--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 16:27:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0265/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -288.80          -291.91
2       -288.79          -292.30
--------------------------------------
TOTAL     -288.80          -292.12
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.895882    0.095827    0.380378    1.526504    0.857581   1280.96   1390.98    1.000
r(A<->C){all}   0.170543    0.020742    0.000021    0.463445    0.132601    120.02    147.04    1.002
r(A<->G){all}   0.160298    0.018971    0.000030    0.429086    0.120020    239.22    288.40    1.000
r(A<->T){all}   0.174874    0.022368    0.000063    0.473358    0.135955    140.68    161.48    1.000
r(C<->G){all}   0.149526    0.017595    0.000093    0.422501    0.110395    220.90    235.56    1.000
r(C<->T){all}   0.171901    0.020091    0.000206    0.474434    0.137472    189.30    229.00    1.000
r(G<->T){all}   0.172857    0.020666    0.000098    0.465335    0.137672    191.66    217.90    1.002
pi(A){all}      0.174210    0.000681    0.122705    0.225415    0.173436   1120.58   1310.79    1.000
pi(C){all}      0.265446    0.000891    0.209849    0.325972    0.264334   1165.55   1250.76    1.000
pi(G){all}      0.298161    0.000991    0.238360    0.361513    0.297308   1171.02   1247.74    1.001
pi(T){all}      0.262183    0.000904    0.201532    0.317675    0.261163   1313.65   1407.33    1.001
alpha{1,2}      0.417385    0.230205    0.000237    1.397936    0.243918    800.00   1011.86    1.000
alpha{3}        0.440089    0.241295    0.000216    1.442665    0.280301   1457.63   1479.31    1.000
pinvar{all}     0.992042    0.000097    0.973463    0.999992    0.995156   1356.80   1362.74    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-270.244501
Model 2: PositiveSelection	-270.244503
Model 0: one-ratio	-270.24451
Model 7: beta	-270.244446
Model 8: beta&w>1	-270.244446


Model 0 vs 1	1.799999995455437E-5

Model 2 vs 1	3.999999989900971E-6

Model 8 vs 7	0.0
>C1
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C2
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C3
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C4
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C5
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C6
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=70 

C1              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C2              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C3              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C4              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C5              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C6              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
                **************************************************

C1              PDDVVKTQLFARIVTLLTWI
C2              PDDVVKTQLFARIVTLLTWI
C3              PDDVVKTQLFARIVTLLTWI
C4              PDDVVKTQLFARIVTLLTWI
C5              PDDVVKTQLFARIVTLLTWI
C6              PDDVVKTQLFARIVTLLTWI
                ********************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   70 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   70 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2100]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2100]--->[2100]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.446 Mb, Max= 30.589 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C2              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C3              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C4              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C5              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C6              LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
                **************************************************

C1              PDDVVKTQLFARIVTLLTWI
C2              PDDVVKTQLFARIVTLLTWI
C3              PDDVVKTQLFARIVTLLTWI
C4              PDDVVKTQLFARIVTLLTWI
C5              PDDVVKTQLFARIVTLLTWI
C6              PDDVVKTQLFARIVTLLTWI
                ********************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C2              TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C3              TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C4              TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C5              TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C6              TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
                **************************************************

C1              CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C2              CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C3              CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C4              CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C5              CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C6              CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
                **************************************************

C1              GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C2              GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C3              GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C4              GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C5              GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C6              GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
                **************************************************

C1              CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C2              CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C3              CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C4              CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C5              CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C6              CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
                **************************************************

C1              CACCTGGATT
C2              CACCTGGATT
C3              CACCTGGATT
C4              CACCTGGATT
C5              CACCTGGATT
C6              CACCTGGATT
                **********



>C1
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C2
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C3
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C4
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C5
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C6
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C1
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C2
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C3
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C4
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C5
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C6
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 210 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579796766
      Setting output file names to "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 728833707
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0331645202
      Seed = 1626890552
      Swapseed = 1579796766
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -469.990066 -- -24.965149
         Chain 2 -- -469.989995 -- -24.965149
         Chain 3 -- -469.990039 -- -24.965149
         Chain 4 -- -469.990039 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -469.990066 -- -24.965149
         Chain 2 -- -469.989995 -- -24.965149
         Chain 3 -- -469.990066 -- -24.965149
         Chain 4 -- -469.990066 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-469.990] (-469.990) (-469.990) (-469.990) * [-469.990] (-469.990) (-469.990) (-469.990) 
        500 -- [-296.756] (-294.244) (-297.383) (-298.128) * [-298.118] (-292.830) (-303.731) (-298.410) -- 0:00:00
       1000 -- [-295.469] (-298.879) (-295.113) (-303.523) * (-302.442) (-295.025) (-310.961) [-298.805] -- 0:00:00
       1500 -- (-299.025) (-296.612) [-298.124] (-296.198) * (-299.352) (-297.061) [-297.810] (-301.820) -- 0:00:00
       2000 -- (-304.037) (-299.893) (-298.081) [-298.618] * (-300.890) [-296.526] (-296.340) (-302.990) -- 0:00:00
       2500 -- (-304.858) (-299.108) (-296.611) [-297.670] * [-299.900] (-310.998) (-298.000) (-306.024) -- 0:00:00
       3000 -- (-305.127) [-298.069] (-309.682) (-298.242) * (-297.678) (-302.000) (-297.362) [-290.187] -- 0:00:00
       3500 -- [-296.046] (-297.575) (-307.142) (-296.174) * (-296.787) (-296.391) (-296.995) [-301.416] -- 0:00:00
       4000 -- (-296.685) (-300.525) (-306.514) [-296.977] * [-295.533] (-295.879) (-300.273) (-294.892) -- 0:00:00
       4500 -- (-300.389) (-304.041) [-288.872] (-304.842) * (-303.378) (-298.979) (-299.929) [-298.694] -- 0:00:00
       5000 -- [-295.091] (-298.567) (-290.245) (-294.927) * (-297.929) (-297.913) (-304.096) [-294.426] -- 0:00:00

      Average standard deviation of split frequencies: 0.102479

       5500 -- (-301.580) (-301.735) (-288.417) [-295.849] * (-299.987) (-294.347) (-301.274) [-297.886] -- 0:00:00
       6000 -- (-298.587) [-298.374] (-287.742) (-301.108) * (-294.825) (-297.601) (-295.890) [-298.092] -- 0:00:00
       6500 -- (-311.991) (-299.254) [-288.507] (-298.262) * (-292.767) [-296.668] (-309.881) (-302.145) -- 0:02:32
       7000 -- (-312.440) (-293.944) [-291.247] (-295.084) * (-305.626) (-300.847) (-309.116) [-299.784] -- 0:02:21
       7500 -- (-311.556) [-297.841] (-288.824) (-297.917) * (-306.973) (-305.850) (-299.859) [-299.865] -- 0:02:12
       8000 -- (-299.854) (-299.855) [-290.374] (-299.160) * (-295.091) (-301.940) [-295.031] (-300.866) -- 0:02:04
       8500 -- (-295.563) [-301.866] (-288.053) (-299.118) * (-301.820) (-313.839) (-296.055) [-303.693] -- 0:01:56
       9000 -- (-288.246) (-305.251) (-290.561) [-296.394] * (-303.157) [-295.480] (-302.463) (-302.237) -- 0:01:50
       9500 -- (-288.048) (-297.512) [-288.381] (-296.178) * (-311.109) (-302.136) (-304.769) [-297.564] -- 0:01:44
      10000 -- (-287.923) [-302.054] (-291.717) (-304.131) * (-298.687) (-300.243) (-294.290) [-294.443] -- 0:01:39

      Average standard deviation of split frequencies: 0.092808

      10500 -- (-289.001) (-306.478) [-287.517] (-296.752) * (-297.832) (-297.892) (-298.552) [-294.818] -- 0:01:34
      11000 -- (-290.324) (-300.058) [-288.892] (-294.950) * (-298.541) (-297.019) [-297.079] (-296.186) -- 0:01:29
      11500 -- [-288.668] (-294.145) (-292.026) (-293.378) * (-301.085) (-301.663) [-305.248] (-302.980) -- 0:01:25
      12000 -- (-289.338) [-291.873] (-292.864) (-303.774) * (-309.104) (-295.990) [-304.449] (-293.827) -- 0:01:22
      12500 -- (-288.239) (-289.291) [-290.239] (-295.492) * [-295.957] (-299.447) (-298.826) (-295.418) -- 0:01:19
      13000 -- (-289.696) (-290.570) [-289.018] (-299.056) * (-305.016) [-295.697] (-300.150) (-298.661) -- 0:01:15
      13500 -- (-289.141) [-289.793] (-291.499) (-292.656) * (-299.781) (-304.787) [-298.170] (-300.290) -- 0:01:13
      14000 -- (-289.336) [-289.264] (-289.096) (-300.185) * (-293.100) (-301.906) [-299.682] (-301.734) -- 0:01:10
      14500 -- (-290.164) (-288.021) [-288.203] (-301.463) * (-301.427) (-299.334) (-295.591) [-299.880] -- 0:01:07
      15000 -- (-290.758) (-290.298) (-288.792) [-297.726] * [-300.805] (-305.629) (-295.098) (-308.214) -- 0:01:05

      Average standard deviation of split frequencies: 0.066679

      15500 -- (-289.328) [-289.196] (-295.171) (-302.219) * (-303.162) (-307.450) (-299.754) [-296.913] -- 0:01:03
      16000 -- (-291.034) [-291.581] (-288.953) (-303.476) * (-299.022) [-293.146] (-299.362) (-298.199) -- 0:01:01
      16500 -- (-291.297) (-289.279) (-288.089) [-296.325] * (-299.360) (-299.002) (-303.166) [-303.418] -- 0:00:59
      17000 -- (-288.899) (-291.748) [-288.116] (-289.547) * [-292.114] (-302.019) (-297.338) (-306.862) -- 0:00:57
      17500 -- [-289.438] (-288.835) (-288.788) (-288.442) * (-307.405) (-298.517) [-296.785] (-301.666) -- 0:00:56
      18000 -- [-288.354] (-290.230) (-288.685) (-287.876) * (-300.387) (-299.257) (-299.097) [-301.828] -- 0:00:54
      18500 -- [-288.152] (-287.396) (-288.924) (-292.316) * (-294.176) [-298.920] (-310.064) (-298.438) -- 0:00:53
      19000 -- (-291.116) (-289.843) (-290.639) [-288.397] * (-294.327) (-296.880) (-300.588) [-300.643] -- 0:00:51
      19500 -- (-290.928) [-289.213] (-290.977) (-292.931) * (-301.788) (-303.650) (-297.539) [-299.398] -- 0:00:50
      20000 -- (-288.559) (-289.934) [-288.539] (-291.579) * (-295.495) [-302.497] (-306.823) (-300.446) -- 0:00:49

      Average standard deviation of split frequencies: 0.044278

      20500 -- (-289.969) (-288.156) [-289.438] (-288.606) * [-299.760] (-297.937) (-308.079) (-299.246) -- 0:00:47
      21000 -- (-288.164) (-289.120) [-289.388] (-289.301) * (-298.685) (-299.447) [-296.967] (-300.342) -- 0:00:46
      21500 -- (-292.415) (-291.572) (-288.724) [-287.961] * [-303.575] (-302.577) (-304.371) (-299.205) -- 0:00:45
      22000 -- (-290.000) [-288.632] (-291.131) (-290.270) * [-298.727] (-300.519) (-301.167) (-305.405) -- 0:00:44
      22500 -- (-297.339) [-289.175] (-288.245) (-289.093) * [-299.562] (-298.824) (-295.679) (-305.044) -- 0:00:43
      23000 -- (-289.513) (-287.077) [-287.296] (-289.606) * (-296.935) (-298.468) (-292.315) [-299.826] -- 0:01:24
      23500 -- (-288.767) (-288.032) [-288.331] (-289.024) * (-302.897) [-298.355] (-289.709) (-294.274) -- 0:01:23
      24000 -- (-289.375) (-290.654) (-288.520) [-289.940] * (-304.910) [-294.109] (-288.309) (-301.368) -- 0:01:21
      24500 -- (-289.145) (-288.174) (-288.355) [-287.882] * (-291.508) (-306.088) [-288.527] (-298.195) -- 0:01:19
      25000 -- (-288.500) [-292.005] (-298.531) (-288.497) * [-300.829] (-302.052) (-287.547) (-304.101) -- 0:01:18

      Average standard deviation of split frequencies: 0.030493

      25500 -- (-288.690) [-296.309] (-291.516) (-290.647) * (-301.535) (-296.251) [-291.262] (-298.599) -- 0:01:16
      26000 -- (-290.710) (-289.948) (-290.604) [-289.865] * (-299.207) [-298.290] (-295.459) (-295.587) -- 0:01:14
      26500 -- (-290.580) (-289.442) (-290.523) [-290.735] * (-297.026) (-293.532) [-292.714] (-299.428) -- 0:01:13
      27000 -- [-293.444] (-287.959) (-293.909) (-293.594) * (-299.044) [-297.309] (-291.526) (-306.418) -- 0:01:12
      27500 -- (-287.496) [-288.142] (-288.217) (-293.057) * (-305.123) (-305.556) [-291.248] (-301.684) -- 0:01:10
      28000 -- (-293.023) (-288.006) (-290.274) [-290.004] * [-301.477] (-303.120) (-289.551) (-299.344) -- 0:01:09
      28500 -- (-290.193) [-288.492] (-290.562) (-288.976) * (-298.989) [-300.524] (-294.650) (-309.876) -- 0:01:08
      29000 -- (-289.142) (-290.829) [-288.751] (-290.944) * [-296.994] (-295.614) (-290.139) (-303.068) -- 0:01:06
      29500 -- (-288.418) [-291.470] (-289.726) (-290.077) * (-297.273) (-293.935) (-291.242) [-299.380] -- 0:01:05
      30000 -- (-290.850) (-294.438) (-291.440) [-290.706] * (-296.953) (-307.324) (-290.538) [-295.072] -- 0:01:04

      Average standard deviation of split frequencies: 0.033980

      30500 -- [-288.098] (-294.280) (-289.272) (-287.902) * (-295.855) (-301.901) (-288.471) [-300.135] -- 0:01:03
      31000 -- (-293.436) (-290.518) [-288.436] (-289.263) * (-302.711) (-300.464) [-287.594] (-297.321) -- 0:01:02
      31500 -- (-289.438) (-288.475) (-288.963) [-287.587] * (-303.068) (-295.626) (-287.915) [-295.808] -- 0:01:01
      32000 -- [-289.167] (-292.945) (-290.100) (-289.359) * (-296.467) (-297.893) [-288.174] (-296.899) -- 0:01:00
      32500 -- [-289.611] (-290.805) (-288.509) (-290.560) * (-296.197) (-306.417) (-288.468) [-295.625] -- 0:00:59
      33000 -- (-290.209) [-288.987] (-287.832) (-289.087) * (-297.461) (-302.326) [-290.182] (-308.495) -- 0:00:58
      33500 -- [-287.274] (-289.010) (-287.981) (-291.314) * (-302.352) [-296.570] (-287.624) (-297.979) -- 0:00:57
      34000 -- (-290.603) (-288.952) [-289.629] (-288.449) * (-305.067) [-295.495] (-293.763) (-314.366) -- 0:00:56
      34500 -- (-292.055) (-293.896) [-289.694] (-287.832) * (-296.939) [-296.062] (-290.356) (-309.299) -- 0:00:55
      35000 -- (-290.715) (-287.975) (-288.557) [-287.762] * (-308.802) (-296.484) [-289.733] (-299.023) -- 0:00:55

      Average standard deviation of split frequencies: 0.033770

      35500 -- (-290.797) (-290.904) [-288.410] (-288.735) * [-301.567] (-296.268) (-290.236) (-293.415) -- 0:00:54
      36000 -- (-290.864) (-291.281) [-289.628] (-289.524) * [-294.848] (-304.497) (-288.595) (-287.955) -- 0:00:53
      36500 -- [-289.044] (-288.435) (-289.481) (-292.041) * (-301.691) (-306.130) [-288.892] (-290.055) -- 0:00:52
      37000 -- [-288.948] (-287.493) (-291.991) (-289.098) * [-296.361] (-299.990) (-291.509) (-287.693) -- 0:00:52
      37500 -- (-293.653) (-290.941) (-290.042) [-288.399] * (-299.953) (-302.485) (-291.052) [-288.207] -- 0:00:51
      38000 -- (-287.620) [-290.117] (-292.285) (-290.084) * [-302.450] (-311.887) (-289.644) (-290.312) -- 0:00:50
      38500 -- [-288.930] (-288.561) (-289.450) (-290.137) * (-303.534) (-300.588) (-288.851) [-288.670] -- 0:00:49
      39000 -- [-290.311] (-290.421) (-288.034) (-290.960) * (-297.330) (-297.709) (-288.452) [-288.057] -- 0:00:49
      39500 -- [-293.204] (-290.498) (-290.953) (-290.225) * [-293.632] (-296.756) (-290.668) (-288.777) -- 0:01:12
      40000 -- [-290.836] (-289.734) (-290.570) (-289.452) * [-294.819] (-310.496) (-289.259) (-288.227) -- 0:01:12

      Average standard deviation of split frequencies: 0.034166

      40500 -- (-289.679) (-289.911) (-292.947) [-288.947] * [-294.973] (-312.951) (-289.525) (-291.582) -- 0:01:11
      41000 -- [-289.949] (-289.040) (-290.788) (-289.073) * (-307.278) (-299.018) (-288.729) [-288.408] -- 0:01:10
      41500 -- [-290.070] (-289.584) (-291.342) (-288.973) * (-303.175) (-287.954) [-290.108] (-292.720) -- 0:01:09
      42000 -- (-287.818) [-287.511] (-289.523) (-288.488) * [-297.433] (-289.211) (-287.921) (-290.226) -- 0:01:08
      42500 -- [-287.941] (-288.414) (-287.196) (-288.077) * (-297.394) (-288.260) [-290.865] (-293.087) -- 0:01:07
      43000 -- [-293.224] (-288.902) (-287.844) (-288.680) * (-300.235) (-290.216) (-293.050) [-294.198] -- 0:01:06
      43500 -- (-288.847) (-289.372) (-289.576) [-289.827] * (-300.263) [-291.047] (-292.329) (-288.817) -- 0:01:05
      44000 -- [-290.451] (-287.928) (-294.913) (-289.495) * [-295.101] (-293.041) (-292.814) (-289.882) -- 0:01:05
      44500 -- (-289.496) (-288.556) (-289.526) [-287.899] * (-295.925) (-288.234) (-293.759) [-288.608] -- 0:01:04
      45000 -- [-289.556] (-291.498) (-289.405) (-288.828) * (-298.513) [-291.109] (-292.051) (-288.326) -- 0:01:03

      Average standard deviation of split frequencies: 0.038834

      45500 -- (-287.327) (-288.589) (-289.426) [-291.454] * (-297.455) [-287.805] (-289.123) (-290.513) -- 0:01:02
      46000 -- (-292.437) [-289.579] (-292.428) (-289.096) * [-299.893] (-292.797) (-292.001) (-288.686) -- 0:01:02
      46500 -- [-290.000] (-288.646) (-292.713) (-291.702) * (-297.470) [-287.670] (-288.027) (-289.490) -- 0:01:01
      47000 -- (-290.082) (-292.001) (-288.925) [-289.104] * (-299.179) [-288.940] (-288.683) (-287.607) -- 0:01:00
      47500 -- (-289.298) (-291.360) (-289.961) [-291.050] * (-300.517) [-287.717] (-287.582) (-289.000) -- 0:01:00
      48000 -- (-289.349) [-291.470] (-292.376) (-288.586) * (-298.037) (-290.992) (-289.909) [-287.654] -- 0:00:59
      48500 -- (-289.248) (-291.993) [-289.318] (-287.872) * (-291.665) (-292.325) [-287.759] (-289.306) -- 0:00:58
      49000 -- (-290.478) (-290.532) (-288.488) [-289.604] * (-300.362) [-290.445] (-293.632) (-292.135) -- 0:00:58
      49500 -- (-289.207) [-290.095] (-287.307) (-289.328) * [-305.710] (-288.825) (-287.792) (-288.931) -- 0:00:57
      50000 -- (-288.995) [-291.865] (-291.101) (-288.954) * (-292.620) (-293.157) [-288.900] (-292.868) -- 0:00:57

      Average standard deviation of split frequencies: 0.039175

      50500 -- (-288.110) [-288.979] (-288.349) (-291.067) * (-295.928) (-289.299) [-289.673] (-289.356) -- 0:00:56
      51000 -- (-290.799) [-287.870] (-288.425) (-295.072) * (-301.971) [-290.592] (-288.435) (-288.700) -- 0:00:55
      51500 -- [-290.876] (-292.538) (-289.112) (-293.822) * (-297.105) [-289.153] (-290.189) (-287.280) -- 0:00:55
      52000 -- (-287.725) [-288.400] (-288.895) (-291.722) * [-299.478] (-289.856) (-288.320) (-289.618) -- 0:00:54
      52500 -- (-287.774) [-291.910] (-288.670) (-287.963) * (-320.430) (-289.048) (-292.458) [-291.486] -- 0:00:54
      53000 -- (-293.061) [-290.022] (-288.252) (-287.980) * (-311.844) [-290.971] (-288.574) (-294.071) -- 0:00:53
      53500 -- (-291.654) [-290.465] (-289.508) (-289.576) * (-298.848) [-289.823] (-288.409) (-290.880) -- 0:00:53
      54000 -- [-288.616] (-291.206) (-291.636) (-289.873) * [-288.851] (-291.525) (-288.186) (-288.440) -- 0:00:52
      54500 -- (-292.761) (-291.458) [-288.088] (-291.065) * (-298.486) (-289.189) (-289.094) [-289.600] -- 0:00:52
      55000 -- (-290.758) (-289.843) [-290.513] (-288.268) * (-300.923) [-289.854] (-288.672) (-288.934) -- 0:00:51

      Average standard deviation of split frequencies: 0.038102

      55500 -- (-291.841) (-290.305) [-291.674] (-290.389) * (-301.022) [-291.601] (-289.877) (-293.927) -- 0:00:51
      56000 -- [-289.935] (-289.338) (-290.461) (-290.031) * (-291.628) [-288.962] (-288.939) (-289.908) -- 0:00:50
      56500 -- (-288.891) (-291.513) (-288.150) [-288.922] * [-288.142] (-289.057) (-290.965) (-291.504) -- 0:01:06
      57000 -- (-289.243) (-290.630) (-292.693) [-287.900] * (-288.135) [-288.061] (-290.395) (-290.240) -- 0:01:06
      57500 -- (-289.441) (-289.760) (-292.651) [-290.100] * [-289.043] (-287.742) (-293.565) (-287.718) -- 0:01:05
      58000 -- (-288.697) [-290.330] (-289.569) (-288.252) * (-290.567) [-289.178] (-291.345) (-287.318) -- 0:01:04
      58500 -- (-287.257) (-288.165) (-296.248) [-288.851] * [-289.084] (-291.069) (-291.086) (-288.768) -- 0:01:04
      59000 -- (-287.869) (-288.334) [-287.871] (-288.562) * (-288.278) (-288.300) (-290.004) [-287.605] -- 0:01:03
      59500 -- [-290.397] (-288.591) (-292.801) (-292.586) * (-289.206) (-290.993) (-287.501) [-287.994] -- 0:01:03
      60000 -- [-288.555] (-289.700) (-287.445) (-290.250) * [-288.496] (-287.983) (-290.456) (-290.863) -- 0:01:02

      Average standard deviation of split frequencies: 0.042533

      60500 -- (-287.416) (-288.944) [-289.737] (-290.436) * (-289.778) (-287.836) [-289.497] (-295.207) -- 0:01:02
      61000 -- (-287.975) (-289.887) (-289.333) [-293.598] * (-288.336) (-288.419) (-287.655) [-288.944] -- 0:01:01
      61500 -- [-290.850] (-289.285) (-291.310) (-295.367) * (-287.578) (-290.445) [-290.168] (-290.111) -- 0:01:01
      62000 -- [-291.096] (-290.930) (-288.183) (-294.000) * [-289.202] (-289.297) (-287.817) (-288.406) -- 0:01:00
      62500 -- [-288.403] (-292.437) (-288.891) (-287.673) * (-287.886) (-290.073) [-291.200] (-290.177) -- 0:01:00
      63000 -- (-288.425) (-291.049) [-289.537] (-289.338) * (-292.269) (-289.847) [-289.197] (-292.236) -- 0:00:59
      63500 -- [-288.273] (-290.442) (-293.151) (-287.662) * (-290.844) (-288.347) (-290.814) [-287.734] -- 0:00:58
      64000 -- (-289.671) (-292.919) [-289.369] (-288.666) * (-292.351) [-289.076] (-290.715) (-288.069) -- 0:00:58
      64500 -- (-289.424) [-291.373] (-294.814) (-289.309) * [-288.179] (-289.574) (-291.088) (-289.635) -- 0:00:58
      65000 -- (-292.197) [-289.007] (-292.077) (-294.598) * (-289.842) [-289.986] (-289.169) (-290.978) -- 0:00:57

      Average standard deviation of split frequencies: 0.037753

      65500 -- (-290.148) (-292.103) (-290.380) [-288.323] * [-288.008] (-293.442) (-289.011) (-291.206) -- 0:00:57
      66000 -- [-288.586] (-291.238) (-291.787) (-289.718) * [-287.303] (-292.272) (-289.841) (-288.963) -- 0:00:56
      66500 -- (-289.510) [-290.596] (-292.573) (-292.826) * (-288.763) [-287.872] (-289.106) (-289.089) -- 0:00:56
      67000 -- (-292.499) [-289.428] (-288.305) (-292.553) * (-288.432) [-287.795] (-288.059) (-289.720) -- 0:00:55
      67500 -- (-292.303) (-289.979) (-289.435) [-289.162] * (-288.328) (-287.917) [-287.954] (-289.546) -- 0:00:55
      68000 -- (-289.341) [-288.725] (-290.128) (-290.777) * (-288.999) [-287.321] (-290.391) (-290.129) -- 0:00:54
      68500 -- (-287.866) (-290.564) [-288.445] (-289.339) * [-288.340] (-292.788) (-287.664) (-289.212) -- 0:00:54
      69000 -- (-289.183) (-289.527) (-290.330) [-288.668] * [-289.608] (-294.780) (-291.086) (-289.162) -- 0:00:53
      69500 -- [-288.700] (-287.767) (-291.207) (-287.970) * [-289.228] (-287.876) (-289.916) (-290.343) -- 0:00:53
      70000 -- (-290.267) (-288.643) (-295.766) [-289.021] * (-290.646) [-292.133] (-288.882) (-288.994) -- 0:00:53

