918) [-1281.263] * (-1283.608) (-1280.073) (-1281.876) [-1281.791] -- 0:00:42

      Average standard deviation of split frequencies: 0.014453

      340500 -- [-1280.499] (-1281.678) (-1282.201) (-1279.337) * (-1280.098) (-1282.277) (-1280.176) [-1283.309] -- 0:00:42
      341000 -- [-1280.856] (-1281.463) (-1279.575) (-1280.597) * (-1280.327) [-1279.703] (-1279.067) (-1283.909) -- 0:00:42
      341500 -- (-1280.487) (-1286.036) (-1282.699) [-1281.972] * [-1280.624] (-1280.134) (-1280.044) (-1282.714) -- 0:00:42
      342000 -- (-1283.040) (-1282.940) (-1282.790) [-1281.387] * (-1281.136) (-1281.318) (-1281.011) [-1282.000] -- 0:00:42
      342500 -- [-1281.550] (-1284.148) (-1279.441) (-1282.464) * [-1281.469] (-1279.527) (-1281.110) (-1283.350) -- 0:00:42
      343000 -- (-1279.856) (-1281.811) [-1281.440] (-1279.689) * (-1280.719) (-1280.259) (-1280.478) [-1282.239] -- 0:00:42
      343500 -- (-1281.538) (-1281.959) [-1280.750] (-1280.596) * (-1280.471) [-1280.093] (-1280.049) (-1280.481) -- 0:00:42
      344000 -- (-1280.238) [-1281.200] (-1281.232) (-1282.145) * (-1285.079) (-1281.061) (-1280.259) [-1284.365] -- 0:00:41
      344500 -- (-1280.829) [-1282.748] (-1280.569) (-1283.758) * (-1283.097) [-1281.594] (-1280.850) (-1284.885) -- 0:00:41
      345000 -- (-1281.562) (-1279.883) (-1281.101) [-1279.482] * [-1280.544] (-1280.972) (-1279.389) (-1279.117) -- 0:00:41

      Average standard deviation of split frequencies: 0.014198

      345500 -- (-1280.764) [-1282.477] (-1280.116) (-1280.827) * (-1280.478) (-1280.304) [-1279.428] (-1279.627) -- 0:00:41
      346000 -- (-1281.467) (-1279.870) (-1281.312) [-1281.555] * (-1284.694) (-1283.579) (-1282.059) [-1279.504] -- 0:00:41
      346500 -- (-1278.969) (-1280.522) (-1281.506) [-1282.626] * (-1282.921) [-1283.958] (-1280.142) (-1280.504) -- 0:00:41
      347000 -- (-1279.155) (-1280.080) [-1279.335] (-1280.507) * (-1282.604) [-1282.068] (-1281.961) (-1284.220) -- 0:00:41
      347500 -- (-1279.883) (-1284.020) (-1280.865) [-1279.989] * [-1282.861] (-1282.493) (-1281.490) (-1280.040) -- 0:00:41
      348000 -- [-1279.412] (-1279.937) (-1280.955) (-1282.858) * (-1281.187) (-1280.936) (-1279.457) [-1280.828] -- 0:00:41
      348500 -- [-1278.979] (-1280.933) (-1280.579) (-1283.127) * (-1280.294) [-1281.655] (-1279.735) (-1281.172) -- 0:00:41
      349000 -- (-1280.105) (-1281.241) (-1280.581) [-1281.499] * [-1281.363] (-1282.739) (-1281.868) (-1281.529) -- 0:00:41
      349500 -- (-1282.141) (-1280.402) [-1280.697] (-1282.344) * (-1279.993) (-1284.139) [-1282.056] (-1281.747) -- 0:00:40
      350000 -- (-1282.324) (-1281.692) [-1279.976] (-1281.245) * (-1282.165) (-1282.959) (-1283.440) [-1282.433] -- 0:00:40

      Average standard deviation of split frequencies: 0.015499

      350500 -- (-1280.475) (-1281.421) (-1280.122) [-1280.294] * (-1284.474) (-1284.892) [-1280.460] (-1283.881) -- 0:00:40
      351000 -- [-1284.275] (-1283.283) (-1279.790) (-1285.369) * (-1286.744) (-1283.366) (-1280.963) [-1282.766] -- 0:00:40
      351500 -- (-1282.557) [-1279.437] (-1279.973) (-1282.500) * (-1280.350) (-1281.411) (-1279.642) [-1280.012] -- 0:00:40
      352000 -- [-1280.310] (-1279.261) (-1281.230) (-1281.511) * (-1282.478) [-1282.232] (-1280.345) (-1281.792) -- 0:00:40
      352500 -- (-1280.804) (-1279.617) [-1280.242] (-1279.413) * (-1283.031) (-1279.922) (-1282.696) [-1279.123] -- 0:00:40
      353000 -- (-1284.130) [-1279.617] (-1282.007) (-1290.734) * [-1281.562] (-1280.423) (-1281.366) (-1281.792) -- 0:00:40
      353500 -- (-1282.771) [-1284.316] (-1281.996) (-1285.155) * (-1281.562) (-1283.576) (-1280.473) [-1282.852] -- 0:00:40
      354000 -- (-1286.240) (-1283.534) (-1281.313) [-1281.676] * (-1280.550) [-1279.586] (-1281.286) (-1282.541) -- 0:00:40
      354500 -- (-1280.718) [-1286.480] (-1279.909) (-1282.720) * (-1284.446) (-1279.355) [-1282.645] (-1283.571) -- 0:00:40
      355000 -- (-1283.087) (-1285.235) [-1280.856] (-1281.148) * (-1280.702) (-1279.588) [-1282.635] (-1280.553) -- 0:00:39

      Average standard deviation of split frequencies: 0.014722

      355500 -- [-1282.613] (-1282.301) (-1282.688) (-1280.715) * (-1283.269) [-1279.494] (-1282.663) (-1282.523) -- 0:00:41
      356000 -- (-1280.144) (-1282.152) [-1280.481] (-1279.636) * (-1281.568) (-1279.590) (-1283.144) [-1281.290] -- 0:00:41
      356500 -- (-1279.530) [-1280.849] (-1282.033) (-1283.211) * (-1282.522) [-1282.070] (-1282.850) (-1280.308) -- 0:00:41
      357000 -- (-1281.478) (-1283.498) [-1280.596] (-1284.454) * [-1282.229] (-1280.819) (-1281.810) (-1279.937) -- 0:00:41
      357500 -- [-1280.933] (-1282.460) (-1279.598) (-1283.294) * (-1281.462) (-1282.862) [-1282.327] (-1281.918) -- 0:00:41
      358000 -- (-1281.422) (-1282.984) (-1280.778) [-1282.440] * (-1283.498) (-1283.065) (-1280.579) [-1281.265] -- 0:00:41
      358500 -- (-1281.138) (-1282.785) (-1280.708) [-1283.231] * (-1281.341) (-1281.165) [-1281.189] (-1281.318) -- 0:00:41
      359000 -- (-1279.881) (-1281.858) [-1283.347] (-1283.712) * (-1281.369) (-1281.888) (-1280.992) [-1280.375] -- 0:00:41
      359500 -- (-1280.338) [-1281.891] (-1283.291) (-1281.677) * (-1283.413) [-1282.662] (-1281.338) (-1279.008) -- 0:00:40
      360000 -- (-1280.015) [-1282.328] (-1285.402) (-1282.247) * [-1281.385] (-1281.567) (-1281.263) (-1279.052) -- 0:00:40

      Average standard deviation of split frequencies: 0.013839

      360500 -- (-1279.117) [-1286.242] (-1279.967) (-1283.174) * (-1286.056) (-1282.362) (-1282.471) [-1279.745] -- 0:00:40
      361000 -- [-1280.946] (-1281.535) (-1281.664) (-1281.620) * (-1281.907) (-1285.430) (-1283.322) [-1281.112] -- 0:00:40
      361500 -- [-1280.970] (-1282.759) (-1283.115) (-1279.192) * (-1284.103) (-1286.625) [-1282.386] (-1280.771) -- 0:00:40
      362000 -- (-1279.784) (-1284.911) [-1280.549] (-1281.608) * (-1282.979) [-1282.535] (-1279.948) (-1283.992) -- 0:00:40
      362500 -- (-1279.022) (-1281.996) [-1280.550] (-1280.110) * [-1283.092] (-1282.379) (-1280.440) (-1282.419) -- 0:00:40
      363000 -- (-1280.243) (-1281.019) [-1279.843] (-1283.868) * [-1280.060] (-1282.738) (-1280.304) (-1280.337) -- 0:00:40
      363500 -- (-1280.300) (-1283.272) [-1282.028] (-1286.160) * (-1280.118) [-1281.614] (-1284.620) (-1286.032) -- 0:00:40
      364000 -- [-1282.923] (-1280.579) (-1281.240) (-1280.827) * (-1280.109) [-1279.078] (-1282.736) (-1279.586) -- 0:00:40
      364500 -- (-1281.049) [-1279.944] (-1280.296) (-1280.171) * (-1281.850) [-1281.593] (-1282.315) (-1282.194) -- 0:00:40
      365000 -- [-1281.242] (-1282.029) (-1281.824) (-1281.704) * (-1282.413) (-1281.734) [-1282.229] (-1282.857) -- 0:00:40

      Average standard deviation of split frequencies: 0.012236

      365500 -- (-1284.766) (-1279.940) (-1281.575) [-1281.260] * (-1286.348) [-1281.953] (-1280.624) (-1279.718) -- 0:00:39
      366000 -- (-1281.813) [-1280.477] (-1282.184) (-1286.820) * (-1283.239) (-1280.720) [-1280.216] (-1284.629) -- 0:00:39
      366500 -- (-1280.456) (-1283.405) [-1280.944] (-1282.885) * (-1281.793) [-1280.141] (-1281.784) (-1280.069) -- 0:00:39
      367000 -- (-1280.542) (-1284.614) (-1281.364) [-1284.141] * (-1281.550) (-1280.848) (-1280.817) [-1279.957] -- 0:00:39
      367500 -- [-1281.704] (-1280.327) (-1282.726) (-1280.760) * (-1283.250) [-1280.998] (-1279.316) (-1279.299) -- 0:00:39
      368000 -- (-1281.884) (-1282.309) (-1282.021) [-1282.442] * [-1280.598] (-1280.025) (-1280.818) (-1279.794) -- 0:00:39
      368500 -- [-1283.301] (-1279.897) (-1282.670) (-1280.390) * (-1281.275) (-1283.091) [-1281.356] (-1279.972) -- 0:00:39
      369000 -- (-1281.676) (-1280.537) [-1282.476] (-1280.400) * (-1279.781) (-1282.086) (-1281.534) [-1279.797] -- 0:00:39
      369500 -- (-1281.620) (-1281.394) [-1280.143] (-1281.761) * [-1281.125] (-1281.352) (-1287.048) (-1282.411) -- 0:00:39
      370000 -- (-1280.049) (-1282.007) [-1281.030] (-1280.966) * (-1280.916) (-1280.703) (-1285.010) [-1282.938] -- 0:00:39

      Average standard deviation of split frequencies: 0.012364

      370500 -- (-1282.734) (-1281.695) [-1280.160] (-1280.123) * (-1280.439) [-1282.403] (-1282.486) (-1280.480) -- 0:00:39
      371000 -- [-1281.279] (-1281.665) (-1280.171) (-1280.437) * (-1282.422) (-1282.315) (-1280.433) [-1281.831] -- 0:00:40
      371500 -- (-1283.466) (-1283.866) (-1281.968) [-1285.431] * (-1281.006) (-1283.133) [-1281.044] (-1285.285) -- 0:00:40
      372000 -- (-1284.627) [-1283.171] (-1280.989) (-1285.171) * (-1281.670) [-1284.760] (-1281.138) (-1281.504) -- 0:00:40
      372500 -- (-1281.470) [-1281.921] (-1282.716) (-1282.236) * (-1283.452) (-1279.481) (-1280.410) [-1281.764] -- 0:00:40
      373000 -- (-1281.959) (-1284.937) [-1282.867] (-1280.828) * (-1282.182) (-1284.466) (-1282.564) [-1281.530] -- 0:00:40
      373500 -- (-1282.315) (-1280.440) [-1280.902] (-1281.082) * (-1282.183) (-1282.050) (-1281.161) [-1284.340] -- 0:00:40
      374000 -- [-1281.025] (-1282.948) (-1281.862) (-1280.541) * (-1281.854) [-1280.940] (-1282.536) (-1283.305) -- 0:00:40
      374500 -- (-1280.992) [-1281.250] (-1284.472) (-1283.502) * (-1281.853) (-1280.321) [-1281.717] (-1282.361) -- 0:00:40
      375000 -- (-1280.040) (-1281.312) [-1280.750] (-1282.566) * (-1282.366) [-1280.206] (-1281.260) (-1283.870) -- 0:00:40