      Average standard deviation of split frequencies: 0.038024

      70500 -- (-290.950) (-288.449) (-289.935) [-289.007] * (-294.225) (-290.044) (-289.608) [-287.387] -- 0:00:52
      71000 -- (-294.412) [-289.200] (-291.869) (-290.079) * (-288.741) [-289.039] (-289.002) (-287.522) -- 0:00:52
      71500 -- (-292.008) (-287.776) (-290.902) [-290.177] * (-289.774) [-292.505] (-290.906) (-288.270) -- 0:00:51
      72000 -- (-288.872) [-289.183] (-287.919) (-288.072) * (-290.352) (-290.345) [-289.794] (-289.623) -- 0:00:51
      72500 -- (-288.915) (-289.123) [-287.624] (-291.376) * [-290.013] (-287.389) (-288.873) (-290.095) -- 0:00:51
      73000 -- (-289.348) (-291.226) (-287.428) [-291.311] * (-290.514) (-291.414) [-289.406] (-295.263) -- 0:00:50
      73500 -- (-289.552) (-289.128) (-287.443) [-289.092] * (-287.863) (-287.523) (-290.706) [-289.897] -- 0:00:50
      74000 -- (-289.718) (-289.528) [-288.876] (-289.291) * (-290.221) [-290.920] (-290.687) (-291.255) -- 0:01:02
      74500 -- [-288.223] (-290.927) (-288.195) (-289.010) * (-288.867) (-288.850) [-287.233] (-294.213) -- 0:01:02
      75000 -- (-290.570) [-292.360] (-287.137) (-291.828) * [-290.716] (-292.128) (-288.291) (-288.165) -- 0:01:01

      Average standard deviation of split frequencies: 0.038196

      75500 -- [-289.239] (-288.596) (-287.308) (-288.531) * (-288.156) (-293.105) (-288.638) [-291.217] -- 0:01:01
      76000 -- (-288.952) (-289.143) [-287.142] (-290.887) * (-287.246) [-291.773] (-287.729) (-290.986) -- 0:01:00
      76500 -- (-289.545) (-288.839) [-290.341] (-288.517) * (-289.398) (-290.273) (-289.941) [-290.274] -- 0:01:00
      77000 -- [-290.024] (-289.889) (-288.388) (-291.103) * (-289.913) [-288.181] (-287.969) (-293.149) -- 0:00:59
      77500 -- [-290.012] (-288.795) (-289.882) (-295.141) * (-292.292) [-288.366] (-290.263) (-290.637) -- 0:00:59
      78000 -- [-288.728] (-290.065) (-294.608) (-293.112) * (-289.921) [-290.965] (-288.832) (-292.029) -- 0:00:59
      78500 -- (-291.245) [-289.917] (-288.984) (-293.316) * (-288.790) (-295.589) [-290.412] (-290.285) -- 0:00:58
      79000 -- (-288.670) (-288.872) [-290.886] (-290.068) * (-293.734) (-296.584) (-288.575) [-289.797] -- 0:00:58
      79500 -- [-288.972] (-291.008) (-294.328) (-288.233) * (-292.607) [-290.382] (-288.280) (-288.195) -- 0:00:57
      80000 -- (-292.458) (-294.124) (-289.450) [-288.994] * (-290.179) [-294.075] (-290.656) (-290.779) -- 0:00:57

      Average standard deviation of split frequencies: 0.038844

      80500 -- (-290.825) (-287.718) [-287.203] (-290.970) * (-292.113) (-293.150) (-289.820) [-290.058] -- 0:00:57
      81000 -- (-289.442) [-288.414] (-287.643) (-287.909) * [-289.975] (-290.948) (-289.841) (-290.658) -- 0:00:56
      81500 -- (-288.883) (-288.654) [-290.163] (-290.671) * (-289.498) (-296.254) (-289.969) [-288.447] -- 0:00:56
      82000 -- (-287.904) (-288.961) [-292.259] (-292.793) * (-290.989) (-293.644) (-291.981) [-294.077] -- 0:00:55
      82500 -- [-290.428] (-288.204) (-292.945) (-290.919) * (-290.700) (-292.259) [-288.712] (-288.416) -- 0:00:55
      83000 -- (-290.267) (-288.448) (-291.058) [-288.407] * (-288.446) (-291.688) (-287.775) [-293.485] -- 0:00:55
      83500 -- (-289.081) (-287.359) [-289.391] (-289.218) * (-289.091) (-292.491) [-289.219] (-292.669) -- 0:00:54
      84000 -- [-288.368] (-290.575) (-288.879) (-289.270) * (-288.652) [-288.084] (-288.822) (-295.862) -- 0:00:54
      84500 -- (-289.234) [-290.116] (-288.324) (-290.856) * (-288.810) (-287.812) [-290.268] (-294.671) -- 0:00:54
      85000 -- (-288.759) (-289.478) [-288.623] (-289.924) * (-289.521) [-289.178] (-292.642) (-288.268) -- 0:00:53

      Average standard deviation of split frequencies: 0.033985

      85500 -- (-290.929) (-289.408) (-293.698) [-288.363] * (-292.039) (-288.518) (-291.200) [-287.431] -- 0:00:53
      86000 -- (-289.778) [-287.787] (-289.771) (-287.737) * (-293.071) (-288.716) (-290.954) [-288.157] -- 0:00:53
      86500 -- (-288.707) (-288.756) [-292.014] (-287.561) * [-290.449] (-288.689) (-288.654) (-289.914) -- 0:00:52
      87000 -- (-287.404) (-290.632) [-287.884] (-288.369) * (-290.010) [-291.064] (-292.811) (-293.452) -- 0:00:52
      87500 -- (-294.488) (-289.448) [-288.271] (-289.606) * (-287.742) [-290.607] (-297.536) (-290.920) -- 0:00:52
      88000 -- (-292.637) (-289.437) (-288.974) [-289.193] * [-288.493] (-289.529) (-289.391) (-291.673) -- 0:00:51
      88500 -- (-290.024) (-292.016) [-290.886] (-288.895) * (-287.779) (-288.173) (-291.115) [-291.490] -- 0:00:51
      89000 -- (-289.449) (-290.716) (-290.575) [-289.197] * (-290.543) [-288.248] (-290.809) (-291.927) -- 0:00:51
      89500 -- (-290.007) [-288.311] (-291.862) (-291.377) * (-290.778) (-293.976) [-290.161] (-291.272) -- 0:00:50
      90000 -- (-290.176) (-289.854) [-289.184] (-288.499) * [-288.248] (-292.049) (-287.935) (-288.986) -- 0:00:50

      Average standard deviation of split frequencies: 0.033659

      90500 -- (-289.808) (-292.633) [-293.182] (-287.931) * [-287.812] (-290.435) (-288.681) (-288.363) -- 0:00:50
      91000 -- (-289.456) (-290.619) (-290.724) [-292.301] * [-287.762] (-291.872) (-292.026) (-288.829) -- 0:00:59
      91500 -- [-288.119] (-289.708) (-290.165) (-291.636) * [-288.671] (-291.147) (-292.336) (-292.417) -- 0:00:59
      92000 -- (-287.838) [-287.626] (-292.242) (-293.753) * (-290.512) (-288.927) (-288.924) [-287.328] -- 0:00:59
      92500 -- (-288.498) [-291.358] (-289.746) (-289.674) * (-289.516) [-290.839] (-289.137) (-287.825) -- 0:00:58
      93000 -- (-287.646) (-290.310) (-289.905) [-289.445] * (-291.373) (-293.025) (-289.612) [-288.822] -- 0:00:58
      93500 -- [-288.582] (-290.059) (-288.517) (-291.606) * (-290.068) (-290.169) [-292.439] (-288.252) -- 0:00:58
      94000 -- [-288.186] (-289.803) (-288.661) (-290.987) * [-288.948] (-292.025) (-292.527) (-292.984) -- 0:00:57
      94500 -- (-289.622) (-289.787) (-292.627) [-289.046] * (-288.176) [-291.874] (-292.047) (-287.637) -- 0:00:57
      95000 -- (-287.973) [-290.911] (-288.416) (-290.880) * [-289.724] (-290.595) (-287.170) (-289.199) -- 0:00:57

      Average standard deviation of split frequencies: 0.028946

      95500 -- (-291.671) [-289.409] (-288.883) (-291.119) * (-290.750) [-292.023] (-289.765) (-289.061) -- 0:00:56
      96000 -- (-288.344) [-289.674] (-292.198) (-293.783) * [-287.515] (-288.748) (-291.836) (-289.056) -- 0:00:56
      96500 -- (-289.991) (-287.652) (-288.291) [-289.285] * (-288.314) (-295.933) [-290.864] (-287.511) -- 0:00:56
      97000 -- [-292.284] (-290.457) (-289.115) (-289.936) * (-290.987) [-289.136] (-291.501) (-290.291) -- 0:00:55
      97500 -- (-288.247) [-295.907] (-296.751) (-289.145) * [-288.670] (-291.911) (-289.660) (-288.588) -- 0:00:55
      98000 -- [-290.439] (-288.914) (-293.997) (-287.633) * (-291.998) [-290.131] (-288.080) (-288.590) -- 0:00:55
      98500 -- (-291.363) (-289.950) [-292.109] (-290.287) * [-288.175] (-287.330) (-288.804) (-290.160) -- 0:00:54
      99000 -- (-288.940) (-290.214) (-289.066) [-289.103] * (-288.708) (-289.988) [-289.985] (-288.485) -- 0:00:54
      99500 -- [-287.388] (-289.935) (-290.370) (-290.792) * [-288.281] (-290.858) (-294.050) (-289.196) -- 0:00:54
      100000 -- [-289.620] (-287.473) (-289.121) (-288.439) * (-290.281) [-291.442] (-291.097) (-288.035) -- 0:00:54

      Average standard deviation of split frequencies: 0.028923

      100500 -- (-289.625) (-289.015) [-288.016] (-287.832) * [-289.911] (-290.650) (-290.357) (-293.541) -- 0:00:53
      101000 -- (-291.455) (-289.090) (-291.162) [-288.630] * (-289.265) (-289.285) (-290.304) [-287.882] -- 0:00:53
      101500 -- [-289.680] (-287.744) (-289.525) (-288.972) * (-291.849) (-288.952) [-290.051] (-287.200) -- 0:00:53
      102000 -- [-289.153] (-291.754) (-288.830) (-288.374) * (-288.786) [-290.721] (-289.665) (-288.663) -- 0:00:52
      102500 -- [-287.673] (-295.851) (-288.482) (-287.942) * (-287.859) (-289.863) (-288.047) [-288.683] -- 0:00:52
      103000 -- (-288.181) [-292.969] (-288.336) (-290.253) * (-288.384) [-296.496] (-287.858) (-290.958) -- 0:00:52
      103500 -- (-289.312) [-289.681] (-290.939) (-288.659) * (-293.121) (-294.711) (-288.989) [-289.919] -- 0:00:51
      104000 -- (-288.278) (-291.923) (-290.386) [-288.385] * [-289.245] (-292.151) (-292.312) (-287.653) -- 0:00:51
      104500 -- (-291.991) [-289.350] (-292.040) (-290.292) * (-291.709) [-287.082] (-291.971) (-293.446) -- 0:00:51
      105000 -- (-290.882) (-290.445) (-296.127) [-288.756] * (-291.456) [-288.846] (-290.931) (-294.295) -- 0:00:51

      Average standard deviation of split frequencies: 0.024577

      105500 -- (-290.717) [-291.125] (-287.815) (-292.168) * (-289.540) (-289.044) [-289.325] (-290.607) -- 0:00:50
      106000 -- (-287.758) (-288.027) (-288.565) [-287.525] * (-287.593) [-291.006] (-287.393) (-289.673) -- 0:00:50
      106500 -- (-289.350) (-288.097) (-288.567) [-290.993] * (-289.709) (-294.217) (-288.148) [-287.830] -- 0:00:50
      107000 -- [-287.944] (-287.865) (-289.859) (-290.649) * (-291.439) [-290.686] (-287.931) (-288.103) -- 0:00:50
      107500 -- (-288.402) (-292.061) [-290.785] (-288.246) * (-288.718) (-290.686) [-289.070] (-294.867) -- 0:00:49
      108000 -- (-288.047) (-295.383) [-287.915] (-288.994) * (-290.145) (-289.705) [-288.843] (-294.109) -- 0:00:57
      108500 -- [-287.911] (-293.391) (-287.732) (-291.482) * (-292.104) [-289.915] (-291.250) (-289.006) -- 0:00:57
      109000 -- (-290.143) (-295.455) (-290.551) [-288.768] * [-289.880] (-289.589) (-291.292) (-291.426) -- 0:00:57
      109500 -- (-289.171) [-290.430] (-288.782) (-289.443) * (-289.012) (-293.883) (-288.502) [-288.980] -- 0:00:56
      110000 -- (-287.639) (-289.203) [-289.907] (-288.368) * (-290.603) (-296.586) [-291.088] (-290.696) -- 0:00:56

      Average standard deviation of split frequencies: 0.024437

      110500 -- [-287.948] (-288.139) (-288.832) (-288.892) * (-287.378) (-288.708) (-291.484) [-291.202] -- 0:00:56
      111000 -- (-288.540) (-290.682) [-288.980] (-290.914) * (-288.150) (-288.183) (-289.969) [-288.314] -- 0:00:56
      111500 -- [-289.687] (-290.981) (-288.843) (-288.499) * (-289.884) [-288.000] (-293.057) (-290.897) -- 0:00:55
      112000 -- (-293.724) (-289.362) (-287.162) [-288.437] * [-289.082] (-293.354) (-294.756) (-291.693) -- 0:00:55
      112500 -- (-288.810) (-289.439) [-288.408] (-288.584) * (-288.518) [-289.698] (-293.213) (-290.426) -- 0:00:55
      113000 -- (-289.714) (-290.764) [-287.934] (-291.010) * [-288.375] (-288.796) (-291.403) (-291.507) -- 0:00:54
      113500 -- (-287.965) (-289.840) (-292.075) [-290.585] * (-292.599) (-289.947) [-291.051] (-288.184) -- 0:00:54
      114000 -- [-289.318] (-288.956) (-289.626) (-290.153) * (-290.558) (-288.749) [-288.801] (-289.563) -- 0:00:54
      114500 -- [-289.575] (-288.692) (-290.239) (-288.546) * (-290.471) (-292.239) (-291.527) [-290.064] -- 0:00:54
      115000 -- (-289.909) (-287.662) (-288.890) [-287.192] * [-288.464] (-292.110) (-288.560) (-289.381) -- 0:00:53

      Average standard deviation of split frequencies: 0.024383

      115500 -- (-290.673) (-288.303) [-292.336] (-289.998) * (-288.457) (-296.952) (-288.121) [-290.108] -- 0:00:53
      116000 -- (-290.479) (-288.932) (-289.777) [-289.777] * (-289.115) [-288.160] (-296.179) (-293.551) -- 0:00:53
      116500 -- (-289.960) (-293.548) [-287.821] (-288.265) * (-290.127) (-287.653) [-291.838] (-290.180) -- 0:00:53
      117000 -- (-289.353) [-289.651] (-289.866) (-291.754) * (-288.308) [-288.292] (-290.010) (-289.770) -- 0:00:52
      117500 -- (-293.410) (-288.650) [-288.060] (-290.961) * (-288.397) (-290.168) [-287.539] (-290.948) -- 0:00:52
      118000 -- [-292.218] (-290.610) (-287.825) (-291.441) * (-289.797) [-287.743] (-289.014) (-288.390) -- 0:00:52
      118500 -- (-290.404) (-289.242) (-288.339) [-290.142] * (-288.933) (-289.723) (-287.633) [-289.309] -- 0:00:52
      119000 -- [-292.057] (-292.409) (-289.295) (-290.096) * (-289.327) (-295.131) (-288.263) [-290.263] -- 0:00:51
      119500 -- (-287.970) [-289.970] (-288.762) (-293.016) * (-293.026) [-290.700] (-290.449) (-291.339) -- 0:00:51
      120000 -- (-292.013) [-289.700] (-289.389) (-290.156) * (-289.780) (-289.869) (-289.201) [-290.060] -- 0:00:51

      Average standard deviation of split frequencies: 0.024674

      120500 -- (-290.931) [-290.060] (-292.030) (-288.180) * (-292.626) (-291.453) [-288.611] (-288.992) -- 0:00:51
      121000 -- (-290.807) [-291.298] (-295.558) (-292.214) * (-289.810) [-290.866] (-291.052) (-287.860) -- 0:00:50
      121500 -- (-289.922) (-293.214) (-293.950) [-289.134] * (-294.179) [-289.622] (-288.410) (-292.507) -- 0:00:50
      122000 -- (-289.002) (-291.221) [-288.857] (-294.435) * (-290.227) (-288.247) [-289.586] (-294.372) -- 0:00:50
      122500 -- (-289.634) [-289.749] (-288.231) (-290.277) * (-288.227) (-297.524) (-293.911) [-291.781] -- 0:00:50
      123000 -- (-293.306) (-288.831) (-289.872) [-289.061] * [-287.851] (-297.607) (-288.594) (-295.880) -- 0:00:49
      123500 -- (-288.853) (-292.277) (-290.156) [-290.772] * [-288.611] (-289.997) (-291.115) (-291.184) -- 0:00:49
      124000 -- [-290.205] (-289.449) (-293.228) (-290.235) * [-289.601] (-288.928) (-291.230) (-288.747) -- 0:00:49
      124500 -- [-289.832] (-293.054) (-288.658) (-289.055) * (-290.647) (-288.946) [-289.100] (-288.658) -- 0:00:49
      125000 -- [-290.169] (-290.315) (-288.758) (-287.933) * (-292.665) (-288.320) (-289.498) [-288.323] -- 0:00:49

      Average standard deviation of split frequencies: 0.023570

      125500 -- (-288.885) (-288.606) [-287.876] (-287.304) * (-292.659) (-290.579) [-289.737] (-287.805) -- 0:00:55
      126000 -- (-289.401) [-289.580] (-290.561) (-289.753) * (-287.779) [-290.922] (-289.179) (-289.095) -- 0:00:55
      126500 -- (-289.252) (-289.865) [-289.796] (-287.445) * (-288.851) (-290.524) (-289.025) [-287.934] -- 0:00:55
      127000 -- (-291.430) (-289.538) (-290.637) [-289.361] * (-289.338) (-288.461) [-289.326] (-294.239) -- 0:00:54
      127500 -- (-292.543) [-292.403] (-296.194) (-289.256) * [-291.184] (-288.292) (-290.847) (-292.826) -- 0:00:54
      128000 -- (-290.390) [-288.086] (-289.518) (-288.554) * (-293.047) (-289.042) (-293.489) [-290.051] -- 0:00:54
      128500 -- (-291.591) (-292.252) [-290.656] (-288.316) * (-290.320) (-289.421) [-289.392] (-288.234) -- 0:00:54
      129000 -- (-290.476) (-288.219) [-288.482] (-287.907) * (-291.375) (-288.650) [-290.617] (-288.695) -- 0:00:54
      129500 -- (-290.897) (-288.079) (-290.792) [-287.586] * [-292.676] (-288.641) (-288.751) (-295.429) -- 0:00:53
      130000 -- [-291.548] (-288.222) (-290.522) (-288.881) * (-298.694) (-288.335) (-290.701) [-288.917] -- 0:00:53

      Average standard deviation of split frequencies: 0.022026

      130500 -- (-287.803) (-290.738) (-290.299) [-289.352] * (-292.092) (-290.008) [-287.808] (-291.157) -- 0:00:53
      131000 -- (-289.870) [-292.413] (-288.366) (-288.816) * (-292.588) (-293.560) (-289.514) [-288.347] -- 0:00:53
      131500 -- (-291.030) (-289.480) (-291.315) [-291.328] * (-290.190) [-288.128] (-291.526) (-291.772) -- 0:00:52
      132000 -- [-289.285] (-289.209) (-290.038) (-288.740) * (-288.676) (-288.520) [-288.511] (-287.852) -- 0:00:52
      132500 -- (-290.041) (-289.240) [-290.849] (-289.579) * (-292.789) (-289.074) [-290.105] (-289.378) -- 0:00:52
      133000 -- (-293.188) [-288.285] (-288.109) (-290.192) * (-289.943) (-289.054) (-291.378) [-290.048] -- 0:00:52
      133500 -- (-288.595) (-289.851) (-290.708) [-288.152] * (-290.490) (-292.296) (-290.037) [-290.862] -- 0:00:51
      134000 -- (-289.706) (-289.175) (-288.175) [-289.450] * (-290.627) [-291.767] (-288.262) (-292.134) -- 0:00:51
      134500 -- (-287.762) [-290.176] (-293.042) (-289.728) * (-291.532) (-289.899) (-288.595) [-288.046] -- 0:00:51
      135000 -- (-290.244) (-288.110) (-290.662) [-287.612] * (-295.079) [-288.131] (-289.310) (-290.133) -- 0:00:51

      Average standard deviation of split frequencies: 0.020797

      135500 -- (-288.323) (-292.378) (-290.737) [-290.420] * [-290.155] (-289.492) (-297.470) (-288.270) -- 0:00:51
      136000 -- (-288.591) [-291.517] (-289.333) (-287.886) * [-288.308] (-289.244) (-288.070) (-288.171) -- 0:00:50
      136500 -- (-288.586) (-294.067) [-289.683] (-290.419) * (-290.932) [-290.201] (-288.422) (-289.126) -- 0:00:50
      137000 -- (-288.678) (-289.824) [-289.108] (-290.481) * [-287.803] (-287.751) (-288.628) (-292.176) -- 0:00:50
      137500 -- (-289.669) (-293.616) [-287.442] (-291.813) * (-288.325) (-287.847) [-288.487] (-290.596) -- 0:00:50
      138000 -- [-290.207] (-289.386) (-287.316) (-288.980) * (-291.479) [-288.541] (-287.416) (-289.831) -- 0:00:49
      138500 -- (-289.393) (-288.811) [-288.348] (-292.395) * (-291.297) (-292.825) (-287.252) [-288.161] -- 0:00:49
      139000 -- [-288.075] (-290.449) (-293.312) (-292.093) * (-292.164) (-291.836) (-288.165) [-288.540] -- 0:00:49
      139500 -- [-289.617] (-289.731) (-288.334) (-290.037) * [-288.384] (-288.597) (-288.528) (-292.146) -- 0:00:49
      140000 -- [-288.382] (-291.048) (-288.146) (-290.393) * (-293.663) (-291.481) [-288.168] (-288.274) -- 0:00:49

      Average standard deviation of split frequencies: 0.017687

      140500 -- (-289.648) [-291.440] (-292.469) (-289.127) * (-288.791) (-290.814) [-288.357] (-292.114) -- 0:00:48
      141000 -- (-288.579) (-289.875) [-287.220] (-290.208) * (-289.677) [-288.269] (-292.732) (-289.748) -- 0:00:48
      141500 -- (-289.707) (-287.668) [-288.119] (-287.612) * (-289.392) [-289.638] (-291.737) (-289.356) -- 0:00:48
      142000 -- (-288.724) (-288.577) [-288.228] (-288.399) * (-291.683) [-291.520] (-289.962) (-287.797) -- 0:00:48
      142500 -- (-287.695) (-289.419) (-289.497) [-288.138] * (-296.845) (-290.950) [-289.790] (-289.270) -- 0:00:54
      143000 -- (-291.334) [-287.917] (-287.455) (-291.503) * (-294.431) (-290.747) [-289.422] (-291.695) -- 0:00:53
      143500 -- [-287.853] (-289.360) (-288.923) (-288.499) * (-290.549) [-288.033] (-291.500) (-289.267) -- 0:00:53
      144000 -- (-288.826) [-289.564] (-290.341) (-288.682) * [-290.427] (-293.807) (-290.478) (-291.761) -- 0:00:53
      144500 -- (-287.486) [-287.382] (-288.244) (-288.042) * [-288.932] (-288.579) (-287.836) (-288.245) -- 0:00:53
      145000 -- [-287.726] (-291.139) (-288.957) (-289.631) * (-289.586) (-289.132) (-289.757) [-291.167] -- 0:00:53

      Average standard deviation of split frequencies: 0.018523

      145500 -- (-290.318) (-288.362) [-288.575] (-292.605) * (-288.297) [-289.370] (-291.460) (-291.252) -- 0:00:52
      146000 -- (-289.500) [-289.220] (-291.725) (-288.150) * [-287.512] (-290.243) (-291.785) (-289.940) -- 0:00:52
      146500 -- (-288.628) (-288.438) (-291.287) [-289.277] * [-291.223] (-287.471) (-288.076) (-292.104) -- 0:00:52
      147000 -- (-287.553) (-289.392) [-287.879] (-288.823) * (-294.434) (-289.521) (-288.728) [-289.100] -- 0:00:52
      147500 -- (-287.891) (-289.109) [-289.225] (-289.721) * (-291.203) [-294.041] (-288.738) (-295.399) -- 0:00:52
      148000 -- (-287.887) (-290.016) (-289.581) [-288.778] * (-287.856) (-291.138) [-288.919] (-289.754) -- 0:00:51
      148500 -- [-289.237] (-288.502) (-290.062) (-288.540) * [-289.031] (-287.591) (-290.941) (-288.880) -- 0:00:51
      149000 -- (-288.668) (-287.987) [-288.158] (-288.814) * (-294.200) (-290.842) [-288.802] (-287.146) -- 0:00:51
      149500 -- (-292.028) (-288.731) [-288.744] (-288.901) * (-290.043) (-290.189) [-290.120] (-287.949) -- 0:00:51
      150000 -- (-289.126) [-288.580] (-289.487) (-290.695) * (-288.294) (-290.608) (-290.546) [-290.637] -- 0:00:51