      Average standard deviation of split frequencies: 0.011353

      375500 -- [-1283.494] (-1281.274) (-1283.305) (-1282.142) * (-1281.447) (-1281.199) [-1283.123] (-1282.128) -- 0:00:39
      376000 -- (-1280.604) (-1281.355) (-1281.467) [-1281.037] * (-1281.572) (-1282.748) (-1281.998) [-1280.507] -- 0:00:39
      376500 -- (-1279.674) [-1282.769] (-1284.936) (-1281.278) * (-1280.371) [-1281.241] (-1281.955) (-1280.855) -- 0:00:39
      377000 -- [-1279.465] (-1280.654) (-1280.446) (-1280.214) * (-1284.325) (-1281.217) (-1285.409) [-1280.197] -- 0:00:39
      377500 -- (-1280.433) (-1281.779) [-1282.256] (-1279.984) * (-1284.562) (-1280.754) [-1288.036] (-1282.029) -- 0:00:39
      378000 -- (-1280.549) [-1282.183] (-1280.669) (-1282.663) * (-1283.669) [-1280.619] (-1284.934) (-1280.720) -- 0:00:39
      378500 -- (-1279.587) (-1284.263) (-1285.428) [-1282.961] * (-1282.878) [-1280.769] (-1287.634) (-1280.010) -- 0:00:39
      379000 -- (-1281.301) (-1285.098) [-1285.559] (-1282.048) * (-1282.474) [-1282.196] (-1281.495) (-1279.838) -- 0:00:39
      379500 -- (-1282.417) [-1283.586] (-1286.052) (-1282.977) * (-1281.875) (-1282.634) (-1280.737) [-1281.031] -- 0:00:39
      380000 -- (-1280.514) (-1283.031) (-1282.480) [-1281.212] * (-1283.441) (-1285.311) (-1280.962) [-1280.503] -- 0:00:39

      Average standard deviation of split frequencies: 0.010939

      380500 -- (-1281.144) (-1283.687) (-1285.750) [-1280.452] * (-1281.134) (-1281.835) (-1280.663) [-1281.185] -- 0:00:39
      381000 -- (-1280.040) (-1281.441) (-1285.560) [-1282.203] * (-1282.348) (-1285.439) [-1279.698] (-1283.216) -- 0:00:38
      381500 -- [-1280.033] (-1285.663) (-1280.592) (-1281.804) * [-1281.899] (-1285.554) (-1283.655) (-1283.522) -- 0:00:38
      382000 -- [-1280.647] (-1279.100) (-1284.435) (-1281.009) * (-1283.258) (-1282.194) (-1281.228) [-1283.127] -- 0:00:38
      382500 -- [-1282.703] (-1281.698) (-1283.589) (-1280.385) * (-1282.941) (-1286.603) (-1281.657) [-1281.198] -- 0:00:38
      383000 -- (-1280.189) [-1280.349] (-1284.166) (-1283.091) * (-1286.355) [-1280.979] (-1281.078) (-1282.232) -- 0:00:38
      383500 -- (-1280.333) (-1281.582) (-1280.216) [-1281.940] * (-1283.820) (-1279.769) [-1281.468] (-1289.193) -- 0:00:38
      384000 -- [-1280.680] (-1281.651) (-1281.110) (-1284.972) * (-1281.212) [-1279.676] (-1280.140) (-1283.359) -- 0:00:38
      384500 -- [-1282.460] (-1281.942) (-1279.925) (-1282.790) * (-1280.289) [-1281.021] (-1281.116) (-1286.851) -- 0:00:38
      385000 -- (-1280.656) (-1284.094) (-1280.208) [-1282.921] * (-1280.417) (-1282.126) [-1280.582] (-1283.482) -- 0:00:38

      Average standard deviation of split frequencies: 0.010927

      385500 -- (-1286.590) [-1281.416] (-1282.014) (-1281.551) * (-1279.909) [-1282.665] (-1281.884) (-1280.466) -- 0:00:38
      386000 -- (-1286.592) (-1281.048) (-1280.797) [-1281.282] * (-1283.088) (-1280.667) [-1282.247] (-1281.674) -- 0:00:38
      386500 -- (-1283.587) (-1280.976) (-1281.143) [-1280.760] * [-1280.116] (-1283.692) (-1280.220) (-1279.575) -- 0:00:38
      387000 -- (-1282.216) (-1280.700) (-1285.242) [-1281.625] * (-1285.178) (-1281.774) (-1283.749) [-1280.166] -- 0:00:39
      387500 -- [-1279.949] (-1280.373) (-1281.320) (-1282.716) * (-1281.493) [-1280.022] (-1283.384) (-1282.703) -- 0:00:39
      388000 -- (-1281.693) (-1279.797) [-1283.241] (-1283.651) * [-1281.418] (-1280.481) (-1280.200) (-1283.565) -- 0:00:39
      388500 -- (-1284.905) [-1279.187] (-1281.807) (-1283.221) * [-1280.227] (-1283.069) (-1280.300) (-1284.381) -- 0:00:39
      389000 -- (-1287.280) (-1279.072) [-1280.160] (-1285.480) * (-1283.439) [-1284.903] (-1280.201) (-1285.581) -- 0:00:39
      389500 -- [-1283.999] (-1279.066) (-1281.599) (-1286.157) * (-1288.363) (-1282.033) [-1281.722] (-1282.826) -- 0:00:39
      390000 -- (-1284.281) (-1279.992) (-1280.313) [-1280.511] * [-1279.598] (-1281.722) (-1281.441) (-1280.729) -- 0:00:39

      Average standard deviation of split frequencies: 0.011286

      390500 -- (-1281.141) (-1279.123) (-1279.454) [-1281.256] * [-1280.171] (-1282.826) (-1281.307) (-1280.281) -- 0:00:39
      391000 -- (-1287.837) (-1279.357) (-1279.342) [-1279.862] * (-1280.462) (-1282.025) (-1282.252) [-1280.667] -- 0:00:38
      391500 -- (-1283.840) [-1280.538] (-1282.394) (-1279.625) * (-1281.247) (-1282.621) (-1282.580) [-1281.764] -- 0:00:38
      392000 -- (-1279.291) [-1281.963] (-1282.292) (-1281.077) * (-1281.266) (-1282.658) [-1281.758] (-1283.325) -- 0:00:38
      392500 -- (-1282.503) (-1280.356) (-1279.410) [-1279.581] * [-1285.190] (-1279.794) (-1281.261) (-1284.268) -- 0:00:38
      393000 -- (-1282.206) [-1282.928] (-1279.800) (-1283.757) * (-1280.570) [-1279.863] (-1280.571) (-1286.674) -- 0:00:38
      393500 -- [-1286.428] (-1280.748) (-1281.158) (-1280.153) * (-1282.123) [-1279.726] (-1282.524) (-1288.400) -- 0:00:38
      394000 -- (-1283.945) [-1285.339] (-1282.532) (-1284.100) * (-1279.879) (-1283.134) [-1280.293] (-1282.340) -- 0:00:38
      394500 -- (-1284.531) (-1281.293) (-1281.957) [-1281.344] * (-1280.928) (-1280.829) [-1281.973] (-1282.141) -- 0:00:38
      395000 -- (-1284.326) (-1281.344) [-1282.077] (-1282.666) * (-1281.977) (-1281.006) (-1282.531) [-1282.568] -- 0:00:38

      Average standard deviation of split frequencies: 0.011274

      395500 -- [-1281.847] (-1280.579) (-1280.768) (-1281.617) * (-1279.754) [-1280.376] (-1283.489) (-1281.556) -- 0:00:38
      396000 -- (-1281.289) (-1280.365) [-1280.264] (-1281.882) * [-1282.140] (-1284.765) (-1285.497) (-1283.240) -- 0:00:38
      396500 -- (-1284.910) [-1281.325] (-1282.597) (-1287.199) * [-1282.013] (-1281.210) (-1281.669) (-1287.224) -- 0:00:38
      397000 -- (-1281.887) (-1279.746) [-1280.260] (-1281.225) * (-1285.402) [-1280.914] (-1282.747) (-1285.156) -- 0:00:37
      397500 -- (-1280.382) [-1279.741] (-1282.048) (-1280.603) * (-1280.207) (-1280.115) (-1280.690) [-1283.765] -- 0:00:37
      398000 -- (-1279.174) [-1280.222] (-1280.607) (-1285.585) * (-1282.630) (-1279.903) (-1281.869) [-1283.812] -- 0:00:37
      398500 -- (-1285.146) [-1279.935] (-1283.462) (-1282.720) * (-1282.346) (-1279.600) (-1281.587) [-1279.911] -- 0:00:37
      399000 -- (-1282.415) (-1281.824) (-1282.990) [-1281.921] * (-1279.765) (-1279.912) (-1282.028) [-1280.532] -- 0:00:37
      399500 -- [-1280.172] (-1280.242) (-1281.942) (-1281.404) * (-1280.662) [-1283.302] (-1282.923) (-1283.209) -- 0:00:37
      400000 -- (-1279.748) (-1280.111) [-1283.009] (-1282.344) * (-1280.683) (-1286.605) [-1281.407] (-1279.984) -- 0:00:37

      Average standard deviation of split frequencies: 0.010381

      400500 -- [-1280.759] (-1282.843) (-1286.381) (-1282.805) * (-1283.166) (-1280.794) (-1281.095) [-1281.076] -- 0:00:37
      401000 -- [-1280.759] (-1280.303) (-1280.567) (-1282.341) * (-1280.380) (-1280.744) [-1280.887] (-1280.296) -- 0:00:37
      401500 -- (-1279.866) [-1280.106] (-1282.070) (-1282.095) * (-1280.366) (-1281.214) [-1282.713] (-1280.850) -- 0:00:37
      402000 -- (-1279.353) (-1283.337) (-1286.684) [-1280.844] * (-1282.590) [-1281.083] (-1283.021) (-1280.641) -- 0:00:37
      402500 -- [-1281.300] (-1281.243) (-1286.073) (-1282.405) * (-1280.783) (-1282.077) [-1281.987] (-1282.179) -- 0:00:37
      403000 -- (-1283.339) (-1280.331) [-1279.237] (-1282.439) * (-1280.319) (-1279.440) [-1280.300] (-1283.212) -- 0:00:38
      403500 -- [-1283.370] (-1280.666) (-1280.750) (-1280.610) * (-1281.672) [-1279.062] (-1281.327) (-1281.197) -- 0:00:38
      404000 -- (-1280.623) (-1279.664) [-1281.414] (-1281.505) * [-1283.637] (-1279.062) (-1280.789) (-1281.912) -- 0:00:38
      404500 -- (-1279.907) (-1279.955) [-1281.817] (-1281.945) * (-1283.865) (-1284.048) (-1279.363) [-1280.534] -- 0:00:38
      405000 -- (-1280.161) (-1279.955) (-1282.200) [-1280.844] * (-1282.680) (-1281.333) [-1282.351] (-1281.850) -- 0:00:38