      Average standard deviation of split frequencies: 0.015973

      150500 -- (-288.509) (-290.939) [-288.123] (-289.557) * (-290.737) (-290.709) [-287.816] (-289.811) -- 0:00:50
      151000 -- (-288.542) (-287.676) [-290.353] (-289.063) * (-288.393) [-290.059] (-289.415) (-289.371) -- 0:00:50
      151500 -- (-289.255) (-288.106) [-288.484] (-289.700) * (-290.598) (-288.422) (-287.954) [-291.119] -- 0:00:50
      152000 -- [-290.120] (-291.328) (-289.615) (-289.604) * (-288.683) (-292.119) (-287.785) [-290.865] -- 0:00:50
      152500 -- [-290.021] (-288.299) (-288.450) (-289.051) * (-290.214) (-290.311) (-291.946) [-290.006] -- 0:00:50
      153000 -- [-288.179] (-287.352) (-291.054) (-294.684) * [-288.328] (-290.243) (-288.008) (-294.438) -- 0:00:49
      153500 -- [-288.912] (-292.213) (-288.590) (-288.156) * (-290.037) (-289.995) (-289.001) [-289.685] -- 0:00:49
      154000 -- (-289.947) (-288.051) [-289.036] (-288.226) * (-289.037) [-289.569] (-291.765) (-293.575) -- 0:00:49
      154500 -- [-288.268] (-289.564) (-287.968) (-288.109) * (-289.701) (-287.962) [-292.452] (-292.996) -- 0:00:49
      155000 -- (-289.365) (-290.442) (-289.366) [-293.824] * (-288.045) (-288.682) (-288.475) [-288.044] -- 0:00:49

      Average standard deviation of split frequencies: 0.015904

      155500 -- (-291.784) (-292.568) (-290.548) [-287.818] * (-288.601) (-292.778) [-290.188] (-290.157) -- 0:00:48
      156000 -- (-288.235) (-291.463) [-289.611] (-287.571) * [-288.780] (-287.756) (-288.129) (-287.929) -- 0:00:48
      156500 -- (-292.898) [-288.578] (-292.595) (-289.365) * [-291.132] (-288.598) (-290.313) (-288.465) -- 0:00:48
      157000 -- (-288.723) [-289.943] (-289.639) (-287.861) * (-288.685) (-289.025) [-290.099] (-288.859) -- 0:00:48
      157500 -- [-290.067] (-289.913) (-288.274) (-292.178) * [-288.226] (-288.254) (-287.722) (-290.451) -- 0:00:48
      158000 -- (-289.598) (-287.430) [-289.668] (-291.364) * [-288.383] (-288.271) (-288.488) (-289.882) -- 0:00:47
      158500 -- (-290.319) (-287.592) (-290.054) [-289.938] * (-291.074) [-289.954] (-287.760) (-292.516) -- 0:00:47
      159000 -- [-289.425] (-289.195) (-288.755) (-289.827) * [-287.700] (-297.606) (-289.043) (-292.789) -- 0:00:47
      159500 -- [-290.179] (-290.608) (-295.224) (-288.476) * [-289.404] (-291.196) (-292.640) (-295.514) -- 0:00:47
      160000 -- (-290.047) [-288.566] (-288.151) (-289.890) * (-290.356) [-288.494] (-297.165) (-290.527) -- 0:00:52

      Average standard deviation of split frequencies: 0.015134

      160500 -- (-287.488) (-290.273) [-287.444] (-288.694) * (-289.580) (-288.374) (-290.561) [-290.900] -- 0:00:52
      161000 -- (-289.592) (-288.106) (-288.411) [-290.596] * [-288.629] (-288.280) (-294.700) (-290.636) -- 0:00:52
      161500 -- (-290.672) (-290.699) [-291.305] (-292.495) * (-287.345) [-288.809] (-290.499) (-287.851) -- 0:00:51
      162000 -- [-288.928] (-290.104) (-289.310) (-290.064) * (-293.080) [-289.244] (-290.587) (-287.470) -- 0:00:51
      162500 -- (-288.702) [-289.236] (-292.498) (-291.934) * (-293.175) [-288.153] (-288.965) (-289.802) -- 0:00:51
      163000 -- [-288.990] (-291.728) (-294.417) (-287.953) * (-292.626) (-290.056) (-293.331) [-287.776] -- 0:00:51
      163500 -- (-289.821) [-290.244] (-293.296) (-289.644) * [-292.476] (-290.296) (-290.777) (-288.163) -- 0:00:51
      164000 -- (-289.852) [-288.279] (-291.900) (-288.815) * (-297.574) [-294.139] (-288.445) (-291.940) -- 0:00:50
      164500 -- (-288.581) [-291.055] (-292.122) (-291.658) * (-292.118) [-288.056] (-289.367) (-289.044) -- 0:00:50
      165000 -- [-287.616] (-293.112) (-292.803) (-289.581) * (-288.450) (-288.548) (-289.403) [-288.597] -- 0:00:50

      Average standard deviation of split frequencies: 0.014946

      165500 -- (-290.124) (-288.547) (-287.674) [-288.079] * (-288.928) (-287.757) [-290.105] (-290.600) -- 0:00:50
      166000 -- (-290.796) (-288.588) [-287.564] (-291.630) * (-287.151) (-291.927) [-287.474] (-291.426) -- 0:00:50
      166500 -- (-293.001) (-290.500) [-289.072] (-291.611) * (-291.374) (-291.492) [-290.416] (-292.708) -- 0:00:50
      167000 -- [-292.331] (-290.902) (-288.454) (-290.042) * [-287.723] (-288.356) (-293.625) (-289.304) -- 0:00:49
      167500 -- (-290.437) [-294.009] (-287.533) (-288.588) * (-292.537) [-288.968] (-289.577) (-288.583) -- 0:00:49
      168000 -- (-292.382) [-289.082] (-290.741) (-287.895) * (-289.548) [-290.015] (-290.103) (-290.066) -- 0:00:49
      168500 -- (-293.789) (-287.196) [-288.438] (-290.839) * (-289.969) (-288.841) (-291.566) [-289.142] -- 0:00:49
      169000 -- (-289.693) (-289.075) [-288.668] (-289.950) * (-290.017) (-288.957) (-291.322) [-288.831] -- 0:00:49
      169500 -- (-289.040) (-290.563) [-287.837] (-294.276) * [-289.019] (-287.464) (-291.998) (-291.108) -- 0:00:48
      170000 -- [-289.430] (-295.523) (-289.069) (-288.045) * [-288.282] (-287.511) (-296.390) (-287.285) -- 0:00:48

      Average standard deviation of split frequencies: 0.013229

      170500 -- [-293.635] (-288.203) (-289.029) (-288.159) * (-288.653) (-287.719) [-289.937] (-289.083) -- 0:00:48
      171000 -- [-289.261] (-290.221) (-290.586) (-289.218) * (-289.867) (-288.790) [-288.438] (-290.959) -- 0:00:48
      171500 -- (-289.644) (-288.857) [-288.349] (-289.848) * (-289.219) (-290.572) (-288.193) [-288.072] -- 0:00:48
      172000 -- [-288.425] (-287.802) (-288.186) (-290.439) * [-287.656] (-291.177) (-289.555) (-290.555) -- 0:00:48
      172500 -- (-287.992) (-288.805) [-289.112] (-289.349) * (-290.091) [-291.068] (-293.129) (-288.873) -- 0:00:47
      173000 -- (-289.661) (-288.591) [-288.351] (-296.899) * (-292.083) (-289.894) (-290.290) [-290.438] -- 0:00:47
      173500 -- [-289.242] (-290.278) (-289.453) (-290.376) * (-292.013) [-289.700] (-289.388) (-290.113) -- 0:00:47
      174000 -- (-288.155) (-290.545) [-290.694] (-288.979) * (-288.742) (-291.283) (-289.176) [-291.995] -- 0:00:47
      174500 -- (-293.715) [-287.929] (-289.780) (-287.974) * (-292.854) [-288.553] (-288.744) (-288.899) -- 0:00:47
      175000 -- (-288.601) (-289.214) (-293.582) [-287.669] * [-288.388] (-289.096) (-290.112) (-292.097) -- 0:00:47

      Average standard deviation of split frequencies: 0.014379

      175500 -- [-290.680] (-288.611) (-290.768) (-288.223) * [-288.499] (-291.700) (-287.837) (-290.033) -- 0:00:46
      176000 -- (-291.277) (-288.293) (-296.945) [-287.655] * [-288.306] (-293.250) (-288.538) (-288.314) -- 0:00:46
      176500 -- (-288.273) (-296.268) (-289.779) [-288.777] * (-290.196) (-290.965) (-288.715) [-288.418] -- 0:00:46
      177000 -- [-290.921] (-293.613) (-289.337) (-291.196) * [-289.459] (-287.782) (-292.347) (-295.017) -- 0:00:51
      177500 -- (-288.255) [-289.721] (-289.317) (-290.857) * (-292.259) (-287.590) [-288.310] (-293.280) -- 0:00:50
      178000 -- (-288.861) (-292.452) [-291.298] (-289.629) * (-290.766) [-288.769] (-289.879) (-288.005) -- 0:00:50
      178500 -- (-294.418) [-291.235] (-290.619) (-289.817) * (-289.419) (-294.531) (-293.269) [-288.270] -- 0:00:50
      179000 -- (-290.611) [-289.189] (-290.557) (-289.474) * [-289.761] (-293.433) (-290.075) (-290.547) -- 0:00:50
      179500 -- (-288.727) [-288.729] (-291.474) (-288.904) * [-287.919] (-291.175) (-290.840) (-289.349) -- 0:00:50
      180000 -- (-294.490) (-291.076) (-290.069) [-289.427] * (-290.918) (-289.548) (-291.235) [-287.895] -- 0:00:50

      Average standard deviation of split frequencies: 0.014694

      180500 -- (-288.805) [-290.696] (-289.718) (-289.058) * (-289.955) (-290.561) [-291.744] (-288.108) -- 0:00:49
      181000 -- (-290.758) [-289.844] (-288.985) (-290.714) * [-293.109] (-288.357) (-288.162) (-287.680) -- 0:00:49
      181500 -- [-290.687] (-291.532) (-289.980) (-289.303) * (-293.302) [-292.649] (-288.269) (-288.586) -- 0:00:49
      182000 -- (-290.454) (-289.292) (-287.485) [-288.213] * (-294.302) (-288.597) [-288.197] (-288.058) -- 0:00:49
      182500 -- (-292.369) (-291.622) [-288.755] (-288.832) * [-288.299] (-289.379) (-288.052) (-289.085) -- 0:00:49
      183000 -- (-293.231) (-287.225) [-289.837] (-292.437) * [-289.599] (-288.544) (-288.562) (-288.437) -- 0:00:49
      183500 -- (-290.819) [-288.333] (-291.769) (-288.201) * (-287.539) (-291.375) [-291.384] (-292.828) -- 0:00:48
      184000 -- (-288.227) (-288.679) (-289.304) [-288.624] * (-287.658) (-292.045) (-289.115) [-290.395] -- 0:00:48
      184500 -- [-289.894] (-294.055) (-288.642) (-291.612) * (-287.968) (-293.431) [-289.161] (-291.674) -- 0:00:48
      185000 -- [-287.699] (-291.866) (-291.427) (-291.378) * (-292.839) (-289.272) (-292.243) [-288.892] -- 0:00:48

      Average standard deviation of split frequencies: 0.012806

      185500 -- [-288.045] (-288.888) (-287.797) (-289.316) * (-288.655) [-291.295] (-289.641) (-288.980) -- 0:00:48
      186000 -- [-289.203] (-291.014) (-288.248) (-289.292) * (-290.408) (-288.548) (-288.935) [-290.748] -- 0:00:48
      186500 -- (-288.830) [-290.188] (-289.175) (-292.343) * (-288.284) [-288.898] (-289.471) (-289.276) -- 0:00:47
      187000 -- [-289.825] (-288.260) (-291.477) (-295.537) * (-291.724) (-289.284) (-289.887) [-289.902] -- 0:00:47
      187500 -- (-289.969) (-292.385) (-289.623) [-287.676] * (-290.477) [-288.354] (-288.795) (-288.844) -- 0:00:47
      188000 -- (-288.891) (-290.856) [-291.505] (-287.594) * (-291.020) [-289.065] (-292.339) (-290.135) -- 0:00:47
      188500 -- (-293.349) [-291.252] (-292.493) (-289.047) * [-288.696] (-290.406) (-290.441) (-288.274) -- 0:00:47
      189000 -- (-294.895) (-290.338) (-288.463) [-291.286] * (-292.398) [-287.556] (-289.114) (-288.318) -- 0:00:47
      189500 -- (-291.089) (-291.006) [-289.121] (-288.576) * (-288.181) [-289.301] (-288.530) (-288.315) -- 0:00:47
      190000 -- (-287.270) [-291.128] (-289.106) (-290.337) * [-289.080] (-289.570) (-289.776) (-291.377) -- 0:00:46

      Average standard deviation of split frequencies: 0.011842

      190500 -- (-291.898) [-290.891] (-288.564) (-288.768) * (-288.302) (-293.431) [-289.219] (-291.792) -- 0:00:46
      191000 -- [-290.629] (-290.378) (-288.531) (-293.978) * (-291.156) (-289.429) (-288.672) [-288.429] -- 0:00:46
      191500 -- (-288.842) (-289.816) (-291.577) [-288.430] * (-289.111) (-288.337) [-290.458] (-291.614) -- 0:00:46
      192000 -- (-290.524) (-288.193) (-292.022) [-291.245] * (-289.940) (-288.525) (-287.319) [-289.686] -- 0:00:46
      192500 -- [-291.413] (-293.213) (-288.944) (-289.748) * (-289.693) (-288.138) (-289.329) [-290.820] -- 0:00:46
      193000 -- (-288.343) (-289.516) [-288.421] (-287.567) * (-289.268) (-292.317) [-288.300] (-292.294) -- 0:00:45
      193500 -- (-287.481) (-290.109) [-289.418] (-288.948) * (-295.892) (-293.560) [-288.051] (-291.604) -- 0:00:45
      194000 -- (-288.843) [-287.988] (-287.886) (-287.882) * (-288.259) (-288.135) [-289.983] (-290.647) -- 0:00:49
      194500 -- [-287.890] (-288.333) (-294.173) (-292.804) * [-288.766] (-289.354) (-289.863) (-289.655) -- 0:00:49
      195000 -- (-289.763) (-288.886) (-293.648) [-296.512] * (-288.680) (-287.623) (-291.381) [-291.479] -- 0:00:49

      Average standard deviation of split frequencies: 0.012026

      195500 -- [-290.904] (-289.110) (-291.719) (-289.352) * (-289.154) [-288.868] (-290.099) (-287.474) -- 0:00:49
      196000 -- (-290.412) (-290.316) [-290.743] (-289.976) * [-290.399] (-290.102) (-293.094) (-288.154) -- 0:00:49
      196500 -- [-289.218] (-289.397) (-289.964) (-289.697) * (-290.375) [-288.160] (-293.630) (-290.051) -- 0:00:49
      197000 -- [-289.117] (-288.410) (-289.855) (-287.326) * [-289.589] (-290.711) (-291.065) (-291.261) -- 0:00:48
      197500 -- (-289.107) (-291.814) [-289.322] (-291.884) * (-288.715) (-291.988) (-287.923) [-288.189] -- 0:00:48
      198000 -- (-291.613) [-289.128] (-290.795) (-290.989) * (-294.242) (-289.161) (-290.726) [-288.562] -- 0:00:48
      198500 -- (-288.114) (-289.799) (-296.622) [-288.115] * (-289.968) (-290.352) [-289.912] (-289.096) -- 0:00:48
      199000 -- (-288.144) (-289.047) [-287.721] (-288.089) * (-290.573) (-287.456) [-289.692] (-290.611) -- 0:00:48
      199500 -- (-288.570) (-288.688) [-288.644] (-292.084) * [-290.107] (-291.240) (-289.507) (-289.413) -- 0:00:48
      200000 -- (-288.216) (-288.557) [-288.480] (-288.588) * [-287.416] (-290.568) (-289.478) (-289.721) -- 0:00:48

      Average standard deviation of split frequencies: 0.011055

      200500 -- [-287.457] (-290.322) (-287.786) (-288.864) * (-287.752) (-290.504) (-289.039) [-289.695] -- 0:00:47
      201000 -- (-288.401) (-296.465) (-292.796) [-288.351] * (-288.657) (-290.315) (-288.943) [-288.038] -- 0:00:47
      201500 -- (-288.011) (-290.473) (-290.472) [-291.082] * (-291.086) [-288.389] (-293.479) (-290.307) -- 0:00:47
      202000 -- (-289.298) [-289.775] (-288.131) (-288.160) * (-291.048) [-288.686] (-290.236) (-290.704) -- 0:00:47
      202500 -- (-287.705) (-288.925) [-289.090] (-289.750) * [-290.477] (-289.652) (-288.683) (-290.545) -- 0:00:47
      203000 -- (-288.143) [-289.906] (-289.513) (-294.015) * [-290.392] (-289.395) (-287.317) (-288.999) -- 0:00:47
      203500 -- [-289.564] (-290.616) (-293.868) (-287.098) * (-290.850) (-288.317) (-289.061) [-288.026] -- 0:00:46
      204000 -- (-289.704) (-288.968) [-289.995] (-287.289) * (-292.104) (-289.793) [-289.410] (-291.065) -- 0:00:46
      204500 -- (-288.522) (-291.049) (-289.929) [-290.248] * (-293.262) (-288.918) [-288.646] (-290.996) -- 0:00:46
      205000 -- [-290.293] (-289.762) (-291.203) (-288.845) * (-288.859) (-292.366) (-290.716) [-289.301] -- 0:00:46

      Average standard deviation of split frequencies: 0.010806

      205500 -- [-288.377] (-289.281) (-290.461) (-289.541) * (-289.542) (-291.893) [-289.964] (-287.841) -- 0:00:46
      206000 -- (-288.801) [-287.800] (-292.381) (-290.181) * (-287.654) [-291.179] (-290.579) (-292.633) -- 0:00:46
      206500 -- (-293.722) [-290.832] (-294.004) (-288.498) * (-290.382) [-289.809] (-289.469) (-288.329) -- 0:00:46
      207000 -- [-291.269] (-292.558) (-289.836) (-289.908) * [-291.194] (-289.030) (-289.466) (-288.320) -- 0:00:45
      207500 -- (-287.931) (-288.456) (-288.422) [-289.311] * [-293.275] (-290.147) (-289.658) (-289.705) -- 0:00:45
      208000 -- [-288.569] (-289.187) (-288.875) (-287.604) * (-287.795) (-289.144) [-291.620] (-291.347) -- 0:00:45
      208500 -- (-288.045) (-289.880) [-290.945] (-289.610) * (-287.747) (-289.206) (-288.586) [-289.009] -- 0:00:45
      209000 -- (-290.458) (-287.985) [-291.133] (-295.399) * (-288.576) (-288.432) [-290.183] (-287.286) -- 0:00:45
      209500 -- (-288.627) (-288.558) [-290.131] (-291.470) * (-290.194) (-288.283) (-291.119) [-288.007] -- 0:00:45
      210000 -- (-287.682) (-289.480) (-292.209) [-291.504] * (-287.588) (-290.462) [-290.470] (-287.323) -- 0:00:45

      Average standard deviation of split frequencies: 0.010717

      210500 -- [-287.483] (-288.999) (-290.390) (-289.246) * (-289.813) (-289.914) (-292.964) [-289.151] -- 0:00:45
      211000 -- (-291.109) (-290.435) (-292.287) [-292.772] * (-293.228) [-288.175] (-291.112) (-289.993) -- 0:00:44
      211500 -- (-289.235) (-290.265) [-289.559] (-290.311) * (-289.548) (-287.613) [-289.424] (-291.335) -- 0:00:48
      212000 -- [-288.538] (-290.148) (-290.174) (-288.801) * (-288.559) (-288.215) (-289.437) [-289.272] -- 0:00:48
      212500 -- (-289.391) [-291.500] (-293.923) (-295.148) * [-287.394] (-287.802) (-291.829) (-288.508) -- 0:00:48
      213000 -- (-288.775) [-291.511] (-287.832) (-295.537) * [-287.413] (-289.439) (-290.817) (-289.148) -- 0:00:48
      213500 -- [-288.752] (-289.187) (-290.420) (-293.637) * (-289.737) (-291.402) [-290.093] (-290.958) -- 0:00:47
      214000 -- (-292.906) [-288.974] (-294.638) (-288.884) * [-290.576] (-288.937) (-292.139) (-289.094) -- 0:00:47
      214500 -- (-289.980) (-288.157) (-295.369) [-288.796] * (-288.811) (-289.448) (-290.277) [-291.371] -- 0:00:47
      215000 -- (-289.753) [-288.172] (-289.995) (-288.224) * [-289.986] (-292.076) (-293.874) (-288.342) -- 0:00:47

      Average standard deviation of split frequencies: 0.012125

      215500 -- (-289.533) (-289.017) (-291.108) [-289.365] * (-287.512) [-287.517] (-290.453) (-288.004) -- 0:00:47
      216000 -- [-294.777] (-293.533) (-289.570) (-289.972) * (-287.806) (-291.598) [-291.284] (-290.001) -- 0:00:47
      216500 -- [-288.699] (-292.017) (-291.516) (-290.551) * (-290.740) (-292.175) [-290.993] (-287.576) -- 0:00:47
      217000 -- (-289.004) (-292.306) [-289.787] (-289.629) * (-289.895) [-291.909] (-288.004) (-291.724) -- 0:00:46
      217500 -- [-288.039] (-291.812) (-292.421) (-289.061) * (-292.041) (-291.392) (-289.403) [-288.745] -- 0:00:46
      218000 -- [-291.729] (-288.601) (-292.482) (-292.863) * (-290.946) (-290.092) [-287.943] (-293.106) -- 0:00:46
      218500 -- (-288.865) (-292.269) (-293.121) [-288.875] * (-293.019) [-288.740] (-290.888) (-287.663) -- 0:00:46
      219000 -- (-290.801) (-291.959) (-289.170) [-288.169] * (-288.849) (-288.965) (-291.192) [-292.315] -- 0:00:46
      219500 -- (-288.040) (-290.291) (-289.864) [-290.169] * (-287.611) [-289.671] (-288.161) (-288.468) -- 0:00:46
      220000 -- (-288.421) [-291.723] (-289.597) (-288.914) * [-290.565] (-291.409) (-292.456) (-290.165) -- 0:00:46

      Average standard deviation of split frequencies: 0.014200

      220500 -- (-287.765) (-289.306) (-290.892) [-289.973] * [-290.645] (-290.616) (-295.391) (-292.209) -- 0:00:45
      221000 -- (-290.683) [-288.667] (-293.236) (-287.519) * (-292.392) (-299.340) [-288.494] (-289.339) -- 0:00:45
      221500 -- (-291.176) (-292.357) [-289.171] (-292.746) * (-288.864) (-293.890) (-292.995) [-288.267] -- 0:00:45
      222000 -- (-293.960) [-288.856] (-290.272) (-288.768) * (-289.623) (-293.599) [-290.277] (-287.821) -- 0:00:45
      222500 -- (-288.761) [-290.214] (-292.908) (-290.378) * (-289.961) (-287.353) (-289.923) [-290.582] -- 0:00:45
      223000 -- (-289.628) [-291.206] (-291.458) (-289.785) * [-287.764] (-289.663) (-288.812) (-287.400) -- 0:00:45
      223500 -- [-290.330] (-289.074) (-287.886) (-291.248) * (-288.487) [-287.560] (-288.683) (-294.237) -- 0:00:45
      224000 -- [-288.298] (-290.265) (-289.000) (-291.891) * (-288.908) [-290.158] (-289.565) (-294.331) -- 0:00:45
      224500 -- (-289.425) (-290.980) [-290.366] (-291.615) * (-289.056) (-291.381) (-288.852) [-287.462] -- 0:00:44
      225000 -- (-290.967) (-287.438) [-289.979] (-288.597) * (-294.382) [-290.199] (-290.755) (-292.105) -- 0:00:44

      Average standard deviation of split frequencies: 0.014356

      225500 -- (-287.825) (-288.163) [-290.238] (-288.852) * (-291.523) (-288.943) (-289.713) [-288.049] -- 0:00:44
      226000 -- (-287.888) (-287.662) [-290.384] (-288.460) * (-289.977) (-288.779) (-289.228) [-289.765] -- 0:00:44
      226500 -- (-292.422) (-291.499) [-290.092] (-291.270) * (-290.280) [-288.167] (-288.895) (-289.335) -- 0:00:44
      227000 -- [-290.342] (-293.373) (-290.457) (-292.411) * [-290.057] (-287.955) (-292.438) (-291.037) -- 0:00:44
      227500 -- (-287.906) (-291.357) (-288.139) [-289.310] * (-293.905) (-290.404) [-289.977] (-290.091) -- 0:00:44
      228000 -- (-289.033) (-288.698) (-288.095) [-287.932] * (-288.639) [-288.310] (-289.625) (-289.026) -- 0:00:44
      228500 -- (-292.793) (-289.496) [-292.729] (-292.260) * (-288.681) [-287.359] (-291.473) (-290.660) -- 0:00:47
      229000 -- (-289.062) (-288.214) (-289.653) [-288.416] * (-287.956) (-290.184) [-290.383] (-291.968) -- 0:00:47
      229500 -- (-290.344) (-292.111) (-288.112) [-287.702] * (-288.042) (-290.007) [-291.855] (-289.527) -- 0:00:47
      230000 -- [-290.916] (-289.718) (-289.869) (-291.555) * (-288.326) (-288.369) (-287.841) [-287.943] -- 0:00:46

      Average standard deviation of split frequencies: 0.015327

      230500 -- [-288.520] (-288.035) (-292.152) (-293.301) * (-292.428) (-289.237) (-291.335) [-288.801] -- 0:00:46
      231000 -- (-287.885) (-288.392) (-289.979) [-289.123] * (-293.412) [-288.574] (-289.210) (-288.062) -- 0:00:46
      231500 -- (-290.635) [-288.193] (-291.056) (-289.256) * (-296.156) (-289.090) (-292.633) [-290.225] -- 0:00:46
      232000 -- [-289.561] (-288.912) (-290.538) (-288.184) * [-289.394] (-289.081) (-290.743) (-290.386) -- 0:00:46
      232500 -- (-288.012) [-290.403] (-287.864) (-291.858) * (-289.082) [-287.475] (-291.307) (-289.137) -- 0:00:46
      233000 -- (-289.030) (-290.249) [-288.453] (-290.341) * (-291.165) (-290.920) [-290.185] (-288.453) -- 0:00:46
      233500 -- (-294.650) (-290.914) [-291.617] (-289.099) * (-287.353) (-289.018) (-293.099) [-288.230] -- 0:00:45
      234000 -- (-287.765) (-289.481) (-288.436) [-287.766] * (-290.716) [-298.900] (-293.386) (-288.408) -- 0:00:45
      234500 -- [-287.824] (-293.062) (-289.756) (-288.531) * (-291.209) [-292.462] (-288.585) (-294.064) -- 0:00:45
      235000 -- (-290.861) (-295.657) (-289.062) [-288.753] * (-294.781) [-287.572] (-291.709) (-289.384) -- 0:00:45