      Average standard deviation of split frequencies: 0.009934

      405500 -- (-1281.145) (-1282.293) (-1285.975) [-1280.046] * [-1282.039] (-1280.069) (-1285.422) (-1281.884) -- 0:00:38
      406000 -- (-1282.114) (-1281.267) (-1280.910) [-1280.863] * (-1281.009) (-1285.225) (-1285.860) [-1281.295] -- 0:00:38
      406500 -- (-1283.593) [-1281.690] (-1280.562) (-1279.817) * (-1279.324) (-1281.990) (-1284.976) [-1281.177] -- 0:00:37
      407000 -- (-1285.416) (-1282.523) [-1279.847] (-1280.599) * (-1279.485) [-1281.910] (-1281.991) (-1280.684) -- 0:00:37
      407500 -- (-1283.075) [-1280.640] (-1286.099) (-1280.649) * (-1280.440) (-1283.385) [-1282.842] (-1279.606) -- 0:00:37
      408000 -- (-1282.340) (-1280.297) [-1283.063] (-1283.693) * [-1282.739] (-1285.539) (-1281.917) (-1279.646) -- 0:00:37
      408500 -- [-1280.155] (-1281.062) (-1283.166) (-1282.553) * (-1282.891) [-1282.377] (-1285.772) (-1279.877) -- 0:00:37
      409000 -- (-1279.929) (-1281.143) [-1280.554] (-1279.907) * (-1282.599) (-1280.287) (-1284.648) [-1280.346] -- 0:00:37
      409500 -- (-1280.071) (-1282.715) [-1281.962] (-1280.335) * (-1284.040) (-1282.660) [-1284.608] (-1281.538) -- 0:00:37
      410000 -- [-1280.218] (-1284.173) (-1284.114) (-1282.692) * [-1281.052] (-1281.489) (-1280.518) (-1280.818) -- 0:00:37

      Average standard deviation of split frequencies: 0.009926

      410500 -- (-1284.506) (-1282.746) (-1285.931) [-1280.393] * (-1287.104) (-1280.776) (-1280.696) [-1281.860] -- 0:00:37
      411000 -- (-1285.614) (-1282.253) [-1284.154] (-1280.028) * (-1284.669) (-1279.224) [-1282.582] (-1280.879) -- 0:00:37
      411500 -- (-1281.468) (-1282.421) [-1281.699] (-1283.910) * (-1282.291) (-1280.983) [-1284.644] (-1280.210) -- 0:00:37
      412000 -- (-1282.074) (-1282.736) [-1281.196] (-1281.172) * (-1284.281) (-1286.035) [-1280.269] (-1280.412) -- 0:00:37
      412500 -- (-1280.054) (-1288.553) (-1287.599) [-1279.442] * (-1280.627) (-1280.890) (-1281.452) [-1279.165] -- 0:00:37
      413000 -- [-1280.084] (-1281.359) (-1282.255) (-1283.637) * (-1279.419) [-1281.007] (-1281.844) (-1279.628) -- 0:00:36
      413500 -- (-1282.039) (-1279.828) [-1279.779] (-1283.750) * (-1279.441) [-1284.424] (-1282.715) (-1279.750) -- 0:00:36
      414000 -- [-1282.369] (-1280.131) (-1280.999) (-1282.775) * [-1285.113] (-1281.055) (-1282.731) (-1281.008) -- 0:00:36
      414500 -- (-1280.750) (-1280.598) [-1281.852] (-1281.686) * (-1281.147) (-1279.631) (-1281.636) [-1282.410] -- 0:00:36
      415000 -- [-1279.431] (-1279.745) (-1284.106) (-1279.682) * (-1282.181) (-1282.138) [-1280.467] (-1287.107) -- 0:00:36

      Average standard deviation of split frequencies: 0.009932

      415500 -- (-1283.890) (-1279.883) (-1290.770) [-1281.093] * (-1284.630) (-1281.132) (-1279.242) [-1280.950] -- 0:00:36
      416000 -- (-1284.230) [-1279.518] (-1281.623) (-1281.656) * (-1282.360) (-1281.421) (-1280.267) [-1280.153] -- 0:00:36
      416500 -- (-1280.418) (-1279.460) (-1281.707) [-1283.328] * (-1286.881) [-1281.129] (-1283.824) (-1282.394) -- 0:00:36
      417000 -- [-1279.418] (-1283.141) (-1280.948) (-1282.115) * [-1280.910] (-1280.648) (-1282.118) (-1281.482) -- 0:00:36
      417500 -- [-1279.491] (-1286.928) (-1283.418) (-1281.750) * [-1280.080] (-1280.934) (-1282.663) (-1279.725) -- 0:00:36
      418000 -- (-1281.452) (-1282.143) (-1282.341) [-1282.859] * (-1279.836) (-1280.565) (-1285.643) [-1283.976] -- 0:00:36
      418500 -- (-1282.845) (-1279.471) (-1282.260) [-1280.853] * (-1281.422) [-1280.316] (-1283.407) (-1282.231) -- 0:00:36
      419000 -- (-1282.382) [-1285.047] (-1281.300) (-1282.375) * (-1281.844) [-1280.999] (-1279.709) (-1281.572) -- 0:00:37
      419500 -- [-1282.130] (-1282.532) (-1281.552) (-1280.054) * (-1282.315) (-1279.728) [-1280.118] (-1280.843) -- 0:00:37
      420000 -- (-1280.671) (-1282.361) (-1282.539) [-1281.535] * (-1281.198) (-1281.784) [-1282.369] (-1281.955) -- 0:00:37

      Average standard deviation of split frequencies: 0.010086

      420500 -- (-1282.333) (-1286.304) (-1281.914) [-1280.547] * (-1280.315) (-1282.142) (-1281.721) [-1285.261] -- 0:00:37
      421000 -- (-1282.530) [-1281.985] (-1280.033) (-1280.211) * [-1280.824] (-1280.832) (-1280.200) (-1282.890) -- 0:00:37
      421500 -- [-1279.345] (-1280.452) (-1280.675) (-1279.565) * (-1283.529) (-1281.582) (-1280.734) [-1280.681] -- 0:00:37
      422000 -- (-1279.441) [-1284.684] (-1282.141) (-1281.921) * [-1281.416] (-1283.808) (-1281.119) (-1280.613) -- 0:00:36
      422500 -- [-1279.317] (-1284.784) (-1281.131) (-1280.759) * (-1280.294) [-1280.946] (-1284.347) (-1280.241) -- 0:00:36
      423000 -- (-1280.778) (-1284.840) (-1281.320) [-1279.937] * [-1279.857] (-1283.371) (-1282.554) (-1280.332) -- 0:00:36
      423500 -- (-1281.294) (-1282.308) [-1282.322] (-1280.973) * [-1281.726] (-1285.925) (-1282.827) (-1280.941) -- 0:00:36
      424000 -- (-1280.845) (-1279.829) (-1282.632) [-1281.147] * (-1281.963) (-1279.831) [-1281.144] (-1284.094) -- 0:00:36
      424500 -- (-1280.642) [-1283.398] (-1281.738) (-1281.650) * (-1281.191) (-1281.909) [-1280.569] (-1282.919) -- 0:00:36
      425000 -- (-1283.970) [-1282.881] (-1282.114) (-1281.357) * [-1281.704] (-1281.613) (-1279.831) (-1280.744) -- 0:00:36