      Average standard deviation of split frequencies: 0.014981

      235500 -- (-289.592) (-292.395) [-287.852] (-287.699) * (-287.851) [-288.293] (-297.527) (-294.211) -- 0:00:45
      236000 -- [-289.977] (-287.431) (-289.864) (-287.340) * (-290.807) (-288.471) (-289.282) [-294.418] -- 0:00:45
      236500 -- (-290.935) (-292.404) (-288.931) [-289.783] * (-292.523) (-292.098) [-288.232] (-291.795) -- 0:00:45
      237000 -- [-287.787] (-288.869) (-291.653) (-290.807) * (-289.564) (-288.156) (-288.552) [-288.123] -- 0:00:45
      237500 -- (-289.417) [-287.856] (-290.119) (-288.835) * (-290.173) (-289.200) [-292.148] (-288.671) -- 0:00:44
      238000 -- [-287.676] (-289.221) (-294.987) (-289.273) * (-291.315) (-293.353) [-294.638] (-295.870) -- 0:00:44
      238500 -- (-288.904) [-289.780] (-287.820) (-289.583) * (-288.752) (-293.200) (-295.551) [-290.562] -- 0:00:44
      239000 -- (-290.353) (-292.747) (-289.390) [-289.309] * [-288.383] (-290.855) (-292.293) (-297.826) -- 0:00:44
      239500 -- (-290.529) (-288.294) [-288.394] (-288.432) * (-287.965) (-289.133) (-296.493) [-291.787] -- 0:00:44
      240000 -- (-290.784) (-291.870) (-293.042) [-291.836] * (-288.861) (-290.276) [-287.612] (-289.957) -- 0:00:44

      Average standard deviation of split frequencies: 0.013711

      240500 -- (-289.668) (-296.026) [-292.758] (-290.132) * (-289.017) [-288.736] (-290.866) (-287.690) -- 0:00:44
      241000 -- (-289.899) (-288.597) (-290.640) [-291.038] * (-290.810) (-289.832) [-289.534] (-287.774) -- 0:00:44
      241500 -- [-288.821] (-292.189) (-290.265) (-291.905) * (-287.960) (-289.411) [-290.547] (-289.093) -- 0:00:43
      242000 -- (-288.231) [-288.696] (-290.668) (-288.686) * (-288.963) (-288.953) (-290.191) [-288.788] -- 0:00:43
      242500 -- (-292.020) (-289.711) (-292.630) [-287.696] * (-290.638) [-289.220] (-290.972) (-294.865) -- 0:00:43
      243000 -- (-295.118) [-288.434] (-291.916) (-289.329) * [-288.982] (-289.364) (-292.708) (-289.583) -- 0:00:43
      243500 -- (-290.522) (-289.368) [-288.911] (-290.972) * (-289.012) (-288.230) (-292.231) [-288.037] -- 0:00:43
      244000 -- (-288.569) (-288.507) [-287.968] (-292.588) * (-291.666) [-288.023] (-289.022) (-287.476) -- 0:00:43
      244500 -- (-288.188) (-288.717) [-290.694] (-287.923) * (-292.141) [-292.873] (-289.731) (-290.734) -- 0:00:43
      245000 -- [-290.061] (-291.832) (-288.276) (-289.962) * (-292.449) [-287.907] (-290.862) (-289.870) -- 0:00:43

      Average standard deviation of split frequencies: 0.014564

      245500 -- (-288.977) (-291.183) (-288.372) [-288.391] * (-291.100) [-288.369] (-291.423) (-291.760) -- 0:00:43
      246000 -- (-293.139) [-288.638] (-289.070) (-288.537) * (-291.733) [-289.369] (-298.165) (-288.737) -- 0:00:45
      246500 -- (-289.048) (-291.127) (-287.642) [-289.896] * [-289.228] (-287.847) (-292.552) (-288.566) -- 0:00:45
      247000 -- (-290.841) (-287.410) [-290.192] (-291.029) * (-290.186) [-289.398] (-287.307) (-288.620) -- 0:00:45
      247500 -- (-288.582) (-289.147) (-295.727) [-289.079] * (-289.651) (-289.828) (-289.768) [-288.004] -- 0:00:45
      248000 -- (-288.807) (-288.666) [-291.251] (-291.260) * (-289.697) [-290.507] (-296.643) (-290.125) -- 0:00:45
      248500 -- (-291.747) [-289.181] (-289.369) (-292.520) * (-288.813) (-287.440) [-293.928] (-288.424) -- 0:00:45
      249000 -- (-290.636) (-287.951) [-289.316] (-289.907) * (-290.240) (-292.178) [-289.044] (-289.365) -- 0:00:45
      249500 -- (-288.978) (-291.024) [-287.716] (-289.358) * [-289.217] (-291.538) (-288.369) (-289.671) -- 0:00:45
      250000 -- [-290.410] (-294.125) (-288.847) (-288.142) * [-291.777] (-291.519) (-287.836) (-289.041) -- 0:00:45

      Average standard deviation of split frequencies: 0.015342

      250500 -- (-289.239) [-289.572] (-287.991) (-289.897) * (-289.295) [-290.967] (-288.613) (-288.367) -- 0:00:44
      251000 -- (-291.120) (-287.860) [-287.354] (-289.362) * [-288.457] (-291.334) (-287.382) (-289.438) -- 0:00:44
      251500 -- (-289.877) (-289.187) (-288.406) [-289.553] * [-288.669] (-291.800) (-288.076) (-290.997) -- 0:00:44
      252000 -- [-289.797] (-290.344) (-296.258) (-289.996) * (-287.413) (-295.887) [-290.067] (-288.317) -- 0:00:44
      252500 -- (-288.135) (-289.326) [-291.158] (-287.930) * (-289.337) (-295.333) [-288.800] (-288.432) -- 0:00:44
      253000 -- (-287.872) (-287.542) [-289.193] (-289.511) * [-291.865] (-288.690) (-293.856) (-288.928) -- 0:00:44
      253500 -- [-288.314] (-287.941) (-288.624) (-287.822) * [-289.304] (-287.813) (-289.606) (-287.504) -- 0:00:44
      254000 -- [-292.563] (-290.767) (-288.900) (-291.703) * (-289.302) (-288.031) [-290.149] (-287.919) -- 0:00:44
      254500 -- [-292.307] (-291.349) (-293.727) (-292.094) * (-289.162) [-288.796] (-289.050) (-290.117) -- 0:00:43
      255000 -- (-292.767) [-287.995] (-289.886) (-288.437) * (-289.596) (-287.932) (-292.695) [-287.587] -- 0:00:43

      Average standard deviation of split frequencies: 0.014731

      255500 -- [-288.560] (-290.244) (-287.671) (-288.685) * (-289.641) [-288.407] (-290.734) (-289.990) -- 0:00:43
      256000 -- (-289.053) (-288.649) [-287.634] (-288.464) * [-289.591] (-288.140) (-287.829) (-290.046) -- 0:00:43
      256500 -- (-288.630) (-288.962) (-289.163) [-288.147] * (-292.354) (-290.313) (-287.823) [-292.595] -- 0:00:43
      257000 -- (-294.466) [-288.876] (-288.186) (-289.313) * [-289.434] (-290.852) (-289.688) (-289.621) -- 0:00:43
      257500 -- (-289.538) (-288.750) (-288.283) [-287.515] * (-289.643) (-292.252) [-289.296] (-288.917) -- 0:00:43
      258000 -- (-289.596) (-293.926) [-288.915] (-289.375) * (-289.797) (-289.178) [-288.410] (-291.576) -- 0:00:43
      258500 -- (-288.840) (-289.090) [-287.712] (-292.138) * (-288.596) (-288.327) [-288.880] (-290.173) -- 0:00:43
      259000 -- (-291.234) (-294.291) [-287.155] (-288.993) * (-289.052) (-289.319) (-288.578) [-288.316] -- 0:00:42
      259500 -- [-287.734] (-288.836) (-288.834) (-291.925) * [-287.611] (-289.135) (-289.592) (-289.006) -- 0:00:42
      260000 -- (-292.073) [-288.974] (-288.796) (-289.424) * (-287.852) (-288.150) (-287.684) [-288.209] -- 0:00:42

      Average standard deviation of split frequencies: 0.013965

      260500 -- (-290.699) (-291.006) (-291.745) [-288.640] * [-289.529] (-288.361) (-291.458) (-293.008) -- 0:00:42
      261000 -- (-287.514) (-288.649) (-288.821) [-289.838] * (-290.539) (-289.022) (-290.275) [-288.404] -- 0:00:42
      261500 -- (-289.515) (-293.935) [-289.598] (-290.464) * (-288.834) [-291.797] (-293.901) (-287.704) -- 0:00:42
      262000 -- (-291.716) (-289.159) (-293.130) [-288.270] * (-288.452) [-288.178] (-291.880) (-292.340) -- 0:00:42
      262500 -- (-293.764) [-288.586] (-287.774) (-287.681) * (-292.503) (-289.141) [-288.431] (-289.329) -- 0:00:42
      263000 -- (-291.393) (-289.773) [-289.479] (-288.405) * (-290.271) (-289.351) [-287.774] (-290.179) -- 0:00:44
      263500 -- (-295.579) [-290.498] (-290.765) (-289.479) * (-291.127) (-287.769) [-290.297] (-293.238) -- 0:00:44
      264000 -- (-289.741) (-288.145) [-292.896] (-288.171) * (-288.940) (-292.968) (-290.224) [-293.868] -- 0:00:44
      264500 -- [-288.918] (-288.284) (-294.647) (-289.201) * (-288.067) (-293.005) (-290.610) [-292.404] -- 0:00:44
      265000 -- (-292.668) (-290.860) (-289.482) [-287.786] * (-291.625) (-288.084) [-290.315] (-288.342) -- 0:00:44

      Average standard deviation of split frequencies: 0.015297

      265500 -- (-290.066) [-288.749] (-289.818) (-296.475) * (-287.524) (-288.285) (-290.117) [-289.377] -- 0:00:44
      266000 -- (-288.485) (-287.634) [-290.830] (-289.314) * (-292.403) (-290.035) (-288.282) [-290.093] -- 0:00:44
      266500 -- (-289.024) (-290.648) (-290.133) [-291.312] * (-290.852) [-292.185] (-290.439) (-287.686) -- 0:00:44
      267000 -- [-288.233] (-292.432) (-293.256) (-288.615) * (-294.460) [-291.810] (-290.048) (-291.014) -- 0:00:43
      267500 -- (-289.103) [-289.165] (-287.302) (-288.030) * [-287.657] (-289.645) (-288.762) (-288.560) -- 0:00:43
      268000 -- (-289.500) (-288.946) [-288.576] (-290.933) * [-288.145] (-290.814) (-287.439) (-290.461) -- 0:00:43
      268500 -- (-291.428) (-289.384) (-288.761) [-288.156] * (-294.309) (-289.220) (-290.040) [-288.576] -- 0:00:43
      269000 -- (-291.270) (-288.814) (-290.331) [-289.324] * (-292.699) [-289.484] (-288.747) (-291.853) -- 0:00:43
      269500 -- (-288.765) (-289.159) [-287.957] (-290.059) * [-289.941] (-289.537) (-290.550) (-287.950) -- 0:00:43
      270000 -- (-288.430) (-287.739) (-290.487) [-288.489] * (-295.341) [-289.755] (-287.958) (-290.338) -- 0:00:43

      Average standard deviation of split frequencies: 0.013933

      270500 -- (-290.401) (-288.457) [-288.375] (-288.346) * (-288.392) [-288.907] (-290.724) (-292.155) -- 0:00:43
      271000 -- (-288.979) (-291.816) [-289.490] (-289.948) * (-292.373) [-287.891] (-289.970) (-289.459) -- 0:00:43
      271500 -- (-288.870) [-293.186] (-291.896) (-289.813) * (-297.337) [-290.670] (-290.235) (-288.206) -- 0:00:42
      272000 -- (-289.619) (-294.003) [-292.361] (-289.064) * [-288.008] (-289.080) (-292.907) (-288.724) -- 0:00:42
      272500 -- (-290.298) [-292.087] (-289.952) (-293.969) * [-288.874] (-288.174) (-290.361) (-290.171) -- 0:00:42
      273000 -- [-288.441] (-291.053) (-289.543) (-288.047) * (-287.214) [-290.921] (-292.032) (-288.870) -- 0:00:42
      273500 -- (-289.102) (-293.303) (-293.410) [-288.978] * (-287.515) (-289.081) [-290.870] (-288.394) -- 0:00:42
      274000 -- (-289.982) (-289.769) [-289.941] (-288.801) * [-287.515] (-288.097) (-292.004) (-288.365) -- 0:00:42
      274500 -- (-290.709) (-288.718) [-287.595] (-294.292) * (-288.536) (-291.246) (-291.034) [-288.578] -- 0:00:42
      275000 -- [-289.896] (-288.515) (-289.608) (-289.953) * [-288.013] (-291.511) (-292.473) (-288.927) -- 0:00:42

      Average standard deviation of split frequencies: 0.014563

      275500 -- (-289.024) (-290.511) [-289.100] (-290.939) * [-290.017] (-292.652) (-290.082) (-289.561) -- 0:00:42
      276000 -- (-288.550) [-287.682] (-289.969) (-287.906) * [-287.407] (-290.323) (-291.036) (-292.073) -- 0:00:41
      276500 -- (-287.250) [-290.778] (-292.010) (-288.304) * (-292.191) (-293.754) (-294.010) [-291.418] -- 0:00:41
      277000 -- (-287.960) (-294.708) (-288.015) [-288.317] * (-287.893) (-292.782) [-291.946] (-289.918) -- 0:00:41
      277500 -- (-288.162) [-292.390] (-291.251) (-287.936) * (-290.635) (-290.788) (-289.291) [-288.818] -- 0:00:41
      278000 -- (-290.773) (-289.757) [-287.277] (-288.910) * (-290.972) [-289.164] (-288.598) (-290.360) -- 0:00:41
      278500 -- (-290.266) (-289.196) (-289.537) [-289.020] * (-287.789) (-288.243) [-288.018] (-290.359) -- 0:00:41
      279000 -- [-289.138] (-293.072) (-289.348) (-290.254) * (-289.752) (-288.872) [-291.226] (-287.846) -- 0:00:41
      279500 -- (-287.412) (-289.087) (-289.785) [-289.497] * (-288.954) [-288.047] (-290.384) (-288.842) -- 0:00:41
      280000 -- (-290.395) (-291.393) [-288.117] (-289.813) * (-290.476) [-288.919] (-291.621) (-287.662) -- 0:00:41

      Average standard deviation of split frequencies: 0.015205

      280500 -- (-289.056) [-289.809] (-291.170) (-290.112) * (-290.443) [-289.086] (-288.107) (-291.139) -- 0:00:43
      281000 -- (-288.097) (-296.876) (-292.277) [-290.642] * [-288.608] (-289.737) (-290.206) (-288.051) -- 0:00:43
      281500 -- (-291.064) (-288.959) [-288.472] (-287.746) * (-290.671) [-288.560] (-290.285) (-290.767) -- 0:00:43
      282000 -- [-287.577] (-290.028) (-288.502) (-287.782) * [-289.382] (-289.045) (-291.466) (-291.585) -- 0:00:43
      282500 -- (-290.073) (-289.230) (-288.340) [-287.763] * (-289.834) (-291.570) (-296.682) [-289.121] -- 0:00:43
      283000 -- [-290.483] (-289.084) (-291.495) (-288.467) * (-291.678) (-291.184) (-292.369) [-291.522] -- 0:00:43
      283500 -- [-289.211] (-288.474) (-292.213) (-290.577) * (-291.705) (-289.962) [-292.731] (-291.116) -- 0:00:42
      284000 -- (-289.736) (-287.604) (-293.283) [-291.832] * (-289.060) (-288.413) [-292.792] (-287.830) -- 0:00:42
      284500 -- (-289.337) (-289.274) [-291.509] (-291.814) * (-289.398) (-288.061) [-288.439] (-293.499) -- 0:00:42
      285000 -- [-290.563] (-290.312) (-290.040) (-295.228) * (-292.547) (-291.577) (-288.768) [-290.078] -- 0:00:42

      Average standard deviation of split frequencies: 0.015008

      285500 -- (-290.570) (-287.708) [-288.567] (-293.166) * (-292.606) [-289.273] (-293.572) (-288.039) -- 0:00:42
      286000 -- [-288.156] (-291.265) (-289.405) (-287.993) * (-289.759) (-290.228) [-291.079] (-288.733) -- 0:00:42
      286500 -- [-289.362] (-292.308) (-289.132) (-289.711) * (-291.173) (-289.102) (-289.052) [-289.613] -- 0:00:42
      287000 -- (-289.780) (-291.873) (-289.680) [-288.155] * (-289.963) (-289.630) [-288.187] (-289.687) -- 0:00:42
      287500 -- [-291.076] (-289.580) (-291.356) (-288.646) * [-290.827] (-292.719) (-288.449) (-290.186) -- 0:00:42
      288000 -- (-292.224) [-289.999] (-292.666) (-290.208) * [-288.805] (-288.304) (-288.590) (-289.786) -- 0:00:42
      288500 -- (-293.600) (-292.945) (-291.781) [-287.570] * (-292.024) (-291.717) (-292.167) [-288.778] -- 0:00:41
      289000 -- [-292.165] (-290.371) (-293.178) (-289.013) * (-289.034) [-290.422] (-290.214) (-290.554) -- 0:00:41
      289500 -- (-287.807) [-289.920] (-287.814) (-292.468) * (-293.243) (-288.531) [-288.615] (-290.967) -- 0:00:41
      290000 -- (-288.391) [-289.596] (-287.632) (-290.711) * (-289.562) (-289.020) (-288.748) [-288.057] -- 0:00:41

      Average standard deviation of split frequencies: 0.014340

      290500 -- [-294.227] (-290.106) (-289.129) (-288.470) * (-291.787) [-290.509] (-295.666) (-291.447) -- 0:00:41
      291000 -- [-293.617] (-292.177) (-288.348) (-287.481) * [-296.216] (-287.518) (-292.491) (-292.174) -- 0:00:41
      291500 -- [-289.599] (-289.733) (-288.364) (-289.715) * (-288.550) [-288.163] (-289.660) (-289.321) -- 0:00:41
      292000 -- (-297.248) [-287.271] (-295.500) (-288.811) * [-287.823] (-287.306) (-292.590) (-290.195) -- 0:00:41
      292500 -- (-292.480) (-287.436) (-292.259) [-289.629] * (-289.153) (-289.845) (-290.605) [-288.144] -- 0:00:41
      293000 -- (-294.330) [-288.323] (-291.906) (-288.355) * (-291.772) (-287.826) (-292.531) [-289.758] -- 0:00:41
      293500 -- (-288.734) (-288.549) (-289.594) [-287.997] * (-289.797) (-294.411) [-292.168] (-291.058) -- 0:00:40
      294000 -- (-296.568) [-288.087] (-289.409) (-287.410) * [-287.515] (-290.661) (-289.143) (-294.061) -- 0:00:40
      294500 -- (-294.843) (-288.869) [-291.586] (-287.402) * [-288.499] (-291.679) (-291.505) (-289.648) -- 0:00:40
      295000 -- (-287.938) [-287.558] (-289.978) (-288.996) * (-288.478) (-287.718) [-288.823] (-289.325) -- 0:00:40

      Average standard deviation of split frequencies: 0.014249

      295500 -- [-287.816] (-289.786) (-291.134) (-287.710) * [-289.529] (-287.372) (-292.505) (-289.493) -- 0:00:40
      296000 -- (-289.822) (-295.763) [-289.207] (-290.457) * [-288.136] (-287.860) (-288.299) (-289.204) -- 0:00:40
      296500 -- (-290.680) (-288.454) (-289.061) [-288.479] * (-290.751) [-291.426] (-290.603) (-288.026) -- 0:00:40
      297000 -- (-290.507) [-288.294] (-291.824) (-291.612) * [-288.924] (-287.762) (-289.951) (-288.148) -- 0:00:40
      297500 -- (-290.077) [-289.008] (-291.190) (-291.783) * (-289.812) (-287.444) (-290.550) [-293.223] -- 0:00:42
      298000 -- (-287.909) (-288.916) [-288.473] (-289.688) * (-288.569) (-287.828) (-291.987) [-290.075] -- 0:00:42
      298500 -- (-290.435) (-291.800) (-293.238) [-289.107] * (-290.331) (-288.314) [-290.419] (-291.589) -- 0:00:42
      299000 -- [-289.014] (-289.344) (-290.920) (-290.033) * (-289.555) [-288.892] (-290.482) (-294.953) -- 0:00:42
      299500 -- (-288.421) [-290.631] (-291.479) (-288.537) * (-290.725) [-290.196] (-290.057) (-293.255) -- 0:00:42
      300000 -- (-288.488) (-291.384) [-288.904] (-288.778) * (-290.072) (-289.625) (-291.178) [-288.245] -- 0:00:42

      Average standard deviation of split frequencies: 0.014193

      300500 -- (-290.644) (-291.048) (-291.972) [-287.604] * (-289.950) (-289.337) (-290.830) [-287.490] -- 0:00:41
      301000 -- (-288.979) (-287.811) [-289.085] (-289.776) * (-289.150) (-288.050) (-290.184) [-287.810] -- 0:00:41
      301500 -- (-291.107) (-287.721) (-294.050) [-289.060] * [-289.614] (-291.476) (-289.329) (-288.079) -- 0:00:41
      302000 -- (-289.748) (-288.163) (-288.703) [-287.495] * (-289.306) (-290.005) (-292.538) [-289.254] -- 0:00:41
      302500 -- (-289.244) (-294.111) (-288.666) [-289.840] * (-287.893) (-290.193) [-289.205] (-290.113) -- 0:00:41
      303000 -- [-287.833] (-291.278) (-287.557) (-287.837) * (-289.959) (-295.162) [-292.253] (-288.839) -- 0:00:41
      303500 -- (-288.201) [-289.617] (-290.919) (-288.855) * (-291.322) [-287.505] (-289.318) (-290.717) -- 0:00:41
      304000 -- [-288.753] (-288.769) (-290.306) (-287.489) * [-287.982] (-289.763) (-289.845) (-291.389) -- 0:00:41
      304500 -- (-290.771) (-288.395) [-290.076] (-289.588) * (-288.609) (-288.450) [-290.174] (-292.825) -- 0:00:41
      305000 -- [-287.956] (-288.480) (-288.078) (-291.287) * (-288.742) (-290.006) [-288.547] (-288.078) -- 0:00:41

      Average standard deviation of split frequencies: 0.014432

      305500 -- [-288.088] (-288.433) (-289.263) (-288.598) * (-293.639) (-289.243) (-294.446) [-288.950] -- 0:00:40
      306000 -- [-287.729] (-292.632) (-289.569) (-287.864) * (-288.249) (-289.221) [-288.733] (-288.025) -- 0:00:40
      306500 -- (-288.602) (-298.469) (-289.164) [-288.230] * (-291.272) (-289.049) (-289.157) [-290.390] -- 0:00:40
      307000 -- (-291.506) [-288.897] (-290.842) (-290.166) * (-291.560) (-288.399) (-292.611) [-289.529] -- 0:00:40
      307500 -- (-293.368) (-289.843) (-288.339) [-287.543] * (-291.193) (-290.426) [-288.660] (-291.731) -- 0:00:40
      308000 -- (-290.323) (-289.642) [-290.494] (-288.792) * [-287.816] (-290.672) (-290.372) (-295.043) -- 0:00:40
      308500 -- (-291.046) (-288.727) (-291.159) [-288.863] * (-288.031) (-288.596) (-292.655) [-288.547] -- 0:00:40
      309000 -- [-290.333] (-289.821) (-288.976) (-287.774) * (-289.080) [-287.901] (-289.164) (-289.605) -- 0:00:40
      309500 -- (-290.409) (-288.374) [-289.054] (-288.563) * (-289.910) (-289.199) [-289.763] (-289.521) -- 0:00:40
      310000 -- (-288.197) (-289.982) [-291.941] (-290.181) * (-289.001) (-290.943) [-289.400] (-287.894) -- 0:00:40

      Average standard deviation of split frequencies: 0.013018

      310500 -- (-288.137) [-288.441] (-288.273) (-288.667) * [-287.777] (-291.177) (-287.688) (-289.295) -- 0:00:39
      311000 -- (-287.853) (-289.525) (-287.953) [-290.623] * [-290.035] (-289.222) (-289.890) (-289.711) -- 0:00:39
      311500 -- (-289.711) (-292.967) [-289.712] (-288.673) * (-288.655) [-289.927] (-289.985) (-289.877) -- 0:00:39
      312000 -- [-289.209] (-293.382) (-288.625) (-292.789) * (-289.300) (-289.251) [-288.402] (-291.715) -- 0:00:39
      312500 -- [-291.076] (-294.872) (-288.184) (-289.685) * (-288.751) (-289.118) (-288.612) [-289.426] -- 0:00:39
      313000 -- (-290.502) [-288.264] (-288.217) (-290.617) * (-289.638) (-289.452) [-288.223] (-289.260) -- 0:00:39
      313500 -- [-287.774] (-289.042) (-289.691) (-289.945) * [-288.803] (-293.502) (-292.888) (-289.466) -- 0:00:39
      314000 -- (-288.862) (-288.177) [-289.813] (-289.103) * [-289.243] (-287.428) (-290.385) (-290.145) -- 0:00:39
      314500 -- [-289.241] (-291.186) (-290.804) (-287.789) * (-288.535) (-289.494) [-290.269] (-288.059) -- 0:00:39
      315000 -- (-288.056) (-292.138) (-289.101) [-288.727] * [-288.400] (-288.526) (-290.148) (-290.695) -- 0:00:41

      Average standard deviation of split frequencies: 0.014054

      315500 -- (-289.511) [-292.128] (-288.097) (-290.894) * [-288.753] (-289.087) (-288.006) (-288.460) -- 0:00:41
      316000 -- (-291.073) (-292.931) (-287.687) [-292.273] * (-287.621) (-289.313) [-290.082] (-289.107) -- 0:00:41
      316500 -- (-287.147) [-292.813] (-289.198) (-291.051) * (-289.834) (-291.011) (-298.504) [-291.615] -- 0:00:41
      317000 -- (-287.957) [-288.631] (-288.732) (-292.568) * (-288.222) [-289.416] (-288.385) (-288.115) -- 0:00:40
      317500 -- (-289.466) (-290.713) (-291.993) [-289.232] * (-289.514) (-288.941) [-290.618] (-287.553) -- 0:00:40
      318000 -- [-289.077] (-290.081) (-290.003) (-288.753) * [-290.680] (-288.961) (-292.119) (-289.102) -- 0:00:40
      318500 -- [-288.067] (-296.945) (-289.828) (-291.166) * [-289.512] (-293.442) (-293.831) (-289.032) -- 0:00:40
      319000 -- (-291.566) [-290.407] (-289.054) (-293.115) * (-290.145) (-294.629) (-290.214) [-289.839] -- 0:00:40
      319500 -- [-292.460] (-291.293) (-290.758) (-292.923) * (-290.252) (-291.074) (-291.944) [-288.200] -- 0:00:40
      320000 -- (-287.249) (-287.383) [-290.127] (-288.113) * (-292.738) (-289.243) (-288.974) [-287.450] -- 0:00:40