      Average standard deviation of split frequencies: 0.009569

      425500 -- [-1283.320] (-1281.504) (-1282.699) (-1283.924) * (-1280.808) (-1281.836) (-1281.750) [-1281.802] -- 0:00:36
      426000 -- [-1282.656] (-1283.448) (-1282.930) (-1283.726) * (-1279.793) (-1282.204) [-1281.443] (-1279.078) -- 0:00:36
      426500 -- (-1284.173) (-1281.198) (-1280.250) [-1281.475] * (-1279.782) [-1281.196] (-1280.811) (-1279.196) -- 0:00:36
      427000 -- (-1281.236) (-1282.902) (-1280.301) [-1281.566] * (-1279.765) (-1279.481) [-1282.666] (-1279.196) -- 0:00:36
      427500 -- (-1280.440) [-1286.189] (-1283.295) (-1284.127) * (-1284.802) [-1280.226] (-1279.709) (-1279.701) -- 0:00:36
      428000 -- [-1280.403] (-1281.621) (-1283.352) (-1284.353) * (-1283.032) (-1280.144) [-1279.608] (-1280.394) -- 0:00:36
      428500 -- (-1284.051) [-1281.589] (-1281.997) (-1279.980) * [-1284.816] (-1285.144) (-1280.730) (-1280.400) -- 0:00:36
      429000 -- (-1281.034) (-1284.406) [-1283.333] (-1284.858) * (-1279.992) [-1281.154] (-1282.575) (-1280.414) -- 0:00:35
      429500 -- (-1280.198) [-1284.734] (-1281.701) (-1280.804) * [-1279.953] (-1282.703) (-1280.683) (-1283.805) -- 0:00:35
      430000 -- (-1280.549) (-1286.285) (-1284.368) [-1280.527] * [-1285.426] (-1280.177) (-1282.372) (-1282.178) -- 0:00:35

      Average standard deviation of split frequencies: 0.008950

      430500 -- [-1280.973] (-1284.071) (-1285.123) (-1282.836) * (-1281.121) (-1281.159) (-1286.198) [-1282.085] -- 0:00:35
      431000 -- [-1280.974] (-1281.116) (-1284.677) (-1279.895) * (-1280.899) (-1282.403) [-1280.192] (-1286.064) -- 0:00:35
      431500 -- [-1280.348] (-1282.467) (-1283.408) (-1279.948) * (-1280.813) (-1283.658) [-1280.730] (-1286.465) -- 0:00:35
      432000 -- (-1281.076) [-1281.423] (-1283.405) (-1280.057) * (-1280.610) (-1287.203) [-1279.240] (-1284.131) -- 0:00:35
      432500 -- [-1280.104] (-1281.116) (-1281.468) (-1279.583) * [-1281.166] (-1281.303) (-1281.228) (-1282.221) -- 0:00:35
      433000 -- (-1279.879) (-1279.874) [-1283.470] (-1280.412) * [-1279.960] (-1279.736) (-1280.719) (-1281.779) -- 0:00:35
      433500 -- [-1279.617] (-1280.247) (-1280.999) (-1280.412) * [-1283.665] (-1279.369) (-1281.868) (-1282.633) -- 0:00:35
      434000 -- [-1281.934] (-1282.902) (-1283.083) (-1280.361) * (-1281.110) [-1281.136] (-1283.300) (-1285.914) -- 0:00:35
      434500 -- (-1289.094) (-1280.058) (-1280.740) [-1281.316] * (-1281.670) (-1281.476) (-1281.265) [-1283.783] -- 0:00:36
      435000 -- (-1284.040) [-1279.414] (-1279.405) (-1280.220) * (-1282.608) (-1281.945) [-1279.363] (-1282.163) -- 0:00:36

      Average standard deviation of split frequencies: 0.009222

      435500 -- (-1280.962) [-1282.850] (-1280.251) (-1279.675) * [-1282.271] (-1279.378) (-1281.105) (-1280.666) -- 0:00:36
      436000 -- (-1281.505) (-1280.170) [-1280.516] (-1279.310) * (-1283.706) (-1279.669) (-1281.526) [-1279.883] -- 0:00:36
      436500 -- (-1280.708) (-1280.955) (-1280.403) [-1282.567] * (-1285.582) [-1281.913] (-1280.719) (-1279.517) -- 0:00:36
      437000 -- (-1282.930) (-1280.300) [-1280.149] (-1280.555) * [-1282.408] (-1281.976) (-1280.937) (-1279.802) -- 0:00:36
      437500 -- [-1282.143] (-1280.311) (-1280.284) (-1279.996) * (-1283.210) (-1283.634) [-1279.636] (-1280.033) -- 0:00:36
      438000 -- (-1280.628) [-1280.387] (-1280.104) (-1281.110) * (-1284.933) (-1281.244) (-1279.848) [-1280.475] -- 0:00:35
      438500 -- (-1281.958) (-1281.472) (-1281.396) [-1280.873] * (-1281.414) [-1281.905] (-1281.423) (-1283.567) -- 0:00:35
      439000 -- (-1279.724) (-1282.505) [-1281.454] (-1281.856) * [-1282.024] (-1280.186) (-1286.179) (-1281.218) -- 0:00:35
      439500 -- (-1280.231) (-1280.826) (-1282.504) [-1281.518] * (-1283.603) [-1282.108] (-1280.802) (-1280.585) -- 0:00:35
      440000 -- (-1283.151) [-1279.553] (-1280.095) (-1281.351) * (-1281.252) (-1279.459) [-1280.387] (-1280.264) -- 0:00:35