      Average standard deviation of split frequencies: 0.012577

      320500 -- (-289.203) (-289.876) (-294.329) [-289.102] * (-292.424) (-291.499) [-289.126] (-288.254) -- 0:00:40
      321000 -- (-289.972) [-288.991] (-291.098) (-287.530) * [-289.597] (-293.119) (-293.682) (-288.618) -- 0:00:40
      321500 -- (-292.293) (-291.175) (-288.064) [-290.499] * (-289.236) [-290.220] (-287.810) (-291.293) -- 0:00:40
      322000 -- [-289.700] (-290.105) (-289.208) (-293.595) * (-288.825) (-290.487) [-287.826] (-289.278) -- 0:00:40
      322500 -- (-289.096) (-289.856) [-289.812] (-291.619) * [-287.895] (-289.137) (-288.840) (-288.343) -- 0:00:39
      323000 -- (-287.992) [-288.303] (-289.297) (-289.596) * (-287.949) [-288.930] (-289.868) (-287.880) -- 0:00:39
      323500 -- (-289.506) (-290.403) [-289.742] (-290.589) * (-287.678) (-288.472) [-289.207] (-289.437) -- 0:00:39
      324000 -- (-289.554) (-288.380) [-288.687] (-288.603) * [-288.457] (-289.419) (-289.293) (-295.294) -- 0:00:39
      324500 -- (-288.666) [-288.063] (-291.946) (-289.183) * (-289.326) (-293.717) (-287.749) [-291.299] -- 0:00:39
      325000 -- (-290.301) (-296.484) [-296.076] (-290.773) * [-290.190] (-288.504) (-288.496) (-291.693) -- 0:00:39

      Average standard deviation of split frequencies: 0.012131

      325500 -- (-289.169) [-289.226] (-295.764) (-289.294) * [-289.985] (-290.021) (-292.379) (-287.513) -- 0:00:39
      326000 -- (-289.988) (-288.302) (-288.644) [-290.879] * (-290.434) (-290.526) [-289.224] (-289.604) -- 0:00:39
      326500 -- (-289.979) (-291.554) (-288.713) [-288.203] * (-289.905) (-288.460) (-291.116) [-287.159] -- 0:00:39
      327000 -- (-291.708) [-287.772] (-294.939) (-288.364) * (-291.815) (-289.169) (-291.286) [-293.066] -- 0:00:39
      327500 -- (-291.878) (-290.570) [-289.434] (-289.301) * (-288.940) (-291.760) [-290.100] (-297.000) -- 0:00:39
      328000 -- (-289.035) [-289.246] (-290.896) (-289.754) * [-288.507] (-292.776) (-290.428) (-298.349) -- 0:00:38
      328500 -- [-288.625] (-291.210) (-291.822) (-288.934) * [-288.100] (-291.457) (-291.810) (-293.688) -- 0:00:38
      329000 -- (-289.193) [-291.098] (-290.379) (-288.413) * (-288.864) (-291.865) (-290.756) [-290.923] -- 0:00:38
      329500 -- (-289.677) (-290.925) (-289.662) [-287.795] * [-291.711] (-293.307) (-292.489) (-289.065) -- 0:00:38
      330000 -- (-288.143) (-290.815) (-290.254) [-288.606] * [-290.648] (-291.532) (-291.514) (-288.054) -- 0:00:38

      Average standard deviation of split frequencies: 0.013334

      330500 -- (-290.182) (-289.057) [-291.202] (-288.330) * (-291.689) [-289.300] (-291.815) (-287.935) -- 0:00:38
      331000 -- (-287.941) (-289.186) [-288.655] (-290.206) * (-291.636) [-288.942] (-288.746) (-288.304) -- 0:00:38
      331500 -- (-291.273) [-290.082] (-289.168) (-287.956) * [-292.313] (-292.193) (-291.427) (-290.273) -- 0:00:38
      332000 -- (-292.876) (-289.964) (-289.579) [-288.688] * (-298.677) [-288.034] (-291.561) (-289.516) -- 0:00:40
      332500 -- (-287.970) (-290.802) [-288.971] (-289.328) * (-291.811) (-291.613) [-291.135] (-288.281) -- 0:00:40
      333000 -- [-290.403] (-290.327) (-293.726) (-287.550) * (-295.518) (-289.042) [-290.677] (-288.643) -- 0:00:40
      333500 -- (-289.021) (-290.937) (-295.847) [-288.145] * (-293.896) (-290.168) [-288.286] (-294.258) -- 0:00:39
      334000 -- [-289.278] (-287.381) (-292.028) (-288.443) * (-292.865) (-289.267) [-288.491] (-287.857) -- 0:00:39
      334500 -- (-290.257) [-288.045] (-296.405) (-291.060) * (-293.682) (-288.559) [-290.200] (-288.506) -- 0:00:39
      335000 -- (-293.913) [-287.708] (-289.010) (-289.835) * (-287.960) [-287.540] (-287.697) (-288.980) -- 0:00:39

      Average standard deviation of split frequencies: 0.013370

      335500 -- (-290.555) [-288.951] (-288.696) (-288.021) * (-288.076) [-288.115] (-287.734) (-288.144) -- 0:00:39
      336000 -- [-287.751] (-289.301) (-291.332) (-292.704) * [-288.799] (-290.427) (-290.630) (-289.295) -- 0:00:39
      336500 -- (-288.366) (-296.202) (-289.404) [-288.562] * (-291.453) [-288.002] (-290.035) (-289.489) -- 0:00:39
      337000 -- [-288.208] (-294.879) (-291.214) (-289.264) * (-290.701) [-288.081] (-290.884) (-289.149) -- 0:00:39
      337500 -- (-288.784) [-290.579] (-290.094) (-293.097) * (-289.293) (-288.147) [-290.665] (-289.041) -- 0:00:39
      338000 -- (-294.701) [-287.404] (-291.443) (-290.273) * (-288.867) (-290.495) (-288.325) [-287.924] -- 0:00:39
      338500 -- (-289.951) (-288.122) [-290.512] (-290.140) * (-287.661) (-288.698) (-289.316) [-288.856] -- 0:00:39
      339000 -- [-288.224] (-294.251) (-291.559) (-290.805) * (-287.781) [-288.717] (-287.446) (-288.928) -- 0:00:38
      339500 -- (-287.264) (-293.760) (-289.178) [-294.149] * (-290.773) (-289.822) (-288.294) [-288.971] -- 0:00:38
      340000 -- (-289.595) (-292.948) [-289.661] (-291.715) * (-287.720) (-292.401) [-287.727] (-288.252) -- 0:00:38

      Average standard deviation of split frequencies: 0.012617

      340500 -- [-287.586] (-291.306) (-289.369) (-287.555) * (-288.420) [-289.328] (-290.468) (-290.637) -- 0:00:38
      341000 -- (-288.302) [-288.986] (-290.327) (-288.420) * [-292.384] (-289.137) (-293.170) (-290.870) -- 0:00:38
      341500 -- (-288.905) [-288.861] (-289.672) (-288.920) * [-291.979] (-288.986) (-291.394) (-289.875) -- 0:00:38
      342000 -- (-291.673) [-288.360] (-289.251) (-289.318) * (-288.367) [-290.284] (-292.046) (-289.772) -- 0:00:38
      342500 -- (-287.442) (-287.925) [-289.685] (-289.859) * (-291.654) (-292.411) [-290.490] (-295.397) -- 0:00:38
      343000 -- (-291.717) (-290.634) (-287.723) [-288.509] * (-291.904) (-289.151) (-292.085) [-292.143] -- 0:00:38
      343500 -- (-290.037) (-291.943) (-288.253) [-288.953] * (-289.429) [-290.872] (-290.621) (-288.880) -- 0:00:38
      344000 -- (-288.082) (-292.040) [-290.348] (-288.908) * (-289.232) [-288.698] (-290.558) (-288.501) -- 0:00:38
      344500 -- (-288.878) (-290.584) [-292.772] (-288.645) * (-289.470) [-288.389] (-289.535) (-288.015) -- 0:00:38
      345000 -- (-289.480) [-288.851] (-289.838) (-288.338) * (-288.895) (-290.614) [-288.393] (-288.210) -- 0:00:37

      Average standard deviation of split frequencies: 0.012182

      345500 -- [-289.333] (-293.734) (-290.444) (-288.422) * (-289.369) [-290.340] (-290.223) (-290.559) -- 0:00:37
      346000 -- (-296.973) (-288.136) (-292.059) [-291.375] * (-290.550) (-288.669) [-289.343] (-289.125) -- 0:00:37
      346500 -- (-291.205) (-287.719) [-290.483] (-289.161) * (-289.990) (-293.492) [-288.781] (-290.188) -- 0:00:37
      347000 -- (-288.342) (-290.694) [-288.901] (-290.643) * [-290.120] (-296.467) (-291.583) (-290.401) -- 0:00:37
      347500 -- (-290.701) [-288.538] (-288.956) (-289.006) * (-287.862) [-287.663] (-290.870) (-291.738) -- 0:00:37
      348000 -- (-290.080) (-287.693) (-291.844) [-289.837] * [-288.482] (-287.801) (-287.891) (-294.451) -- 0:00:37
      348500 -- (-288.477) (-289.648) (-289.974) [-288.665] * (-290.846) (-291.085) [-291.401] (-290.615) -- 0:00:37
      349000 -- [-292.817] (-287.683) (-290.293) (-288.151) * (-291.092) [-292.372] (-292.019) (-290.561) -- 0:00:37
      349500 -- (-289.441) (-296.660) (-291.102) [-288.192] * [-291.440] (-288.756) (-289.221) (-287.801) -- 0:00:39
      350000 -- (-291.062) (-288.914) [-291.876] (-288.196) * (-289.537) (-289.591) [-292.534] (-288.657) -- 0:00:39

      Average standard deviation of split frequencies: 0.012020

      350500 -- (-289.560) [-289.025] (-287.922) (-288.337) * (-294.166) (-289.427) (-291.099) [-288.950] -- 0:00:38
      351000 -- (-289.933) [-289.503] (-288.776) (-290.669) * [-289.242] (-290.395) (-290.017) (-290.679) -- 0:00:38
      351500 -- (-289.793) (-291.390) [-288.580] (-288.367) * (-287.257) [-288.978] (-289.946) (-289.263) -- 0:00:38
      352000 -- [-287.700] (-288.097) (-288.528) (-287.501) * (-288.596) (-288.734) [-290.976] (-288.499) -- 0:00:38
      352500 -- [-289.800] (-289.737) (-289.234) (-292.015) * (-287.683) (-288.774) (-289.335) [-289.241] -- 0:00:38
      353000 -- (-290.394) (-294.629) [-288.268] (-289.156) * (-288.363) (-288.128) (-288.942) [-290.010] -- 0:00:38
      353500 -- (-291.058) (-297.581) [-288.609] (-290.427) * (-290.411) (-292.232) (-293.981) [-288.779] -- 0:00:38
      354000 -- [-290.328] (-294.110) (-290.584) (-289.578) * (-293.993) (-288.294) [-292.408] (-287.975) -- 0:00:38
      354500 -- (-288.129) (-290.006) [-288.456] (-289.097) * (-290.713) [-288.009] (-291.748) (-291.153) -- 0:00:38
      355000 -- (-290.087) (-293.773) [-287.184] (-291.220) * [-294.590] (-288.895) (-288.139) (-290.262) -- 0:00:38

      Average standard deviation of split frequencies: 0.013242

      355500 -- [-289.124] (-288.523) (-290.714) (-289.099) * (-290.863) [-287.971] (-288.909) (-288.870) -- 0:00:38
      356000 -- (-287.725) (-290.006) (-287.195) [-289.145] * (-296.217) (-291.809) [-295.696] (-288.900) -- 0:00:37
      356500 -- (-287.746) (-297.015) (-288.080) [-288.513] * (-291.670) (-289.754) (-292.663) [-290.600] -- 0:00:37
      357000 -- [-289.804] (-290.251) (-289.119) (-292.587) * (-289.934) (-288.016) (-290.233) [-288.387] -- 0:00:37
      357500 -- [-288.517] (-289.097) (-288.372) (-290.650) * [-288.363] (-288.618) (-291.707) (-289.548) -- 0:00:37
      358000 -- [-288.405] (-297.259) (-290.321) (-290.798) * (-290.346) (-287.965) (-291.483) [-290.726] -- 0:00:37
      358500 -- (-289.627) (-289.823) (-288.227) [-288.715] * [-291.348] (-288.461) (-289.800) (-293.237) -- 0:00:37
      359000 -- (-288.497) (-290.118) [-290.696] (-290.723) * [-290.964] (-289.110) (-290.285) (-293.553) -- 0:00:37
      359500 -- [-292.597] (-292.221) (-291.454) (-290.548) * (-288.458) [-287.829] (-289.756) (-288.508) -- 0:00:37
      360000 -- (-288.515) (-292.407) [-288.613] (-291.345) * (-287.730) (-289.477) [-290.424] (-291.983) -- 0:00:37

      Average standard deviation of split frequencies: 0.012378

      360500 -- [-289.780] (-290.371) (-289.222) (-287.476) * (-288.815) (-292.548) [-289.187] (-289.492) -- 0:00:37
      361000 -- (-291.859) (-289.056) (-291.247) [-288.263] * (-287.597) (-288.874) (-294.317) [-288.768] -- 0:00:37
      361500 -- [-289.734] (-289.330) (-288.518) (-291.158) * (-291.490) (-291.855) [-288.667] (-287.611) -- 0:00:37
      362000 -- (-288.301) (-292.226) [-287.820] (-292.932) * (-289.407) (-289.361) [-287.829] (-287.270) -- 0:00:37
      362500 -- [-288.663] (-290.575) (-289.878) (-292.092) * (-289.369) (-288.479) (-290.633) [-287.793] -- 0:00:36
      363000 -- (-288.185) [-292.752] (-289.369) (-292.567) * (-288.341) (-287.883) [-289.195] (-291.178) -- 0:00:36
      363500 -- (-287.611) (-292.111) (-288.000) [-295.978] * [-289.286] (-287.645) (-287.976) (-292.078) -- 0:00:36
      364000 -- (-288.610) [-291.887] (-288.796) (-288.084) * [-291.672] (-290.110) (-290.816) (-290.547) -- 0:00:36
      364500 -- (-289.408) [-289.115] (-288.155) (-290.230) * (-290.363) (-287.976) [-289.969] (-290.072) -- 0:00:36
      365000 -- (-292.751) (-289.368) (-290.956) [-290.932] * [-288.998] (-291.032) (-287.352) (-289.138) -- 0:00:36

      Average standard deviation of split frequencies: 0.012122

      365500 -- [-289.274] (-289.947) (-288.483) (-290.356) * [-287.981] (-289.120) (-290.002) (-289.879) -- 0:00:36
      366000 -- (-289.476) [-290.038] (-291.351) (-290.169) * (-288.849) (-290.174) (-290.830) [-292.612] -- 0:00:36
      366500 -- [-290.270] (-288.348) (-289.567) (-296.183) * (-290.752) (-291.608) (-289.948) [-288.061] -- 0:00:36
      367000 -- [-290.139] (-288.775) (-288.443) (-291.163) * [-290.919] (-289.144) (-291.516) (-289.102) -- 0:00:37
      367500 -- (-290.452) [-290.224] (-288.833) (-295.485) * (-288.006) [-290.760] (-288.975) (-288.661) -- 0:00:37
      368000 -- (-291.417) (-289.051) (-290.856) [-290.190] * [-289.400] (-292.351) (-289.985) (-288.816) -- 0:00:37
      368500 -- (-290.058) (-290.387) [-289.164] (-289.712) * (-291.014) [-289.014] (-293.698) (-291.087) -- 0:00:37
      369000 -- (-288.630) [-291.491] (-290.444) (-289.703) * (-297.012) (-290.796) [-289.933] (-289.869) -- 0:00:37
      369500 -- (-289.599) (-289.697) [-291.760] (-287.905) * [-294.852] (-287.970) (-289.267) (-291.258) -- 0:00:37
      370000 -- [-287.832] (-292.921) (-289.196) (-291.553) * (-288.837) (-288.983) [-289.790] (-295.423) -- 0:00:37

      Average standard deviation of split frequencies: 0.011745

      370500 -- (-288.886) (-288.696) [-289.348] (-289.426) * [-287.664] (-291.674) (-288.506) (-291.339) -- 0:00:37
      371000 -- (-293.580) (-288.735) [-290.140] (-288.082) * (-289.108) (-290.869) [-287.982] (-288.509) -- 0:00:37
      371500 -- (-292.315) (-287.507) (-292.847) [-287.993] * (-288.222) [-288.367] (-288.482) (-289.984) -- 0:00:37
      372000 -- [-287.965] (-291.290) (-288.583) (-289.124) * (-289.529) [-288.122] (-289.690) (-289.303) -- 0:00:37
      372500 -- (-293.602) [-288.414] (-287.648) (-288.420) * (-288.563) (-291.015) (-291.433) [-290.736] -- 0:00:37
      373000 -- (-288.766) (-287.796) (-289.086) [-288.203] * (-288.601) (-288.937) (-288.892) [-292.357] -- 0:00:36
      373500 -- (-289.698) [-289.585] (-289.961) (-289.241) * (-289.659) (-289.351) (-288.784) [-290.425] -- 0:00:36
      374000 -- (-290.996) (-289.212) [-289.108] (-287.673) * [-295.306] (-289.022) (-291.205) (-288.496) -- 0:00:36
      374500 -- (-291.227) [-290.745] (-288.651) (-288.061) * (-289.152) (-287.669) [-287.560] (-290.023) -- 0:00:36
      375000 -- [-288.816] (-289.606) (-287.183) (-291.147) * (-289.486) (-289.151) (-290.596) [-289.098] -- 0:00:36

      Average standard deviation of split frequencies: 0.011431

      375500 -- [-288.138] (-289.679) (-289.677) (-293.384) * (-289.581) (-287.769) (-289.031) [-292.930] -- 0:00:36
      376000 -- (-287.409) (-290.534) (-290.038) [-289.761] * (-289.198) [-287.987] (-291.702) (-290.074) -- 0:00:36
      376500 -- (-288.858) (-288.753) [-290.074] (-291.159) * (-290.963) (-291.418) (-289.856) [-287.830] -- 0:00:36
      377000 -- (-293.857) [-288.667] (-290.248) (-288.796) * (-288.583) (-290.014) [-287.307] (-288.866) -- 0:00:36
      377500 -- [-292.088] (-291.831) (-288.265) (-290.321) * [-290.553] (-289.869) (-288.712) (-290.544) -- 0:00:36
      378000 -- (-292.038) (-290.572) (-288.572) [-291.535] * (-290.891) [-289.705] (-288.955) (-288.017) -- 0:00:36
      378500 -- (-291.238) (-290.200) [-288.986] (-291.931) * (-290.717) (-288.024) (-288.736) [-288.083] -- 0:00:36
      379000 -- (-289.074) [-287.421] (-290.296) (-290.174) * (-290.498) (-289.945) [-289.001] (-287.582) -- 0:00:36
      379500 -- (-289.709) (-294.191) [-287.780] (-289.327) * [-292.724] (-288.022) (-293.340) (-288.104) -- 0:00:35
      380000 -- [-289.725] (-290.026) (-289.286) (-290.271) * (-291.920) [-290.887] (-290.285) (-291.289) -- 0:00:35

      Average standard deviation of split frequencies: 0.012311

      380500 -- (-295.519) (-293.598) [-292.607] (-290.859) * (-294.551) (-295.317) [-288.914] (-289.209) -- 0:00:35
      381000 -- (-290.935) (-294.899) (-292.436) [-292.078] * (-287.309) [-292.531] (-291.540) (-288.678) -- 0:00:35
      381500 -- (-293.731) (-291.554) (-291.617) [-289.560] * [-289.649] (-290.295) (-287.839) (-291.127) -- 0:00:35
      382000 -- (-289.556) (-291.521) [-288.401] (-291.114) * (-291.590) [-288.946] (-291.561) (-291.655) -- 0:00:35
      382500 -- [-294.132] (-287.804) (-289.149) (-290.906) * (-287.699) [-288.050] (-289.223) (-297.140) -- 0:00:35
      383000 -- (-289.422) [-288.438] (-295.948) (-289.670) * (-287.866) (-288.106) [-288.914] (-296.011) -- 0:00:35
      383500 -- [-289.606] (-296.881) (-288.687) (-290.618) * (-293.205) (-287.997) [-291.065] (-291.236) -- 0:00:35
      384000 -- [-288.993] (-288.109) (-287.558) (-289.620) * (-292.054) (-287.593) [-288.211] (-289.290) -- 0:00:35
      384500 -- (-289.401) (-291.026) [-288.469] (-294.387) * (-288.920) [-289.992] (-291.903) (-291.747) -- 0:00:36
      385000 -- (-290.110) (-290.855) [-290.238] (-288.871) * (-287.272) (-291.027) (-291.090) [-289.933] -- 0:00:36

      Average standard deviation of split frequencies: 0.012428

      385500 -- (-289.113) (-289.684) (-292.239) [-290.454] * [-289.194] (-290.104) (-288.406) (-288.449) -- 0:00:36
      386000 -- (-287.648) (-293.425) [-288.547] (-288.728) * (-288.478) [-289.119] (-288.716) (-288.145) -- 0:00:36
      386500 -- (-290.984) (-287.782) [-289.423] (-289.491) * (-291.387) (-288.982) [-292.432] (-288.928) -- 0:00:36
      387000 -- (-289.161) (-290.629) [-288.312] (-289.926) * (-289.035) (-289.902) (-298.076) [-288.203] -- 0:00:36
      387500 -- (-288.227) (-289.491) [-288.664] (-289.737) * (-291.186) [-289.750] (-293.139) (-291.447) -- 0:00:36
      388000 -- (-289.666) (-289.922) [-287.885] (-290.747) * (-288.045) [-287.952] (-290.540) (-288.434) -- 0:00:36
      388500 -- (-290.570) [-288.665] (-291.686) (-288.452) * (-289.008) (-289.174) [-292.616] (-295.092) -- 0:00:36
      389000 -- (-289.511) (-289.519) [-291.125] (-288.083) * (-288.599) (-290.512) (-289.708) [-287.644] -- 0:00:36
      389500 -- (-287.634) (-290.498) [-290.551] (-290.988) * (-289.954) [-289.540] (-289.607) (-289.352) -- 0:00:36
      390000 -- (-287.124) (-288.082) (-287.926) [-288.438] * (-290.751) (-292.042) (-291.892) [-288.091] -- 0:00:35

      Average standard deviation of split frequencies: 0.012280

      390500 -- (-289.028) (-290.423) [-288.776] (-288.004) * (-288.389) (-289.667) (-292.224) [-288.719] -- 0:00:35
      391000 -- (-289.239) [-289.946] (-292.370) (-288.031) * (-289.679) (-288.749) (-297.015) [-288.703] -- 0:00:35
      391500 -- (-288.978) (-289.051) [-289.809] (-289.200) * [-287.985] (-291.922) (-293.899) (-290.602) -- 0:00:35
      392000 -- (-287.338) (-294.419) [-290.623] (-291.542) * (-289.324) (-292.575) [-289.523] (-287.850) -- 0:00:35
      392500 -- (-291.708) (-288.473) (-288.105) [-288.302] * [-290.043] (-289.409) (-290.830) (-289.145) -- 0:00:35
      393000 -- [-293.066] (-288.245) (-287.225) (-290.191) * (-289.236) [-291.970] (-290.799) (-289.627) -- 0:00:35
      393500 -- (-288.438) (-289.260) (-287.870) [-288.981] * (-290.463) [-288.963] (-288.199) (-293.431) -- 0:00:35
      394000 -- (-292.255) (-290.913) (-292.485) [-288.714] * [-289.292] (-294.282) (-290.590) (-288.193) -- 0:00:35
      394500 -- (-291.465) (-291.374) [-289.623] (-288.783) * [-297.975] (-292.908) (-290.060) (-288.715) -- 0:00:35
      395000 -- (-287.486) (-290.535) (-293.792) [-288.490] * (-287.916) [-290.005] (-293.285) (-291.616) -- 0:00:35

      Average standard deviation of split frequencies: 0.012254

      395500 -- (-289.241) (-287.770) (-289.094) [-290.098] * (-287.998) (-291.022) (-288.335) [-289.177] -- 0:00:35
      396000 -- (-288.570) (-291.160) (-287.541) [-290.046] * (-288.766) [-290.288] (-288.722) (-289.925) -- 0:00:35
      396500 -- (-289.537) (-294.448) (-289.059) [-288.888] * [-292.985] (-291.223) (-288.613) (-287.720) -- 0:00:35
      397000 -- (-288.314) [-290.704] (-291.898) (-287.668) * (-290.740) [-289.774] (-289.749) (-287.424) -- 0:00:34
      397500 -- (-293.229) [-291.407] (-289.137) (-287.439) * (-289.408) (-289.489) (-293.733) [-290.457] -- 0:00:34
      398000 -- (-296.818) (-289.184) [-293.548] (-290.549) * [-288.745] (-288.907) (-288.663) (-288.158) -- 0:00:34
      398500 -- (-290.421) (-290.757) [-289.958] (-291.890) * (-288.669) [-288.629] (-290.578) (-290.841) -- 0:00:34
      399000 -- (-290.646) [-289.371] (-288.258) (-290.387) * (-287.961) (-288.726) [-292.701] (-288.027) -- 0:00:34
      399500 -- [-290.080] (-288.915) (-292.814) (-294.583) * (-288.871) (-287.818) (-287.776) [-287.815] -- 0:00:34
      400000 -- (-291.703) [-289.740] (-288.083) (-290.478) * (-287.889) (-288.211) [-289.164] (-288.097) -- 0:00:34