      Average standard deviation of split frequencies: 0.008495

      440500 -- (-1282.030) [-1281.028] (-1282.006) (-1282.513) * (-1280.974) (-1280.211) [-1281.237] (-1281.708) -- 0:00:35
      441000 -- [-1280.770] (-1280.996) (-1280.488) (-1282.996) * (-1282.445) (-1283.289) (-1281.246) [-1281.444] -- 0:00:35
      441500 -- [-1279.571] (-1281.511) (-1281.050) (-1282.383) * (-1281.028) (-1283.963) [-1280.144] (-1281.059) -- 0:00:35
      442000 -- (-1279.736) [-1282.570] (-1287.771) (-1280.595) * (-1287.130) (-1282.181) (-1280.195) [-1280.450] -- 0:00:35
      442500 -- (-1281.747) (-1283.504) (-1281.705) [-1281.292] * (-1281.718) (-1284.006) [-1279.501] (-1279.741) -- 0:00:35
      443000 -- (-1281.170) (-1280.604) [-1279.739] (-1279.847) * [-1281.765] (-1279.726) (-1285.135) (-1281.547) -- 0:00:35
      443500 -- (-1282.227) [-1280.077] (-1280.024) (-1282.129) * (-1282.116) (-1279.188) [-1283.806] (-1285.335) -- 0:00:35
      444000 -- [-1282.859] (-1281.972) (-1280.155) (-1283.158) * (-1283.550) [-1279.720] (-1281.798) (-1280.403) -- 0:00:35
      444500 -- (-1282.370) [-1279.573] (-1282.541) (-1281.172) * (-1283.986) [-1278.907] (-1279.997) (-1282.936) -- 0:00:34
      445000 -- (-1279.958) (-1280.420) [-1280.383] (-1280.790) * (-1282.209) (-1279.519) (-1281.184) [-1279.481] -- 0:00:34

      Average standard deviation of split frequencies: 0.008514

      445500 -- (-1279.706) (-1284.573) [-1280.516] (-1283.190) * (-1280.364) (-1284.206) [-1280.835] (-1280.796) -- 0:00:34
      446000 -- (-1283.932) (-1282.483) [-1281.666] (-1283.843) * [-1280.816] (-1280.759) (-1280.219) (-1280.167) -- 0:00:34
      446500 -- (-1281.923) [-1281.329] (-1281.366) (-1284.389) * (-1280.007) [-1280.477] (-1280.213) (-1283.205) -- 0:00:34
      447000 -- (-1283.227) (-1279.771) [-1286.193] (-1283.362) * [-1281.491] (-1283.673) (-1279.216) (-1284.955) -- 0:00:34
      447500 -- (-1280.758) [-1280.690] (-1282.467) (-1281.597) * [-1280.579] (-1282.545) (-1285.876) (-1284.126) -- 0:00:34
      448000 -- [-1279.297] (-1281.271) (-1282.554) (-1281.705) * [-1281.046] (-1285.211) (-1284.936) (-1284.264) -- 0:00:34
      448500 -- (-1280.565) (-1281.367) (-1284.913) [-1282.279] * [-1287.136] (-1286.016) (-1280.787) (-1281.257) -- 0:00:34
      449000 -- [-1279.421] (-1283.117) (-1280.433) (-1282.615) * (-1282.738) (-1286.668) [-1282.953] (-1280.551) -- 0:00:34
      449500 -- [-1281.001] (-1280.510) (-1279.662) (-1280.857) * (-1283.436) (-1283.405) [-1283.522] (-1280.551) -- 0:00:34
      450000 -- (-1283.997) (-1280.650) [-1280.352] (-1279.903) * (-1282.453) (-1282.364) [-1284.161] (-1282.140) -- 0:00:34

      Average standard deviation of split frequencies: 0.008491

      450500 -- (-1279.288) [-1280.483] (-1281.268) (-1280.085) * [-1282.356] (-1281.008) (-1281.479) (-1281.639) -- 0:00:35
      451000 -- (-1279.456) [-1283.107] (-1280.105) (-1279.466) * [-1280.630] (-1283.292) (-1280.167) (-1282.168) -- 0:00:35
      451500 -- [-1279.877] (-1283.636) (-1280.973) (-1280.678) * [-1281.208] (-1283.750) (-1279.535) (-1284.245) -- 0:00:35
      452000 -- (-1283.436) [-1281.818] (-1279.906) (-1282.330) * (-1281.297) (-1280.723) [-1279.928] (-1285.054) -- 0:00:35
      452500 -- (-1281.052) [-1282.068] (-1281.043) (-1282.068) * [-1281.373] (-1281.734) (-1282.557) (-1286.436) -- 0:00:35
      453000 -- [-1284.291] (-1281.054) (-1279.307) (-1280.281) * (-1279.703) [-1279.835] (-1279.957) (-1282.502) -- 0:00:35
      453500 -- (-1282.929) (-1283.737) (-1280.241) [-1280.396] * (-1279.698) (-1283.037) [-1280.122] (-1282.283) -- 0:00:34
      454000 -- [-1283.928] (-1282.270) (-1279.698) (-1281.551) * (-1284.023) (-1281.222) [-1288.516] (-1281.172) -- 0:00:34
      454500 -- [-1280.646] (-1284.703) (-1284.929) (-1280.040) * (-1287.256) [-1280.220] (-1284.148) (-1279.748) -- 0:00:34
      455000 -- (-1281.136) [-1278.985] (-1280.493) (-1280.187) * (-1282.207) (-1280.319) (-1282.059) [-1284.062] -- 0:00:34