      Average standard deviation of split frequencies: 0.012665

      400500 -- (-289.219) (-288.999) (-289.169) [-287.591] * (-288.069) (-288.820) [-290.200] (-290.004) -- 0:00:34
      401000 -- (-289.177) (-288.118) (-290.947) [-290.952] * (-289.379) (-288.726) (-288.392) [-289.571] -- 0:00:34
      401500 -- (-292.269) [-288.255] (-288.189) (-290.822) * (-290.908) [-291.392] (-291.166) (-289.596) -- 0:00:35
      402000 -- (-288.687) (-289.410) [-291.315] (-288.657) * (-289.873) (-292.371) (-288.833) [-290.246] -- 0:00:35
      402500 -- (-288.117) (-292.575) [-292.976] (-292.453) * (-288.346) (-293.822) (-288.433) [-290.159] -- 0:00:35
      403000 -- (-290.549) (-289.791) [-289.961] (-291.756) * [-289.642] (-292.094) (-287.830) (-291.777) -- 0:00:35
      403500 -- (-295.370) [-288.910] (-291.859) (-290.058) * (-289.706) (-288.156) (-287.488) [-289.862] -- 0:00:35
      404000 -- (-291.856) (-288.031) [-290.119] (-288.871) * [-288.755] (-288.542) (-288.022) (-290.667) -- 0:00:35
      404500 -- [-288.556] (-291.039) (-289.426) (-288.483) * [-290.981] (-289.569) (-289.840) (-289.525) -- 0:00:35
      405000 -- (-293.208) [-289.897] (-287.453) (-290.438) * (-290.382) (-288.288) (-288.813) [-288.515] -- 0:00:35

      Average standard deviation of split frequencies: 0.012256

      405500 -- (-289.980) (-289.550) [-290.677] (-289.791) * (-290.638) [-288.878] (-289.757) (-288.472) -- 0:00:35
      406000 -- [-288.666] (-289.769) (-288.517) (-291.444) * (-293.784) (-288.847) [-288.342] (-289.641) -- 0:00:35
      406500 -- (-294.701) (-289.423) [-288.943] (-287.856) * (-291.528) (-288.822) [-288.465] (-288.795) -- 0:00:35
      407000 -- (-290.204) (-289.121) [-288.102] (-287.579) * (-289.446) (-289.592) [-289.915] (-288.898) -- 0:00:34
      407500 -- (-289.810) (-292.001) [-288.838] (-293.051) * (-289.280) [-290.223] (-290.010) (-288.599) -- 0:00:34
      408000 -- [-291.655] (-292.017) (-287.350) (-291.847) * (-290.243) (-288.332) (-291.544) [-291.705] -- 0:00:34
      408500 -- (-289.463) (-287.543) [-291.009] (-290.982) * (-291.086) (-290.680) [-288.567] (-287.955) -- 0:00:34
      409000 -- [-289.452] (-290.262) (-290.545) (-290.019) * (-288.953) (-288.701) [-290.220] (-288.257) -- 0:00:34
      409500 -- [-290.029] (-289.505) (-288.024) (-287.797) * (-288.029) (-288.500) [-288.486] (-290.553) -- 0:00:34
      410000 -- [-288.322] (-289.042) (-289.800) (-289.399) * [-288.714] (-288.353) (-288.592) (-289.507) -- 0:00:34

      Average standard deviation of split frequencies: 0.011989

      410500 -- (-287.352) (-289.143) (-289.265) [-289.281] * (-288.672) (-291.418) [-289.132] (-288.525) -- 0:00:34
      411000 -- (-288.864) (-296.386) (-287.709) [-289.976] * (-291.011) (-289.616) [-289.564] (-290.938) -- 0:00:34
      411500 -- (-289.003) (-293.646) [-289.700] (-291.755) * [-289.399] (-290.457) (-289.584) (-292.297) -- 0:00:34
      412000 -- (-288.565) (-291.236) (-288.844) [-288.999] * [-287.790] (-289.125) (-289.876) (-294.078) -- 0:00:34
      412500 -- (-289.683) [-292.068] (-294.037) (-289.613) * [-289.417] (-287.453) (-292.721) (-290.653) -- 0:00:34
      413000 -- [-290.444] (-289.825) (-292.890) (-292.065) * [-289.103] (-291.013) (-289.475) (-291.580) -- 0:00:34
      413500 -- (-289.717) [-290.621] (-295.310) (-289.084) * [-288.142] (-289.282) (-289.418) (-293.109) -- 0:00:34
      414000 -- (-288.166) (-287.132) [-293.922] (-295.375) * [-289.476] (-291.127) (-291.362) (-291.387) -- 0:00:33
      414500 -- (-292.615) [-289.604] (-293.503) (-290.339) * (-290.372) (-289.702) (-288.095) [-289.941] -- 0:00:33
      415000 -- (-288.859) (-292.362) [-291.183] (-297.417) * (-287.276) (-289.164) [-291.611] (-290.342) -- 0:00:33

      Average standard deviation of split frequencies: 0.012065

      415500 -- (-287.962) [-289.428] (-290.565) (-287.971) * (-289.580) (-288.743) (-288.081) [-288.773] -- 0:00:33
      416000 -- (-288.766) [-289.276] (-288.127) (-294.918) * (-289.050) (-289.610) (-289.252) [-288.895] -- 0:00:33
      416500 -- (-289.862) (-287.964) (-290.416) [-289.425] * (-288.697) [-287.631] (-289.624) (-291.644) -- 0:00:33
      417000 -- [-287.759] (-289.294) (-290.652) (-290.282) * (-289.816) [-288.615] (-289.674) (-287.749) -- 0:00:33
      417500 -- (-287.838) [-289.489] (-290.869) (-290.731) * (-288.821) [-292.081] (-291.381) (-287.406) -- 0:00:33
      418000 -- (-288.422) (-290.789) (-291.151) [-288.425] * (-287.733) (-289.773) [-294.268] (-291.705) -- 0:00:33
      418500 -- (-288.258) (-287.748) [-292.571] (-288.868) * [-287.417] (-288.578) (-289.744) (-290.294) -- 0:00:34
      419000 -- (-291.923) (-289.273) (-290.300) [-289.181] * (-288.771) [-287.944] (-291.451) (-288.072) -- 0:00:34
      419500 -- (-289.254) [-289.159] (-288.615) (-292.235) * [-287.347] (-288.016) (-291.173) (-287.636) -- 0:00:34
      420000 -- (-288.347) [-289.488] (-288.147) (-288.946) * [-287.862] (-290.914) (-288.258) (-288.663) -- 0:00:34

      Average standard deviation of split frequencies: 0.011931

      420500 -- (-289.036) [-288.367] (-292.056) (-288.206) * [-288.474] (-290.001) (-289.821) (-289.140) -- 0:00:34
      421000 -- (-289.561) (-289.831) (-290.188) [-289.333] * [-291.897] (-291.435) (-291.227) (-290.533) -- 0:00:34
      421500 -- (-291.973) [-288.276] (-290.919) (-291.759) * (-296.013) (-291.490) [-292.102] (-292.155) -- 0:00:34
      422000 -- (-287.784) (-289.675) (-289.362) [-291.200] * [-294.570] (-290.347) (-290.330) (-288.369) -- 0:00:34
      422500 -- (-290.349) (-292.840) (-291.184) [-288.552] * [-289.295] (-289.105) (-290.457) (-289.526) -- 0:00:34
      423000 -- (-289.665) [-289.529] (-288.170) (-288.490) * [-289.359] (-291.319) (-289.352) (-289.946) -- 0:00:34
      423500 -- [-289.383] (-288.778) (-288.074) (-289.755) * [-288.721] (-292.742) (-288.192) (-294.739) -- 0:00:34
      424000 -- [-292.614] (-288.650) (-290.077) (-290.107) * [-289.518] (-288.754) (-291.613) (-291.548) -- 0:00:33
      424500 -- (-289.506) (-290.502) (-290.742) [-288.169] * (-290.104) (-287.996) [-289.372] (-287.948) -- 0:00:33
      425000 -- (-288.743) (-291.198) (-290.336) [-290.120] * [-289.499] (-288.253) (-288.549) (-292.533) -- 0:00:33

      Average standard deviation of split frequencies: 0.012303

      425500 -- (-289.425) (-289.364) (-288.309) [-288.349] * (-290.673) (-288.496) [-292.823] (-288.818) -- 0:00:33
      426000 -- (-290.084) (-287.629) (-289.551) [-289.026] * (-291.056) (-289.025) [-291.193] (-289.114) -- 0:00:33
      426500 -- [-288.643] (-290.301) (-289.776) (-292.286) * [-288.446] (-288.434) (-288.614) (-289.322) -- 0:00:33
      427000 -- (-288.667) [-287.614] (-292.504) (-290.617) * (-288.967) (-289.022) (-287.550) [-288.572] -- 0:00:33
      427500 -- [-288.185] (-288.908) (-288.795) (-290.154) * (-289.438) (-288.116) [-290.434] (-290.160) -- 0:00:33
      428000 -- [-287.333] (-289.485) (-291.030) (-288.305) * [-287.979] (-288.542) (-288.067) (-289.502) -- 0:00:33
      428500 -- (-290.372) [-292.603] (-290.010) (-294.120) * (-288.728) [-288.278] (-291.755) (-288.717) -- 0:00:33
      429000 -- [-289.935] (-288.911) (-288.947) (-290.504) * [-289.933] (-289.543) (-294.008) (-289.817) -- 0:00:33
      429500 -- (-289.458) (-289.076) [-288.133] (-287.607) * (-290.838) [-293.257] (-290.685) (-288.750) -- 0:00:33
      430000 -- (-292.415) (-288.721) (-291.658) [-288.129] * (-288.124) [-288.323] (-290.732) (-287.811) -- 0:00:33

      Average standard deviation of split frequencies: 0.012383

      430500 -- (-290.854) [-290.730] (-290.899) (-288.295) * [-288.022] (-289.149) (-289.728) (-293.165) -- 0:00:33
      431000 -- [-289.424] (-288.307) (-292.734) (-287.909) * [-288.656] (-287.802) (-288.278) (-289.180) -- 0:00:33
      431500 -- [-288.903] (-288.506) (-290.426) (-287.754) * [-288.434] (-288.424) (-290.677) (-289.215) -- 0:00:32
      432000 -- [-287.751] (-289.903) (-289.207) (-289.838) * (-289.361) (-289.764) [-288.275] (-288.252) -- 0:00:32
      432500 -- [-287.727] (-288.362) (-288.384) (-288.475) * (-287.901) (-289.593) (-289.616) [-290.920] -- 0:00:32
      433000 -- (-287.818) (-291.449) (-288.822) [-290.460] * (-289.993) (-290.149) [-289.797] (-289.548) -- 0:00:32
      433500 -- [-288.910] (-290.535) (-291.145) (-291.994) * [-287.213] (-290.460) (-290.365) (-287.791) -- 0:00:32
      434000 -- (-288.287) (-289.760) [-291.206] (-294.004) * [-289.737] (-291.491) (-288.282) (-289.341) -- 0:00:32
      434500 -- (-289.929) (-292.337) [-288.407] (-293.893) * (-287.709) [-291.002] (-291.236) (-288.511) -- 0:00:32
      435000 -- [-288.844] (-288.316) (-291.457) (-292.640) * (-293.471) [-289.658] (-290.562) (-288.327) -- 0:00:32

      Average standard deviation of split frequencies: 0.012164

      435500 -- (-288.415) [-287.743] (-291.151) (-288.258) * (-289.418) (-289.963) (-288.913) [-288.186] -- 0:00:32
      436000 -- (-288.470) [-287.224] (-288.649) (-289.613) * [-289.197] (-289.653) (-288.514) (-287.683) -- 0:00:33
      436500 -- (-292.411) [-288.920] (-290.312) (-293.673) * (-288.313) (-288.066) [-289.608] (-289.561) -- 0:00:33
      437000 -- [-290.056] (-288.249) (-290.889) (-287.700) * (-290.092) [-289.370] (-289.764) (-287.842) -- 0:00:33
      437500 -- [-288.114] (-288.126) (-290.397) (-288.769) * [-288.517] (-290.235) (-289.160) (-288.079) -- 0:00:33
      438000 -- (-288.461) (-292.229) (-288.979) [-290.311] * (-290.327) [-288.155] (-292.660) (-291.300) -- 0:00:33
      438500 -- [-290.302] (-291.018) (-288.359) (-289.622) * [-289.471] (-289.638) (-293.186) (-292.501) -- 0:00:33
      439000 -- [-290.734] (-289.898) (-289.127) (-287.586) * (-290.400) (-287.930) [-288.911] (-288.161) -- 0:00:33
      439500 -- [-288.633] (-288.654) (-287.873) (-289.142) * (-290.581) (-289.289) [-288.587] (-290.796) -- 0:00:33
      440000 -- (-288.512) (-288.965) [-293.504] (-289.391) * (-289.068) (-291.315) [-288.534] (-290.973) -- 0:00:33

      Average standard deviation of split frequencies: 0.012235

      440500 -- (-289.473) [-288.700] (-296.230) (-291.916) * (-292.093) (-288.077) [-292.569] (-290.563) -- 0:00:33
      441000 -- (-289.245) (-288.330) [-288.367] (-291.544) * (-288.853) (-288.690) (-291.582) [-288.165] -- 0:00:32
      441500 -- (-293.358) [-289.911] (-290.179) (-291.529) * (-290.443) (-288.265) (-292.640) [-288.417] -- 0:00:32
      442000 -- (-289.436) [-290.376] (-290.272) (-287.800) * (-289.126) (-292.511) [-289.373] (-290.064) -- 0:00:32
      442500 -- [-289.312] (-290.999) (-294.073) (-289.934) * (-287.818) (-290.472) [-290.145] (-292.591) -- 0:00:32
      443000 -- (-292.652) [-289.118] (-292.456) (-290.867) * (-287.785) [-288.408] (-289.501) (-290.568) -- 0:00:32
      443500 -- (-295.820) (-289.229) [-291.504] (-287.823) * [-291.631] (-288.554) (-290.911) (-292.486) -- 0:00:32
      444000 -- (-298.067) (-291.494) (-291.611) [-287.390] * [-288.228] (-288.676) (-289.828) (-289.984) -- 0:00:32
      444500 -- (-290.061) [-289.808] (-291.343) (-289.515) * (-287.527) (-289.676) (-289.418) [-289.573] -- 0:00:32
      445000 -- [-288.163] (-292.330) (-288.365) (-287.651) * (-288.136) (-288.255) (-288.769) [-290.226] -- 0:00:32

      Average standard deviation of split frequencies: 0.011362

      445500 -- (-288.271) (-288.754) (-292.621) [-290.920] * [-293.033] (-292.774) (-290.658) (-290.728) -- 0:00:32
      446000 -- (-292.741) (-290.178) [-289.253] (-290.318) * (-290.973) (-288.552) [-289.336] (-291.326) -- 0:00:32
      446500 -- (-289.492) (-292.662) [-291.199] (-290.609) * (-289.059) (-290.210) (-290.616) [-288.030] -- 0:00:32
      447000 -- (-292.132) (-293.981) [-291.792] (-292.305) * (-289.072) (-291.644) [-289.373] (-289.044) -- 0:00:32
      447500 -- (-290.694) (-291.258) (-288.381) [-289.580] * (-293.735) (-292.745) (-289.788) [-288.460] -- 0:00:32
      448000 -- (-291.654) (-289.994) [-288.006] (-288.633) * [-290.225] (-288.770) (-289.000) (-291.214) -- 0:00:32
      448500 -- (-288.820) (-289.673) (-288.251) [-288.881] * (-289.104) (-289.092) [-291.751] (-290.972) -- 0:00:31
      449000 -- (-289.142) [-291.885] (-288.087) (-290.008) * [-288.108] (-289.521) (-291.281) (-288.756) -- 0:00:31
      449500 -- (-290.059) (-288.312) [-287.577] (-291.156) * [-289.885] (-290.679) (-288.260) (-290.524) -- 0:00:31
      450000 -- (-289.905) (-290.512) [-289.350] (-290.981) * (-290.559) (-291.479) [-290.676] (-287.706) -- 0:00:31

      Average standard deviation of split frequencies: 0.011310

      450500 -- (-288.942) (-289.691) (-290.157) [-290.498] * (-298.104) (-289.221) (-289.292) [-289.075] -- 0:00:31
      451000 -- (-289.718) (-293.892) (-291.674) [-288.806] * (-292.511) [-289.397] (-288.337) (-287.866) -- 0:00:31
      451500 -- (-289.705) (-290.444) (-289.859) [-288.005] * [-288.640] (-288.547) (-297.483) (-289.547) -- 0:00:31
      452000 -- [-288.470] (-289.398) (-288.423) (-290.154) * (-294.230) (-289.671) (-288.774) [-289.061] -- 0:00:31
      452500 -- (-287.501) (-294.022) (-289.585) [-287.504] * (-289.165) (-287.586) (-289.626) [-289.053] -- 0:00:31
      453000 -- (-289.240) [-288.330] (-289.639) (-293.566) * (-288.739) (-288.029) [-291.112] (-288.942) -- 0:00:31
      453500 -- (-290.513) (-291.713) [-287.782] (-289.497) * (-288.095) [-288.201] (-288.566) (-291.017) -- 0:00:32
      454000 -- (-290.621) (-288.387) [-288.560] (-290.642) * (-288.464) (-290.771) [-288.401] (-289.729) -- 0:00:32
      454500 -- (-289.667) [-288.971] (-290.332) (-290.963) * (-289.665) [-288.940] (-289.895) (-288.317) -- 0:00:32
      455000 -- (-290.492) [-290.800] (-287.429) (-290.539) * (-290.522) [-288.659] (-291.450) (-288.573) -- 0:00:32

      Average standard deviation of split frequencies: 0.011888

      455500 -- (-289.051) [-288.317] (-289.690) (-287.687) * (-290.443) (-290.025) (-296.677) [-288.621] -- 0:00:32
      456000 -- (-292.243) (-289.909) [-290.641] (-288.210) * (-289.425) [-291.858] (-289.346) (-288.678) -- 0:00:32
      456500 -- [-290.327] (-289.475) (-288.367) (-295.333) * (-289.834) [-288.280] (-292.880) (-289.164) -- 0:00:32
      457000 -- (-293.436) (-290.223) [-289.164] (-287.739) * [-288.168] (-289.693) (-289.890) (-287.277) -- 0:00:32
      457500 -- (-293.918) (-288.983) (-289.419) [-288.636] * (-288.953) [-288.577] (-289.091) (-288.887) -- 0:00:32
      458000 -- (-292.895) [-288.168] (-289.795) (-289.648) * (-291.732) (-291.221) (-290.199) [-289.230] -- 0:00:31
      458500 -- (-293.388) [-289.091] (-292.284) (-291.078) * (-290.138) [-291.835] (-289.467) (-289.138) -- 0:00:31
      459000 -- [-291.534] (-291.121) (-288.950) (-292.611) * (-291.588) (-288.529) [-287.519] (-289.918) -- 0:00:31
      459500 -- (-293.721) [-289.919] (-290.491) (-292.354) * (-291.156) (-287.277) (-288.507) [-289.293] -- 0:00:31
      460000 -- (-290.710) [-288.471] (-292.229) (-289.935) * (-297.991) (-289.290) (-291.053) [-288.174] -- 0:00:31

      Average standard deviation of split frequencies: 0.011256

      460500 -- (-291.384) (-289.186) (-295.623) [-288.221] * (-288.510) (-289.761) [-287.790] (-291.948) -- 0:00:31
      461000 -- (-294.254) [-289.574] (-292.033) (-287.724) * (-288.271) (-291.394) [-290.432] (-289.320) -- 0:00:31
      461500 -- (-291.356) (-291.129) [-289.144] (-289.240) * [-290.321] (-294.491) (-293.142) (-289.533) -- 0:00:31
      462000 -- (-289.062) (-288.918) [-290.307] (-289.996) * (-288.852) (-290.316) (-288.879) [-288.893] -- 0:00:31
      462500 -- (-290.112) (-288.831) [-288.198] (-291.007) * [-288.150] (-291.530) (-289.310) (-290.446) -- 0:00:31
      463000 -- (-289.675) [-287.333] (-288.833) (-291.074) * [-288.213] (-290.885) (-289.664) (-289.158) -- 0:00:31
      463500 -- (-289.589) (-289.182) [-287.753] (-288.279) * (-289.730) [-287.867] (-288.790) (-293.310) -- 0:00:31
      464000 -- [-287.817] (-292.470) (-290.362) (-287.814) * (-288.933) (-293.191) [-288.209] (-288.923) -- 0:00:31
      464500 -- (-291.886) (-291.881) [-288.671] (-292.655) * (-293.340) [-288.130] (-288.462) (-289.812) -- 0:00:31
      465000 -- (-293.584) (-288.491) [-290.417] (-289.364) * (-299.036) (-289.047) (-291.081) [-288.563] -- 0:00:31

      Average standard deviation of split frequencies: 0.011380

      465500 -- (-292.483) (-288.936) [-287.504] (-287.683) * (-287.837) (-292.172) [-289.230] (-289.208) -- 0:00:31
      466000 -- (-291.204) (-289.298) (-288.484) [-289.850] * (-289.891) (-290.778) [-289.686] (-287.266) -- 0:00:30
      466500 -- (-292.017) (-290.124) [-290.888] (-288.989) * (-291.055) [-290.011] (-289.504) (-290.407) -- 0:00:30
      467000 -- (-293.301) (-290.550) [-291.418] (-293.140) * [-288.572] (-287.620) (-291.034) (-291.460) -- 0:00:30
      467500 -- [-291.095] (-291.491) (-291.899) (-291.624) * [-289.903] (-290.455) (-289.610) (-288.900) -- 0:00:30
      468000 -- (-288.245) (-290.203) (-288.389) [-291.481] * [-290.733] (-289.544) (-290.209) (-288.416) -- 0:00:30
      468500 -- (-287.489) (-288.717) [-288.635] (-289.294) * (-288.117) (-289.387) (-290.331) [-288.641] -- 0:00:30
      469000 -- (-287.906) (-287.493) [-287.524] (-289.929) * (-289.841) [-288.813] (-290.807) (-287.650) -- 0:00:30
      469500 -- (-287.447) [-289.895] (-288.908) (-289.462) * (-289.363) (-290.023) (-290.244) [-290.227] -- 0:00:30
      470000 -- (-288.218) [-289.812] (-290.572) (-290.968) * (-288.979) (-288.465) (-290.143) [-292.409] -- 0:00:30

      Average standard deviation of split frequencies: 0.010767

      470500 -- (-288.383) [-290.785] (-291.610) (-292.049) * (-289.605) (-291.792) (-288.545) [-288.930] -- 0:00:31
      471000 -- (-289.180) (-295.571) (-292.273) [-287.769] * (-292.040) (-289.711) [-288.249] (-288.224) -- 0:00:31
      471500 -- (-291.070) (-290.792) (-290.334) [-287.457] * [-290.452] (-287.908) (-288.190) (-291.124) -- 0:00:31
      472000 -- (-290.882) (-289.012) (-291.775) [-290.962] * [-289.070] (-289.938) (-288.010) (-292.659) -- 0:00:31
      472500 -- (-291.649) (-289.706) (-291.616) [-290.263] * [-292.139] (-289.687) (-288.214) (-294.097) -- 0:00:31
      473000 -- (-292.679) [-289.857] (-291.253) (-289.860) * (-289.778) (-288.277) [-291.878] (-288.793) -- 0:00:31
      473500 -- [-290.753] (-288.580) (-291.742) (-289.958) * (-291.317) (-290.975) [-289.539] (-291.384) -- 0:00:31
      474000 -- (-288.024) (-287.894) (-289.235) [-291.319] * (-287.814) (-288.869) [-289.375] (-290.920) -- 0:00:31
      474500 -- (-288.941) (-287.434) [-289.187] (-290.558) * [-290.932] (-290.117) (-293.305) (-289.315) -- 0:00:31
      475000 -- (-291.092) (-288.605) (-287.553) [-290.083] * (-288.670) [-290.556] (-288.064) (-292.321) -- 0:00:30

      Average standard deviation of split frequencies: 0.011637

      475500 -- (-287.809) (-289.002) [-291.820] (-289.306) * [-289.196] (-288.507) (-290.282) (-289.352) -- 0:00:30
      476000 -- (-290.287) (-288.282) (-288.593) [-291.494] * (-292.392) [-287.482] (-289.179) (-288.470) -- 0:00:30
      476500 -- [-288.511] (-288.320) (-289.095) (-288.373) * [-288.195] (-287.788) (-290.835) (-289.173) -- 0:00:30
      477000 -- (-287.816) (-289.111) [-288.157] (-292.269) * (-289.221) (-290.146) (-288.916) [-289.044] -- 0:00:30
      477500 -- (-300.233) [-287.339] (-288.895) (-290.076) * (-289.833) (-294.100) (-288.820) [-289.644] -- 0:00:30
      478000 -- (-293.262) (-288.612) (-289.051) [-289.723] * (-289.954) [-290.046] (-288.951) (-287.390) -- 0:00:30
      478500 -- [-289.997] (-289.433) (-289.058) (-289.979) * (-288.606) (-288.679) [-288.326] (-287.418) -- 0:00:30
      479000 -- (-288.601) (-293.304) (-291.719) [-289.043] * [-288.080] (-289.545) (-289.398) (-287.644) -- 0:00:30
      479500 -- [-291.080] (-291.819) (-288.115) (-292.812) * (-288.844) (-291.583) [-290.586] (-291.317) -- 0:00:30
      480000 -- (-287.771) (-288.775) [-287.964] (-297.056) * [-288.788] (-288.832) (-289.115) (-288.997) -- 0:00:30

      Average standard deviation of split frequencies: 0.011033

      480500 -- (-289.075) (-288.995) (-290.189) [-290.056] * (-289.866) (-287.355) [-287.435] (-289.035) -- 0:00:30
      481000 -- [-289.587] (-289.062) (-290.949) (-289.646) * (-288.894) [-288.115] (-289.842) (-291.204) -- 0:00:30
      481500 -- [-287.790] (-287.965) (-291.825) (-289.407) * [-288.010] (-288.664) (-290.033) (-289.675) -- 0:00:30
      482000 -- [-288.059] (-289.014) (-289.173) (-294.528) * [-288.793] (-288.308) (-287.905) (-290.420) -- 0:00:30
      482500 -- [-290.641] (-287.950) (-291.902) (-289.088) * (-290.928) (-289.144) (-290.572) [-291.592] -- 0:00:30
      483000 -- (-288.453) (-289.433) (-287.870) [-292.644] * (-295.706) (-292.038) (-291.187) [-290.233] -- 0:00:29
      483500 -- (-289.670) [-287.773] (-290.630) (-290.376) * (-288.059) (-287.884) [-294.637] (-290.140) -- 0:00:29
      484000 -- [-289.496] (-290.348) (-290.895) (-290.744) * (-291.087) (-289.321) [-294.946] (-287.561) -- 0:00:29
      484500 -- (-290.465) (-288.985) [-291.172] (-290.442) * (-288.834) (-290.383) [-291.155] (-290.482) -- 0:00:29
      485000 -- (-289.998) [-288.197] (-288.260) (-288.741) * (-287.658) (-289.615) [-287.667] (-295.296) -- 0:00:29

      Average standard deviation of split frequencies: 0.011033

      485500 -- (-290.245) [-292.628] (-288.947) (-293.498) * (-289.149) (-288.142) (-292.374) [-288.883] -- 0:00:29
      486000 -- (-288.757) (-288.124) (-288.674) [-289.083] * (-291.788) (-288.595) [-291.117] (-288.536) -- 0:00:29
      486500 -- [-289.310] (-290.738) (-287.518) (-289.521) * [-287.603] (-290.384) (-290.184) (-291.460) -- 0:00:29
      487000 -- (-287.763) (-288.313) (-288.897) [-287.678] * (-288.166) (-288.703) (-293.831) [-287.585] -- 0:00:29
      487500 -- (-288.216) [-287.769] (-290.216) (-288.499) * (-288.628) (-290.412) [-289.777] (-291.502) -- 0:00:29
      488000 -- (-289.263) (-289.154) [-287.979] (-289.990) * [-289.644] (-288.229) (-290.515) (-290.034) -- 0:00:30
      488500 -- (-289.958) (-288.976) [-290.275] (-292.351) * (-290.775) [-288.510] (-288.969) (-290.180) -- 0:00:30
      489000 -- (-291.480) (-288.867) [-290.709] (-288.840) * (-289.048) (-289.095) [-288.624] (-298.467) -- 0:00:30
      489500 -- (-288.839) [-288.495] (-288.766) (-294.888) * (-289.325) [-287.781] (-287.986) (-289.964) -- 0:00:30
      490000 -- [-289.951] (-291.019) (-291.643) (-288.683) * [-288.879] (-292.333) (-289.195) (-290.383) -- 0:00:30

      Average standard deviation of split frequencies: 0.010268

      490500 -- (-290.202) (-289.498) [-287.857] (-292.226) * (-289.974) (-289.633) (-287.859) [-287.416] -- 0:00:30
      491000 -- (-291.172) [-293.706] (-289.160) (-289.176) * [-288.169] (-289.509) (-289.597) (-288.733) -- 0:00:30
      491500 -- (-290.782) [-292.850] (-289.321) (-289.832) * [-289.728] (-290.246) (-295.422) (-288.927) -- 0:00:30
      492000 -- (-288.487) (-290.161) (-297.759) [-289.404] * (-287.603) [-288.547] (-289.465) (-287.941) -- 0:00:29
      492500 -- [-292.028] (-292.669) (-293.718) (-287.926) * (-289.259) (-289.044) (-287.551) [-288.004] -- 0:00:29
      493000 -- (-287.937) (-288.843) [-291.792] (-289.278) * (-290.160) (-288.922) [-292.444] (-293.946) -- 0:00:29
      493500 -- [-287.886] (-291.964) (-287.406) (-289.332) * (-298.746) [-291.457] (-290.287) (-287.710) -- 0:00:29
      494000 -- (-288.111) (-291.641) [-288.492] (-288.196) * (-292.652) (-289.888) (-288.500) [-288.494] -- 0:00:29
      494500 -- [-289.727] (-291.713) (-291.965) (-287.871) * [-288.599] (-290.390) (-288.917) (-290.551) -- 0:00:29
      495000 -- (-288.573) [-292.370] (-295.177) (-288.499) * [-291.847] (-289.918) (-289.048) (-289.017) -- 0:00:29

      Average standard deviation of split frequencies: 0.010395

      495500 -- (-288.105) (-291.479) (-291.333) [-290.718] * (-292.702) (-290.468) [-287.756] (-289.179) -- 0:00:29
      496000 -- (-291.089) [-288.602] (-289.725) (-287.594) * (-292.364) (-296.895) (-292.120) [-288.021] -- 0:00:29
      496500 -- [-292.856] (-289.313) (-289.083) (-289.691) * (-290.877) [-290.624] (-291.737) (-290.596) -- 0:00:29
      497000 -- [-288.460] (-289.409) (-289.787) (-295.710) * (-288.287) [-288.127] (-289.951) (-287.332) -- 0:00:29
      497500 -- (-289.409) (-289.943) [-289.010] (-290.407) * [-288.147] (-288.870) (-290.465) (-288.366) -- 0:00:29
      498000 -- [-291.858] (-289.472) (-288.054) (-289.680) * (-288.313) [-291.623] (-293.466) (-292.548) -- 0:00:29
      498500 -- (-289.408) (-288.700) [-288.487] (-287.384) * (-289.181) (-289.439) (-288.946) [-291.418] -- 0:00:29
      499000 -- [-290.165] (-291.333) (-289.515) (-288.223) * (-288.233) (-288.968) [-290.327] (-288.309) -- 0:00:29
      499500 -- (-288.789) [-292.952] (-291.400) (-291.447) * [-288.744] (-289.857) (-290.799) (-288.382) -- 0:00:29
      500000 -- [-291.043] (-290.061) (-291.252) (-292.976) * (-290.208) [-291.703] (-289.444) (-292.705) -- 0:00:29

      Average standard deviation of split frequencies: 0.009827

      500500 -- (-291.050) (-289.544) [-288.092] (-289.185) * (-292.696) (-289.757) [-290.793] (-292.641) -- 0:00:28
      501000 -- (-287.812) (-290.538) (-290.724) [-288.282] * (-289.880) [-288.436] (-288.180) (-290.003) -- 0:00:28
      501500 -- (-293.638) (-289.822) [-296.247] (-291.168) * [-287.570] (-288.503) (-290.994) (-289.697) -- 0:00:28
      502000 -- [-287.847] (-289.143) (-289.910) (-288.636) * (-287.586) [-288.015] (-290.737) (-289.863) -- 0:00:28
      502500 -- (-293.174) [-289.862] (-292.893) (-290.227) * (-291.118) [-288.146] (-292.064) (-288.154) -- 0:00:28
      503000 -- [-291.480] (-293.773) (-287.610) (-296.869) * (-290.845) (-290.736) (-289.261) [-290.130] -- 0:00:28
      503500 -- (-293.260) (-290.760) (-290.828) [-290.207] * (-291.107) [-289.863] (-289.752) (-288.709) -- 0:00:28
      504000 -- (-289.063) (-293.117) (-291.366) [-288.948] * (-289.541) (-291.020) [-288.958] (-290.026) -- 0:00:28
      504500 -- (-288.255) (-290.202) [-288.167] (-288.329) * (-287.810) [-288.774] (-288.439) (-288.038) -- 0:00:28
      505000 -- [-289.086] (-290.245) (-292.636) (-289.431) * [-289.706] (-290.558) (-289.499) (-287.727) -- 0:00:29

      Average standard deviation of split frequencies: 0.010073

      505500 -- (-289.577) [-291.260] (-295.553) (-288.713) * (-295.605) [-290.036] (-289.451) (-288.971) -- 0:00:29
      506000 -- (-290.408) (-292.148) [-293.830] (-289.603) * (-293.271) (-291.676) (-288.426) [-290.007] -- 0:00:29
      506500 -- (-290.306) (-292.028) (-287.642) [-288.547] * (-295.674) (-289.069) [-288.406] (-288.024) -- 0:00:29
      507000 -- (-287.557) [-288.056] (-287.655) (-290.361) * (-296.975) (-292.030) [-289.503] (-288.048) -- 0:00:29
      507500 -- [-290.701] (-288.415) (-289.634) (-293.665) * (-293.676) (-288.412) [-289.846] (-289.640) -- 0:00:29
      508000 -- (-290.939) [-287.752] (-288.904) (-293.318) * (-290.843) (-293.111) [-287.603] (-288.252) -- 0:00:29
      508500 -- (-298.200) (-288.084) [-287.275] (-290.788) * (-288.032) (-288.903) [-290.023] (-288.816) -- 0:00:28
      509000 -- (-295.462) (-288.295) [-288.921] (-288.312) * (-288.554) (-289.087) [-289.162] (-287.717) -- 0:00:28
      509500 -- (-290.191) (-292.699) (-292.513) [-290.402] * (-289.702) (-288.537) (-291.493) [-289.427] -- 0:00:28
      510000 -- [-289.820] (-288.862) (-291.527) (-296.827) * (-289.201) [-288.419] (-288.454) (-294.685) -- 0:00:28

      Average standard deviation of split frequencies: 0.009866

      510500 -- (-291.075) (-290.652) (-287.766) [-291.920] * (-291.939) [-292.821] (-290.637) (-290.985) -- 0:00:28
      511000 -- [-291.097] (-288.338) (-288.810) (-289.095) * (-289.232) (-289.204) [-292.582] (-290.123) -- 0:00:28
      511500 -- (-288.635) (-289.282) (-290.547) [-288.621] * (-289.198) [-288.817] (-291.696) (-288.508) -- 0:00:28
      512000 -- (-287.922) [-289.127] (-290.196) (-289.444) * (-290.416) [-293.164] (-289.245) (-287.646) -- 0:00:28
      512500 -- (-289.185) (-290.118) (-290.613) [-290.461] * (-289.228) [-290.576] (-289.361) (-288.028) -- 0:00:28
      513000 -- [-287.746] (-288.547) (-288.782) (-288.543) * (-288.894) (-288.973) [-287.249] (-289.939) -- 0:00:28
      513500 -- (-291.565) [-289.526] (-289.049) (-289.885) * (-289.383) (-289.319) [-291.673] (-292.007) -- 0:00:28
      514000 -- (-290.608) (-289.255) [-288.580] (-287.836) * [-290.571] (-289.144) (-291.900) (-289.764) -- 0:00:28
      514500 -- [-289.525] (-290.062) (-290.228) (-287.731) * [-290.221] (-289.687) (-288.253) (-290.634) -- 0:00:28
      515000 -- (-289.880) (-290.684) (-289.251) [-289.319] * (-288.698) [-291.061] (-293.718) (-289.137) -- 0:00:28

      Average standard deviation of split frequencies: 0.009707

      515500 -- (-294.255) (-296.391) [-288.394] (-292.304) * (-289.967) (-288.912) [-287.668] (-290.810) -- 0:00:28
      516000 -- [-288.419] (-290.808) (-288.503) (-288.545) * (-293.602) [-289.002] (-288.338) (-289.229) -- 0:00:28
      516500 -- [-288.436] (-289.932) (-288.292) (-288.100) * (-290.116) (-289.531) [-290.304] (-288.630) -- 0:00:28
      517000 -- (-292.158) (-291.025) (-291.366) [-287.653] * [-287.859] (-289.175) (-291.353) (-293.203) -- 0:00:28
      517500 -- (-295.158) [-288.048] (-289.919) (-288.833) * (-289.213) (-289.907) [-290.390] (-290.900) -- 0:00:27
      518000 -- (-288.394) [-288.495] (-288.203) (-290.230) * (-290.332) (-290.857) [-291.425] (-291.870) -- 0:00:27
      518500 -- (-291.653) [-287.665] (-289.425) (-291.910) * (-288.173) (-288.634) [-287.822] (-288.479) -- 0:00:27
      519000 -- (-291.322) (-288.310) (-289.673) [-289.047] * (-288.532) (-290.223) (-293.348) [-289.011] -- 0:00:27
      519500 -- (-289.306) (-288.778) [-289.454] (-291.938) * [-290.698] (-290.155) (-290.879) (-289.926) -- 0:00:27
      520000 -- (-288.436) (-291.687) [-290.190] (-289.358) * (-288.920) (-288.033) [-288.151] (-289.072) -- 0:00:27

      Average standard deviation of split frequencies: 0.009789

      520500 -- (-287.348) (-288.973) [-288.239] (-289.718) * (-290.026) (-287.904) (-289.513) [-289.228] -- 0:00:27
      521000 -- (-290.370) (-288.481) [-288.893] (-291.882) * (-288.621) (-291.147) [-290.203] (-287.708) -- 0:00:27
      521500 -- (-290.097) (-288.668) [-288.490] (-292.908) * (-289.414) (-287.659) (-289.628) [-290.196] -- 0:00:27
      522000 -- (-288.178) (-288.142) [-288.725] (-290.703) * (-291.809) (-287.788) (-291.260) [-288.374] -- 0:00:27
      522500 -- (-288.392) (-288.483) [-289.666] (-290.908) * (-293.674) (-291.609) (-292.603) [-288.453] -- 0:00:28
      523000 -- (-289.010) (-289.055) (-288.605) [-288.984] * [-290.548] (-292.932) (-294.780) (-289.708) -- 0:00:28
      523500 -- (-289.410) (-290.660) (-289.370) [-290.465] * [-289.377] (-288.739) (-288.142) (-288.826) -- 0:00:28
      524000 -- (-293.096) (-292.532) [-288.904] (-288.454) * (-287.349) [-291.807] (-292.177) (-289.507) -- 0:00:28
      524500 -- (-293.139) [-290.513] (-288.194) (-292.690) * (-289.085) [-289.761] (-289.931) (-289.780) -- 0:00:28
      525000 -- (-291.061) [-289.102] (-289.885) (-290.857) * (-287.934) (-287.916) (-288.735) [-289.554] -- 0:00:28

      Average standard deviation of split frequencies: 0.009970

      525500 -- (-295.358) [-289.437] (-288.273) (-289.795) * (-290.592) (-287.769) (-295.132) [-289.804] -- 0:00:27
      526000 -- (-290.739) (-290.378) (-288.026) [-289.073] * (-288.212) (-289.303) (-290.704) [-288.231] -- 0:00:27
      526500 -- (-291.003) [-290.735] (-291.809) (-289.073) * (-289.258) (-288.296) [-289.722] (-291.058) -- 0:00:27
      527000 -- (-288.420) (-291.237) (-291.538) [-287.425] * (-290.637) [-290.757] (-290.278) (-289.150) -- 0:00:27
      527500 -- (-289.339) (-288.626) (-289.667) [-288.411] * (-288.439) [-288.176] (-290.310) (-288.520) -- 0:00:27
      528000 -- (-289.150) [-289.139] (-292.182) (-288.852) * (-291.947) [-288.617] (-295.777) (-288.661) -- 0:00:27
      528500 -- (-289.712) (-288.910) [-288.134] (-288.511) * [-290.142] (-289.497) (-290.076) (-289.252) -- 0:00:27
      529000 -- (-293.620) (-288.818) (-292.679) [-289.554] * (-287.635) (-291.646) (-290.087) [-288.419] -- 0:00:27
      529500 -- (-291.574) (-288.032) [-291.386] (-294.587) * (-289.457) (-287.682) (-290.903) [-288.369] -- 0:00:27
      530000 -- [-288.614] (-290.527) (-290.038) (-292.019) * (-291.320) (-289.258) [-291.149] (-290.528) -- 0:00:27

      Average standard deviation of split frequencies: 0.010160

      530500 -- [-293.897] (-288.793) (-288.125) (-290.498) * (-289.293) (-287.999) (-291.234) [-288.816] -- 0:00:27
      531000 -- (-289.418) [-289.556] (-291.148) (-291.062) * (-288.303) (-289.297) (-287.665) [-288.348] -- 0:00:27
      531500 -- [-288.545] (-289.422) (-288.387) (-292.167) * (-289.183) (-290.466) (-287.965) [-288.230] -- 0:00:27
      532000 -- (-291.094) [-287.863] (-294.206) (-287.961) * (-288.688) [-287.373] (-287.947) (-288.301) -- 0:00:27
      532500 -- (-291.015) [-289.036] (-291.091) (-290.790) * (-288.836) (-289.745) (-289.461) [-289.183] -- 0:00:27
      533000 -- (-297.501) [-288.949] (-289.019) (-290.086) * (-290.343) (-288.087) (-289.637) [-288.742] -- 0:00:27
      533500 -- (-293.308) [-288.184] (-289.494) (-289.352) * (-290.906) (-290.472) (-287.474) [-288.460] -- 0:00:27
      534000 -- (-287.827) (-293.150) (-289.225) [-288.830] * (-290.985) (-291.679) (-289.126) [-288.551] -- 0:00:27
      534500 -- (-290.063) [-288.227] (-288.111) (-289.717) * [-287.816] (-289.290) (-291.815) (-291.169) -- 0:00:26
      535000 -- (-290.073) [-289.049] (-288.854) (-290.283) * [-289.998] (-287.712) (-289.242) (-288.348) -- 0:00:26

      Average standard deviation of split frequencies: 0.009949

      535500 -- (-289.511) [-288.137] (-289.226) (-288.687) * (-287.983) (-304.650) (-288.485) [-289.343] -- 0:00:26
      536000 -- [-287.556] (-288.674) (-288.047) (-287.557) * [-290.393] (-290.636) (-289.614) (-289.618) -- 0:00:26
      536500 -- [-288.277] (-289.923) (-289.517) (-290.230) * [-288.854] (-288.785) (-294.166) (-291.185) -- 0:00:26
      537000 -- (-293.902) (-290.019) [-291.862] (-287.836) * (-288.244) [-292.191] (-290.140) (-288.361) -- 0:00:26
      537500 -- (-289.919) [-288.866] (-292.377) (-287.712) * (-289.219) (-290.772) [-290.033] (-290.069) -- 0:00:26
      538000 -- (-291.158) [-290.101] (-289.542) (-288.836) * (-290.151) [-287.573] (-288.220) (-289.886) -- 0:00:26
      538500 -- (-289.153) (-289.516) (-294.240) [-289.990] * (-289.359) (-289.101) (-288.258) [-289.520] -- 0:00:26
      539000 -- (-290.667) (-293.423) (-289.968) [-289.510] * (-288.784) (-288.636) (-288.426) [-293.804] -- 0:00:26
      539500 -- (-291.840) (-290.157) [-288.277] (-288.219) * (-288.554) (-289.037) (-289.246) [-289.983] -- 0:00:27
      540000 -- (-289.272) (-291.964) (-289.691) [-289.657] * [-288.583] (-294.989) (-288.916) (-289.199) -- 0:00:27

      Average standard deviation of split frequencies: 0.009536

      540500 -- (-292.798) [-290.237] (-288.796) (-289.051) * (-291.005) (-289.917) (-290.029) [-289.013] -- 0:00:27
      541000 -- (-292.117) [-290.135] (-290.027) (-287.852) * (-290.625) (-288.430) [-288.729] (-290.438) -- 0:00:27
      541500 -- (-287.916) (-289.106) [-289.740] (-287.707) * (-290.219) (-288.067) [-290.385] (-289.090) -- 0:00:27
      542000 -- (-289.114) (-293.175) [-291.938] (-290.152) * (-291.825) (-287.688) [-290.433] (-290.508) -- 0:00:27
      542500 -- (-288.057) [-288.831] (-291.848) (-290.084) * (-292.485) [-289.061] (-289.989) (-289.065) -- 0:00:26
      543000 -- (-288.540) (-288.378) [-292.301] (-290.176) * (-287.919) (-287.643) (-288.491) [-288.154] -- 0:00:26
      543500 -- (-287.416) (-289.256) (-287.784) [-287.746] * (-290.629) (-290.680) [-288.205] (-293.330) -- 0:00:26
      544000 -- (-287.870) [-288.244] (-289.052) (-290.107) * (-291.088) (-291.051) [-292.147] (-287.327) -- 0:00:26
      544500 -- (-287.756) [-289.071] (-288.756) (-291.462) * [-289.089] (-290.733) (-293.391) (-289.332) -- 0:00:26
      545000 -- (-291.893) (-288.735) [-289.166] (-291.751) * (-291.454) (-288.982) (-293.351) [-293.806] -- 0:00:26

      Average standard deviation of split frequencies: 0.009281

      545500 -- (-289.874) (-295.247) [-292.176] (-288.600) * [-288.813] (-289.660) (-295.367) (-295.458) -- 0:00:26
      546000 -- (-291.269) [-287.744] (-289.482) (-289.072) * [-287.277] (-290.815) (-289.007) (-288.024) -- 0:00:26
      546500 -- (-288.834) (-297.800) (-287.727) [-288.100] * (-289.475) (-287.598) [-290.566] (-288.011) -- 0:00:26
      547000 -- (-289.142) (-290.018) (-291.939) [-289.130] * (-289.033) (-289.510) [-289.807] (-290.760) -- 0:00:26
      547500 -- [-290.253] (-287.740) (-289.110) (-290.737) * (-291.852) (-289.746) [-292.298] (-292.485) -- 0:00:26
      548000 -- (-296.151) (-292.649) (-290.198) [-288.719] * (-291.004) [-288.167] (-289.841) (-290.609) -- 0:00:26
      548500 -- (-289.611) [-289.944] (-288.325) (-290.165) * (-294.931) (-290.302) (-294.928) [-288.220] -- 0:00:26
      549000 -- (-291.430) (-289.633) [-288.886] (-288.743) * (-291.393) (-289.383) [-291.393] (-287.930) -- 0:00:26
      549500 -- (-288.542) (-293.407) (-293.833) [-289.595] * (-294.981) (-289.092) (-291.232) [-290.158] -- 0:00:26
      550000 -- (-287.866) (-289.541) [-288.293] (-287.929) * (-288.498) [-287.514] (-290.499) (-292.057) -- 0:00:26

      Average standard deviation of split frequencies: 0.009470

      550500 -- (-289.288) [-290.493] (-289.157) (-287.992) * (-291.773) [-287.544] (-292.082) (-290.756) -- 0:00:26
      551000 -- (-291.015) (-291.948) [-291.058] (-289.372) * (-295.431) [-289.188] (-287.591) (-291.051) -- 0:00:26
      551500 -- (-291.554) (-287.388) [-291.649] (-292.513) * (-287.287) (-288.241) (-289.680) [-292.323] -- 0:00:26
      552000 -- [-288.200] (-287.598) (-291.189) (-289.919) * (-290.460) (-288.191) [-291.882] (-288.865) -- 0:00:25
      552500 -- [-289.092] (-287.713) (-288.133) (-288.478) * (-288.641) (-288.170) (-288.603) [-288.970] -- 0:00:25
      553000 -- (-288.143) (-291.589) (-290.263) [-287.851] * [-287.694] (-290.646) (-289.570) (-293.706) -- 0:00:25
      553500 -- [-288.663] (-290.132) (-291.923) (-290.072) * (-289.723) (-289.773) [-290.695] (-289.923) -- 0:00:25
      554000 -- [-288.979] (-292.207) (-290.565) (-288.477) * (-288.578) (-294.376) [-287.833] (-291.276) -- 0:00:25
      554500 -- [-289.099] (-293.035) (-287.439) (-289.176) * [-289.981] (-292.997) (-288.802) (-289.514) -- 0:00:25
      555000 -- (-292.324) (-288.504) (-288.093) [-287.987] * (-287.590) (-289.265) [-287.909] (-289.703) -- 0:00:25

      Average standard deviation of split frequencies: 0.009485

      555500 -- (-290.378) (-288.218) [-288.494] (-290.128) * (-289.246) [-288.556] (-289.119) (-293.277) -- 0:00:25
      556000 -- (-289.334) [-289.637] (-290.941) (-289.170) * (-292.235) (-289.582) (-289.052) [-288.597] -- 0:00:25
      556500 -- (-290.984) [-288.537] (-292.391) (-290.984) * (-290.962) (-291.983) [-288.458] (-293.065) -- 0:00:25
      557000 -- (-290.304) [-290.005] (-295.382) (-289.015) * (-291.103) (-292.586) [-288.454] (-287.839) -- 0:00:26
      557500 -- [-291.609] (-289.061) (-293.668) (-289.497) * (-289.692) [-287.756] (-289.374) (-289.664) -- 0:00:26
      558000 -- [-290.982] (-291.966) (-288.042) (-290.331) * (-289.335) (-287.752) (-288.322) [-288.773] -- 0:00:26
      558500 -- [-289.333] (-293.225) (-288.366) (-294.191) * [-291.702] (-292.993) (-292.297) (-289.142) -- 0:00:26
      559000 -- [-294.324] (-289.396) (-288.390) (-290.074) * (-287.963) [-288.391] (-290.458) (-289.597) -- 0:00:26
      559500 -- (-292.027) (-289.834) [-290.260] (-288.883) * (-289.030) [-291.561] (-288.737) (-290.701) -- 0:00:25
      560000 -- [-288.968] (-288.969) (-290.028) (-293.560) * [-290.731] (-295.824) (-287.940) (-289.514) -- 0:00:25

      Average standard deviation of split frequencies: 0.009301

      560500 -- (-290.528) [-292.588] (-291.503) (-290.177) * (-288.649) (-294.297) (-288.408) [-290.159] -- 0:00:25
      561000 -- (-292.446) (-287.841) [-289.622] (-289.330) * (-289.419) (-293.243) (-287.775) [-289.908] -- 0:00:25
      561500 -- (-289.935) (-288.059) [-289.117] (-288.645) * (-291.020) (-289.719) [-289.004] (-288.387) -- 0:00:25
      562000 -- (-288.559) (-288.624) [-294.489] (-291.699) * (-290.310) (-289.564) (-287.961) [-287.989] -- 0:00:25
      562500 -- [-289.338] (-289.510) (-290.220) (-291.095) * (-293.857) (-292.236) [-287.736] (-290.459) -- 0:00:25
      563000 -- (-291.374) (-289.886) (-288.724) [-290.827] * [-293.122] (-290.154) (-287.919) (-292.476) -- 0:00:25
      563500 -- (-289.202) (-288.874) [-288.080] (-292.181) * (-290.096) (-289.576) (-288.883) [-290.342] -- 0:00:25
      564000 -- [-291.450] (-293.623) (-292.379) (-291.735) * [-290.347] (-288.637) (-288.351) (-293.795) -- 0:00:25
      564500 -- (-288.839) [-289.372] (-291.929) (-287.489) * [-287.759] (-291.691) (-289.286) (-287.800) -- 0:00:25
      565000 -- (-288.872) (-287.705) [-289.279] (-287.723) * (-288.812) (-291.090) (-288.461) [-288.626] -- 0:00:25