      Average standard deviation of split frequencies: 0.007430

      455500 -- (-1280.558) [-1279.389] (-1280.839) (-1280.036) * (-1281.828) (-1281.368) (-1282.672) [-1284.707] -- 0:00:34
      456000 -- (-1281.906) (-1280.543) [-1285.643] (-1280.453) * [-1282.019] (-1281.153) (-1284.080) (-1286.602) -- 0:00:34
      456500 -- (-1282.034) [-1282.570] (-1285.580) (-1280.655) * (-1282.265) [-1279.784] (-1283.102) (-1282.929) -- 0:00:34
      457000 -- (-1281.607) (-1279.170) (-1283.104) [-1280.813] * (-1281.934) [-1280.754] (-1281.389) (-1283.296) -- 0:00:34
      457500 -- (-1281.975) (-1280.143) [-1282.294] (-1283.298) * [-1283.210] (-1281.208) (-1280.717) (-1284.706) -- 0:00:34
      458000 -- (-1280.603) (-1279.893) (-1281.272) [-1283.313] * (-1280.103) [-1280.089] (-1280.274) (-1284.836) -- 0:00:34
      458500 -- (-1283.084) [-1280.938] (-1280.416) (-1281.668) * (-1279.940) (-1280.148) [-1281.113] (-1280.771) -- 0:00:34
      459000 -- (-1283.168) (-1280.127) (-1280.882) [-1282.480] * (-1279.744) (-1280.164) [-1279.699] (-1286.214) -- 0:00:34
      459500 -- (-1283.625) [-1281.107] (-1280.811) (-1284.108) * (-1280.756) (-1280.611) (-1279.832) [-1279.733] -- 0:00:34
      460000 -- (-1281.659) (-1281.108) [-1281.549] (-1281.533) * (-1280.541) [-1281.263] (-1281.532) (-1279.774) -- 0:00:34

      Average standard deviation of split frequencies: 0.007803

      460500 -- (-1281.964) (-1281.657) (-1281.265) [-1283.500] * [-1280.921] (-1283.701) (-1281.996) (-1282.740) -- 0:00:33
      461000 -- (-1283.112) [-1282.063] (-1281.889) (-1280.419) * [-1281.132] (-1282.245) (-1282.606) (-1281.117) -- 0:00:33
      461500 -- (-1280.841) (-1281.502) (-1282.273) [-1280.050] * [-1280.831] (-1279.922) (-1282.652) (-1279.922) -- 0:00:33
      462000 -- (-1282.624) (-1280.251) [-1281.140] (-1281.573) * (-1284.521) [-1279.918] (-1281.173) (-1279.915) -- 0:00:33
      462500 -- (-1281.777) (-1279.479) [-1284.293] (-1282.419) * (-1288.185) [-1281.415] (-1280.882) (-1279.789) -- 0:00:33
      463000 -- (-1281.188) (-1286.218) (-1285.469) [-1281.983] * (-1281.084) (-1279.959) [-1281.207] (-1281.109) -- 0:00:33
      463500 -- (-1280.756) (-1281.996) (-1280.001) [-1282.845] * (-1282.897) [-1280.809] (-1280.567) (-1284.727) -- 0:00:33
      464000 -- (-1283.119) (-1280.856) (-1281.532) [-1282.865] * (-1282.011) (-1282.077) (-1281.532) [-1280.248] -- 0:00:33
      464500 -- (-1282.589) (-1284.477) [-1282.131] (-1280.255) * (-1281.134) [-1283.124] (-1281.735) (-1279.964) -- 0:00:33
      465000 -- [-1280.121] (-1282.608) (-1283.896) (-1282.849) * (-1281.691) (-1282.373) (-1279.301) [-1282.827] -- 0:00:33

      Average standard deviation of split frequencies: 0.007018

      465500 -- [-1280.391] (-1281.445) (-1283.605) (-1282.541) * [-1280.895] (-1281.622) (-1279.641) (-1282.908) -- 0:00:34
      466000 -- (-1283.110) (-1281.773) [-1281.841] (-1281.010) * [-1280.901] (-1280.784) (-1280.253) (-1281.012) -- 0:00:34
      466500 -- (-1280.273) (-1281.949) [-1281.280] (-1281.268) * [-1281.656] (-1280.354) (-1280.652) (-1280.338) -- 0:00:34
      467000 -- (-1280.274) [-1286.351] (-1282.390) (-1280.298) * (-1281.283) [-1280.382] (-1282.344) (-1282.538) -- 0:00:34
      467500 -- (-1286.939) (-1286.080) (-1279.414) [-1280.554] * [-1280.497] (-1279.826) (-1282.474) (-1282.839) -- 0:00:34
      468000 -- (-1282.705) [-1280.174] (-1279.414) (-1280.260) * (-1280.782) (-1289.216) (-1283.796) [-1281.650] -- 0:00:34
      468500 -- (-1280.443) (-1279.777) (-1279.610) [-1280.940] * (-1282.647) (-1286.341) (-1281.864) [-1280.914] -- 0:00:34
      469000 -- (-1280.706) (-1279.535) [-1281.126] (-1281.449) * (-1282.250) (-1283.771) (-1282.708) [-1280.837] -- 0:00:33
      469500 -- (-1281.965) [-1281.871] (-1283.568) (-1280.775) * (-1282.514) [-1280.975] (-1285.084) (-1279.981) -- 0:00:33
      470000 -- [-1281.412] (-1280.922) (-1281.311) (-1281.404) * (-1279.552) [-1279.932] (-1279.282) (-1283.949) -- 0:00:33

      Average standard deviation of split frequencies: 0.008200

      470500 -- [-1281.298] (-1281.011) (-1282.300) (-1280.798) * (-1280.566) [-1280.017] (-1280.330) (-1286.990) -- 0:00:33
      471000 -- (-1281.689) (-1281.168) (-1288.059) [-1281.661] * (-1281.220) [-1281.101] (-1280.791) (-1281.421) -- 0:00:33
      471500 -- (-1285.217) (-1286.083) (-1280.218) [-1282.538] * (-1281.713) (-1280.490) [-1283.689] (-1281.535) -- 0:00:33
      472000 -- (-1279.433) [-1281.158] (-1279.122) (-1282.784) * (-1281.687) (-1280.561) [-1284.830] (-1282.474) -- 0:00:33
      472500 -- [-1280.456] (-1282.023) (-1282.278) (-1282.945) * (-1281.035) [-1280.438] (-1280.886) (-1280.589) -- 0:00:33
      4730