      Average standard deviation of split frequencies: 0.009682

      565500 -- (-288.185) (-288.189) [-290.700] (-289.254) * [-287.710] (-291.159) (-290.229) (-291.376) -- 0:00:25
      566000 -- (-297.480) [-291.073] (-290.767) (-289.866) * (-288.728) [-288.099] (-289.436) (-288.423) -- 0:00:25
      566500 -- [-290.285] (-289.752) (-290.626) (-289.264) * [-291.072] (-287.569) (-289.160) (-290.407) -- 0:00:25
      567000 -- (-292.028) (-291.693) (-291.292) [-288.314] * (-293.871) [-287.371] (-292.366) (-290.478) -- 0:00:25
      567500 -- (-289.553) (-288.887) [-288.447] (-288.910) * (-288.746) (-290.296) [-291.133] (-292.171) -- 0:00:25
      568000 -- [-289.622] (-289.005) (-287.192) (-291.496) * (-293.520) (-288.436) (-288.697) [-289.174] -- 0:00:25
      568500 -- (-291.578) [-291.016] (-290.555) (-288.117) * (-291.277) (-291.436) (-288.159) [-288.963] -- 0:00:25
      569000 -- (-290.862) (-288.411) [-290.112] (-287.863) * (-298.870) (-290.198) [-288.269] (-289.179) -- 0:00:24
      569500 -- [-290.281] (-288.472) (-290.366) (-291.278) * [-289.451] (-291.432) (-288.381) (-290.541) -- 0:00:24
      570000 -- (-289.489) (-289.167) (-289.966) [-290.129] * [-288.093] (-289.295) (-290.805) (-290.115) -- 0:00:24

      Average standard deviation of split frequencies: 0.009655

      570500 -- (-288.381) [-288.440] (-288.474) (-290.953) * (-291.782) (-289.687) [-287.625] (-290.027) -- 0:00:24
      571000 -- [-289.092] (-288.828) (-289.527) (-296.452) * (-288.563) (-289.516) [-288.967] (-288.636) -- 0:00:24
      571500 -- (-289.233) (-290.773) [-288.671] (-288.034) * (-289.916) (-289.438) (-291.346) [-288.454] -- 0:00:24
      572000 -- (-290.971) [-290.485] (-291.679) (-288.080) * (-293.476) [-289.537] (-290.753) (-288.368) -- 0:00:24
      572500 -- (-290.788) (-289.286) [-287.465] (-291.887) * (-287.735) (-287.382) [-290.554] (-290.369) -- 0:00:24
      573000 -- (-293.000) (-290.055) [-288.583] (-291.577) * (-288.617) [-290.366] (-289.675) (-289.655) -- 0:00:24
      573500 -- (-291.969) [-288.691] (-290.327) (-289.879) * (-288.853) [-288.973] (-288.632) (-290.383) -- 0:00:24
      574000 -- (-288.179) (-290.527) (-287.189) [-288.719] * (-287.703) (-290.768) [-289.431] (-290.799) -- 0:00:24
      574500 -- (-288.832) (-288.553) [-288.301] (-290.207) * (-291.838) (-288.816) [-290.649] (-288.314) -- 0:00:25
      575000 -- (-292.513) (-288.973) (-288.675) [-294.287] * (-291.288) (-288.100) (-289.589) [-288.606] -- 0:00:25

      Average standard deviation of split frequencies: 0.009616

      575500 -- (-291.974) [-292.123] (-288.685) (-288.864) * (-289.551) (-287.942) (-288.477) [-288.196] -- 0:00:25
      576000 -- (-291.649) [-291.538] (-287.590) (-294.344) * (-288.218) (-287.977) (-288.782) [-289.055] -- 0:00:25
      576500 -- (-288.949) (-291.508) (-288.629) [-289.285] * (-291.346) (-288.712) (-295.355) [-289.867] -- 0:00:24
      577000 -- [-290.229] (-288.800) (-291.917) (-287.968) * (-290.226) [-288.062] (-291.002) (-287.844) -- 0:00:24
      577500 -- (-288.623) [-289.205] (-288.351) (-289.410) * (-289.539) [-292.054] (-288.723) (-289.056) -- 0:00:24
      578000 -- [-287.659] (-287.620) (-292.439) (-294.118) * (-288.467) (-292.453) (-290.400) [-291.772] -- 0:00:24
      578500 -- [-291.365] (-290.160) (-289.350) (-292.580) * [-289.080] (-288.372) (-291.174) (-287.774) -- 0:00:24
      579000 -- (-291.141) (-287.857) [-289.714] (-291.364) * (-289.796) (-294.717) [-288.111] (-288.009) -- 0:00:24
      579500 -- [-290.073] (-289.827) (-288.061) (-290.527) * [-288.946] (-291.167) (-287.995) (-288.275) -- 0:00:24
      580000 -- (-289.556) (-290.870) (-289.776) [-292.111] * (-289.449) (-287.936) (-287.813) [-289.513] -- 0:00:24

      Average standard deviation of split frequencies: 0.009793

      580500 -- (-289.536) (-288.098) [-289.487] (-289.549) * (-287.800) (-287.458) (-290.833) [-291.204] -- 0:00:24
      581000 -- [-288.641] (-292.580) (-288.991) (-290.289) * (-289.035) [-288.272] (-288.522) (-287.688) -- 0:00:24
      581500 -- (-291.015) [-290.481] (-288.603) (-296.338) * (-293.558) [-288.320] (-288.482) (-287.329) -- 0:00:24
      582000 -- (-291.963) [-288.795] (-288.806) (-288.268) * [-288.514] (-288.541) (-289.194) (-289.450) -- 0:00:24
      582500 -- (-290.319) [-290.240] (-294.094) (-293.159) * (-288.110) (-292.451) [-289.640] (-288.202) -- 0:00:24
      583000 -- (-293.139) (-289.890) (-291.866) [-290.801] * [-290.652] (-290.716) (-292.740) (-288.420) -- 0:00:24
      583500 -- (-293.707) (-287.759) (-289.233) [-287.676] * [-289.740] (-291.946) (-291.171) (-287.841) -- 0:00:24
      584000 -- [-289.852] (-290.424) (-294.082) (-288.170) * (-291.585) [-288.531] (-289.968) (-289.581) -- 0:00:24
      584500 -- (-289.593) [-288.295] (-295.497) (-288.547) * [-288.777] (-294.034) (-287.994) (-293.163) -- 0:00:24
      585000 -- (-290.651) [-292.933] (-290.819) (-289.082) * (-290.934) (-292.861) [-287.781] (-292.939) -- 0:00:24

      Average standard deviation of split frequencies: 0.009452

      585500 -- (-289.064) (-289.781) [-288.873] (-289.798) * (-292.548) (-291.766) [-287.801] (-292.114) -- 0:00:24
      586000 -- (-288.828) (-289.781) (-288.014) [-289.578] * (-292.593) (-287.766) (-288.045) [-288.862] -- 0:00:24
      586500 -- [-288.794] (-288.571) (-288.461) (-289.077) * (-288.641) [-290.956] (-287.697) (-290.237) -- 0:00:23
      587000 -- [-289.310] (-288.997) (-293.362) (-292.788) * [-288.393] (-289.968) (-287.934) (-289.806) -- 0:00:23
      587500 -- (-289.057) (-289.015) (-293.011) [-293.602] * [-294.932] (-290.262) (-292.321) (-287.267) -- 0:00:23
      588000 -- (-288.129) [-289.422] (-290.065) (-291.176) * (-290.521) (-288.266) [-290.685] (-287.237) -- 0:00:23
      588500 -- (-288.696) (-292.220) [-291.343] (-289.303) * (-292.040) (-290.132) (-290.947) [-288.503] -- 0:00:23
      589000 -- (-289.089) [-288.670] (-291.356) (-288.005) * (-291.022) [-294.510] (-291.557) (-289.397) -- 0:00:23
      589500 -- [-287.417] (-289.402) (-288.251) (-289.416) * (-290.972) (-291.508) (-289.489) [-289.538] -- 0:00:23
      590000 -- (-289.534) (-288.513) (-288.509) [-291.759] * (-289.014) (-290.035) [-289.852] (-291.492) -- 0:00:23

      Average standard deviation of split frequencies: 0.009577

      590500 -- (-290.494) (-287.490) (-291.858) [-291.355] * (-290.231) (-288.510) (-288.662) [-288.862] -- 0:00:23
      591000 -- (-289.588) [-290.436] (-288.137) (-290.446) * [-290.124] (-291.185) (-291.738) (-288.993) -- 0:00:23
      591500 -- (-290.533) [-289.626] (-288.479) (-288.332) * (-288.646) (-289.215) (-290.836) [-288.357] -- 0:00:24
      592000 -- (-291.042) [-289.651] (-290.930) (-290.069) * (-291.586) (-290.342) (-290.151) [-288.359] -- 0:00:24
      592500 -- [-287.731] (-290.680) (-288.695) (-289.344) * (-292.549) (-293.349) [-289.925] (-290.469) -- 0:00:24
      593000 -- (-291.923) (-289.094) (-289.531) [-289.890] * (-289.755) [-293.704] (-293.594) (-288.798) -- 0:00:24
      593500 -- (-288.111) (-289.563) [-289.995] (-289.264) * [-292.349] (-291.913) (-289.653) (-290.697) -- 0:00:23
      594000 -- (-290.397) [-288.375] (-290.104) (-288.424) * (-290.701) (-288.016) [-288.075] (-293.296) -- 0:00:23
      594500 -- (-292.023) [-288.984] (-294.152) (-293.839) * (-289.652) (-291.645) [-291.007] (-292.834) -- 0:00:23
      595000 -- [-292.284] (-289.274) (-289.473) (-294.424) * [-290.416] (-290.075) (-290.677) (-290.877) -- 0:00:23

      Average standard deviation of split frequencies: 0.010085

      595500 -- (-294.176) [-291.205] (-288.263) (-289.689) * (-292.105) [-287.746] (-289.381) (-290.691) -- 0:00:23
      596000 -- [-290.406] (-289.959) (-288.808) (-290.267) * (-288.490) (-290.363) (-290.684) [-288.439] -- 0:00:23
      596500 -- (-288.148) [-292.038] (-290.175) (-291.188) * (-289.160) [-291.142] (-288.789) (-289.787) -- 0:00:23
      597000 -- (-290.130) [-293.776] (-288.855) (-292.798) * (-287.753) [-288.408] (-289.421) (-293.510) -- 0:00:23
      597500 -- (-290.419) (-288.439) [-290.112] (-289.313) * (-289.584) (-293.333) [-290.088] (-288.528) -- 0:00:23
      598000 -- (-288.990) [-288.991] (-288.270) (-289.718) * (-293.747) (-289.917) [-290.618] (-291.665) -- 0:00:23
      598500 -- (-290.833) (-289.100) [-289.973] (-289.213) * (-290.716) [-290.408] (-288.772) (-289.749) -- 0:00:23
      599000 -- [-290.626] (-299.742) (-291.482) (-289.069) * (-289.189) (-287.351) (-288.975) [-289.982] -- 0:00:23
      599500 -- [-291.374] (-294.074) (-290.838) (-290.325) * (-288.801) [-289.438] (-288.679) (-289.950) -- 0:00:23
      600000 -- (-289.810) (-291.410) (-288.452) [-289.946] * (-290.731) (-292.396) [-287.959] (-289.702) -- 0:00:23

      Average standard deviation of split frequencies: 0.010153

      600500 -- (-291.688) [-291.528] (-289.556) (-289.458) * [-288.858] (-292.149) (-289.133) (-291.580) -- 0:00:23
      601000 -- [-290.780] (-289.606) (-289.432) (-288.548) * (-290.143) (-288.813) [-290.792] (-291.852) -- 0:00:23
      601500 -- [-289.870] (-288.273) (-290.532) (-288.799) * (-290.681) [-289.250] (-291.795) (-290.672) -- 0:00:23
      602000 -- [-290.447] (-289.336) (-289.817) (-289.338) * (-288.324) (-287.580) (-289.300) [-289.250] -- 0:00:23
      602500 -- (-292.580) (-289.093) (-288.411) [-288.197] * (-291.808) [-288.640] (-288.535) (-288.094) -- 0:00:23
      603000 -- (-291.084) (-288.568) [-287.701] (-287.686) * (-288.650) (-290.472) [-287.388] (-288.549) -- 0:00:23
      603500 -- (-287.904) (-290.983) (-287.435) [-288.447] * (-291.424) (-289.034) (-291.909) [-288.165] -- 0:00:22
      604000 -- (-290.537) [-288.219] (-288.121) (-291.739) * (-288.834) (-289.825) (-291.532) [-289.478] -- 0:00:22
      604500 -- [-288.871] (-287.351) (-287.895) (-289.158) * (-288.050) [-291.619] (-288.174) (-287.769) -- 0:00:22
      605000 -- (-290.952) (-289.516) [-288.990] (-289.228) * (-291.802) (-290.257) [-289.881] (-294.737) -- 0:00:22

      Average standard deviation of split frequencies: 0.010307

      605500 -- [-290.990] (-290.217) (-289.670) (-288.454) * (-288.357) (-288.208) (-288.206) [-290.497] -- 0:00:22
      606000 -- (-289.966) (-295.062) (-289.910) [-289.049] * (-287.628) (-287.999) [-289.045] (-288.652) -- 0:00:22
      606500 -- (-289.072) (-290.267) (-289.668) [-289.292] * (-289.122) [-287.555] (-290.741) (-292.064) -- 0:00:22
      607000 -- (-291.706) (-293.300) (-290.110) [-288.605] * (-288.845) [-287.712] (-292.139) (-293.877) -- 0:00:22
      607500 -- (-290.456) (-287.553) [-289.061] (-290.852) * [-288.860] (-289.001) (-295.432) (-290.638) -- 0:00:22
      608000 -- (-293.489) (-291.581) [-289.685] (-291.010) * (-290.421) [-287.951] (-289.149) (-290.861) -- 0:00:22
      608500 -- (-289.810) [-289.969] (-289.181) (-292.034) * (-290.727) (-292.216) [-290.327] (-291.737) -- 0:00:22
      609000 -- (-292.742) [-290.631] (-288.607) (-290.673) * [-290.742] (-289.080) (-290.318) (-287.949) -- 0:00:23
      609500 -- [-292.644] (-294.483) (-290.383) (-289.936) * (-290.620) (-289.710) [-289.509] (-292.632) -- 0:00:23
      610000 -- (-293.090) (-292.266) [-287.671] (-289.821) * (-290.094) (-289.731) (-289.163) [-288.533] -- 0:00:23

      Average standard deviation of split frequencies: 0.010325

      610500 -- (-289.560) (-293.392) (-292.476) [-289.266] * (-292.526) (-292.655) [-288.637] (-291.534) -- 0:00:22
      611000 -- [-291.519] (-290.481) (-290.110) (-290.634) * [-290.213] (-292.127) (-289.450) (-288.798) -- 0:00:22
      611500 -- [-288.617] (-289.101) (-297.274) (-291.705) * (-287.620) [-288.825] (-288.812) (-289.969) -- 0:00:22
      612000 -- (-289.179) (-289.670) (-289.602) [-288.669] * [-293.904] (-290.678) (-288.735) (-291.228) -- 0:00:22
      612500 -- (-290.506) (-289.157) [-288.741] (-290.179) * (-289.941) [-292.605] (-289.321) (-292.016) -- 0:00:22
      613000 -- (-289.603) (-287.908) (-292.493) [-288.168] * (-290.719) (-288.521) [-288.931] (-289.455) -- 0:00:22
      613500 -- (-289.133) [-287.697] (-287.241) (-290.064) * (-288.607) (-288.048) [-292.165] (-287.620) -- 0:00:22
      614000 -- (-290.112) (-291.316) [-290.498] (-289.139) * (-288.530) [-288.703] (-290.712) (-292.288) -- 0:00:22
      614500 -- (-289.915) (-289.285) (-289.095) [-288.501] * (-288.244) (-288.454) (-291.532) [-290.894] -- 0:00:22
      615000 -- [-290.194] (-290.719) (-291.831) (-289.992) * (-290.609) (-289.564) (-288.603) [-288.916] -- 0:00:22

      Average standard deviation of split frequencies: 0.010570

      615500 -- [-289.136] (-292.036) (-287.916) (-293.973) * (-289.360) (-290.476) (-289.151) [-292.581] -- 0:00:22
      616000 -- (-291.530) [-288.117] (-290.253) (-290.343) * [-291.742] (-290.496) (-292.760) (-293.001) -- 0:00:22
      616500 -- (-292.649) (-296.901) (-294.465) [-292.065] * [-289.936] (-289.757) (-289.866) (-293.121) -- 0:00:22
      617000 -- (-294.827) (-292.226) (-293.212) [-293.015] * [-288.522] (-287.363) (-287.954) (-290.310) -- 0:00:22
      617500 -- [-287.894] (-293.949) (-289.855) (-289.709) * (-287.656) [-289.865] (-289.529) (-292.896) -- 0:00:22
      618000 -- (-295.425) (-294.519) (-290.701) [-289.028] * (-297.825) (-292.104) (-288.343) [-289.502] -- 0:00:22
      618500 -- (-290.224) (-293.479) (-288.735) [-292.058] * (-291.237) [-292.602] (-287.901) (-292.595) -- 0:00:22
      619000 -- (-287.338) (-288.428) (-290.178) [-288.539] * (-290.652) (-289.933) (-287.770) [-288.503] -- 0:00:22
      619500 -- (-295.443) (-288.963) [-292.005] (-289.433) * (-289.448) (-289.118) (-287.796) [-288.949] -- 0:00:22
      620000 -- (-291.900) (-290.418) [-289.603] (-293.196) * (-289.413) [-294.104] (-287.237) (-287.830) -- 0:00:22

      Average standard deviation of split frequencies: 0.010396

      620500 -- (-288.993) [-288.917] (-290.381) (-289.290) * [-288.166] (-289.271) (-287.770) (-289.338) -- 0:00:22
      621000 -- (-288.455) [-288.170] (-290.789) (-292.344) * (-293.126) [-288.938] (-291.783) (-288.932) -- 0:00:21
      621500 -- (-288.879) (-287.582) (-290.039) [-289.455] * (-290.437) (-289.044) (-289.285) [-289.856] -- 0:00:21
      622000 -- (-288.818) [-288.304] (-289.298) (-289.520) * (-291.467) [-289.868] (-288.461) (-292.405) -- 0:00:21
      622500 -- (-290.529) (-287.960) (-290.124) [-290.528] * (-290.022) (-289.831) (-288.172) [-288.289] -- 0:00:21
      623000 -- (-290.806) [-290.319] (-290.744) (-288.776) * (-288.103) [-289.141] (-288.513) (-288.451) -- 0:00:21
      623500 -- (-287.690) [-288.223] (-288.970) (-288.462) * (-296.222) (-288.361) [-287.312] (-289.533) -- 0:00:21
      624000 -- (-288.628) (-289.262) (-289.335) [-290.277] * (-296.719) (-288.083) [-289.224] (-290.353) -- 0:00:21
      624500 -- (-288.247) (-291.025) (-290.846) [-288.677] * (-288.497) (-292.385) (-288.101) [-288.644] -- 0:00:21
      625000 -- [-290.207] (-288.303) (-288.091) (-289.197) * (-291.139) (-290.280) (-297.258) [-289.091] -- 0:00:21

      Average standard deviation of split frequencies: 0.009931

      625500 -- (-290.934) [-288.486] (-289.214) (-290.030) * (-292.099) [-289.479] (-288.195) (-288.886) -- 0:00:21
      626000 -- (-290.171) [-289.807] (-289.398) (-290.313) * (-291.501) [-292.548] (-292.342) (-291.198) -- 0:00:21
      626500 -- (-291.050) (-287.795) (-289.364) [-288.759] * (-291.511) [-289.925] (-289.885) (-292.975) -- 0:00:22
      627000 -- (-288.168) [-288.188] (-290.903) (-289.197) * (-290.294) [-293.378] (-288.357) (-291.488) -- 0:00:22
      627500 -- (-291.067) (-288.078) (-288.289) [-288.728] * (-289.373) (-292.643) (-288.581) [-288.878] -- 0:00:21
      628000 -- (-291.087) (-290.328) (-288.022) [-289.116] * (-289.675) [-288.362] (-290.640) (-289.479) -- 0:00:21
      628500 -- (-289.030) (-288.460) (-288.137) [-288.630] * (-289.952) [-289.030] (-288.902) (-290.328) -- 0:00:21
      629000 -- (-290.273) [-287.262] (-289.043) (-288.336) * (-292.461) (-289.902) (-288.781) [-287.736] -- 0:00:21
      629500 -- (-295.972) (-291.228) [-289.947] (-288.361) * [-291.964] (-290.076) (-288.230) (-287.964) -- 0:00:21
      630000 -- (-290.000) (-288.832) [-289.543] (-287.844) * (-293.804) (-289.489) [-287.948] (-289.689) -- 0:00:21

      Average standard deviation of split frequencies: 0.010324

      630500 -- (-287.850) (-288.885) [-288.954] (-293.148) * [-290.356] (-288.931) (-288.687) (-291.053) -- 0:00:21
      631000 -- [-289.044] (-288.438) (-299.569) (-290.119) * [-289.742] (-288.916) (-290.663) (-288.389) -- 0:00:21
      631500 -- (-288.144) (-288.286) (-294.048) [-288.544] * [-291.673] (-287.946) (-289.971) (-290.960) -- 0:00:21
      632000 -- (-291.685) [-288.690] (-289.191) (-288.077) * (-291.335) (-287.751) [-290.040] (-290.073) -- 0:00:21
      632500 -- [-289.238] (-288.633) (-289.208) (-289.631) * (-290.854) (-287.781) [-290.175] (-288.910) -- 0:00:21
      633000 -- (-290.929) [-288.633] (-288.481) (-289.017) * (-291.435) [-290.148] (-291.604) (-288.481) -- 0:00:21
      633500 -- [-289.252] (-291.964) (-288.684) (-289.922) * [-287.950] (-295.254) (-288.553) (-292.030) -- 0:00:21
      634000 -- (-288.422) [-293.054] (-288.508) (-293.240) * (-289.905) [-292.243] (-289.266) (-290.019) -- 0:00:21
      634500 -- [-288.719] (-295.609) (-290.116) (-294.056) * (-289.986) [-288.798] (-290.766) (-289.141) -- 0:00:21
      635000 -- (-289.691) [-288.970] (-288.385) (-291.785) * [-288.891] (-287.627) (-288.320) (-288.107) -- 0:00:21

      Average standard deviation of split frequencies: 0.010099

      635500 -- (-289.602) (-289.430) (-289.762) [-289.901] * [-289.018] (-287.863) (-288.856) (-291.922) -- 0:00:21
      636000 -- (-287.930) (-290.096) [-289.527] (-289.339) * [-291.479] (-289.943) (-290.787) (-292.322) -- 0:00:21
      636500 -- [-291.191] (-288.339) (-289.027) (-289.586) * [-290.950] (-289.048) (-288.775) (-290.730) -- 0:00:21
      637000 -- (-290.246) (-289.967) (-290.367) [-291.281] * (-289.798) (-289.292) (-291.595) [-290.115] -- 0:00:21
      637500 -- [-289.166] (-289.104) (-289.375) (-290.567) * (-291.429) [-289.775] (-292.350) (-287.878) -- 0:00:21
      638000 -- [-289.788] (-287.591) (-291.596) (-290.901) * [-291.736] (-288.578) (-288.223) (-287.967) -- 0:00:20
      638500 -- (-296.864) [-289.267] (-288.274) (-290.052) * (-290.252) [-289.882] (-290.654) (-294.464) -- 0:00:20
      639000 -- (-288.784) [-290.682] (-288.875) (-290.544) * (-292.632) [-289.085] (-291.089) (-290.684) -- 0:00:20
      639500 -- [-289.643] (-289.980) (-289.776) (-291.546) * [-291.475] (-288.755) (-295.474) (-291.767) -- 0:00:20
      640000 -- [-289.370] (-290.106) (-291.844) (-290.126) * (-290.982) (-289.461) [-289.568] (-289.844) -- 0:00:20

      Average standard deviation of split frequencies: 0.010163

      640500 -- (-289.906) (-292.190) (-290.791) [-289.918] * (-288.814) [-289.510] (-289.250) (-289.088) -- 0:00:20
      641000 -- [-288.293] (-290.776) (-291.431) (-289.046) * (-288.863) [-292.109] (-288.634) (-292.325) -- 0:00:20
      641500 -- (-289.039) (-289.558) (-291.905) [-289.110] * (-292.875) [-290.691] (-288.166) (-291.005) -- 0:00:20
      642000 -- (-289.224) (-289.879) [-288.512] (-291.356) * (-292.795) (-293.241) (-287.483) [-290.327] -- 0:00:20
      642500 -- (-294.702) (-289.482) (-288.932) [-289.588] * (-289.420) [-287.601] (-288.330) (-288.773) -- 0:00:20
      643000 -- [-288.022] (-288.757) (-290.080) (-289.686) * [-287.938] (-288.812) (-289.735) (-288.480) -- 0:00:20
      643500 -- (-288.642) [-290.414] (-293.051) (-290.450) * [-289.208] (-289.299) (-292.393) (-288.404) -- 0:00:21
      644000 -- (-294.906) (-289.593) (-288.967) [-288.418] * [-288.313] (-289.383) (-294.937) (-288.648) -- 0:00:21
      644500 -- (-290.484) [-289.412] (-289.055) (-287.889) * (-287.595) [-289.455] (-293.750) (-288.629) -- 0:00:20
      645000 -- (-287.942) (-294.158) (-288.026) [-288.985] * (-288.142) (-291.718) (-291.891) [-288.247] -- 0:00:20

      Average standard deviation of split frequencies: 0.009578

      645500 -- (-288.583) (-291.394) [-288.802] (-288.958) * (-289.539) [-289.434] (-289.346) (-289.955) -- 0:00:20
      646000 -- (-291.111) (-291.255) (-287.985) [-289.850] * (-290.168) [-287.776] (-288.373) (-289.499) -- 0:00:20
      646500 -- (-290.528) [-287.966] (-287.821) (-290.136) * (-290.902) (-288.110) [-289.545] (-288.577) -- 0:00:20
      647000 -- (-287.808) [-288.412] (-287.195) (-289.633) * (-289.036) [-287.461] (-289.510) (-289.610) -- 0:00:20
      647500 -- [-288.075] (-294.329) (-289.976) (-289.449) * [-291.433] (-289.212) (-288.990) (-291.901) -- 0:00:20
      648000 -- (-287.156) (-289.482) (-289.377) [-288.350] * (-294.269) [-293.179] (-290.026) (-290.160) -- 0:00:20
      648500 -- [-288.884] (-288.953) (-290.847) (-289.520) * [-293.865] (-290.227) (-292.004) (-289.603) -- 0:00:20
      649000 -- (-287.820) (-288.450) [-291.807] (-291.864) * [-292.091] (-292.872) (-288.191) (-290.726) -- 0:00:20
      649500 -- [-292.467] (-290.141) (-294.465) (-292.952) * (-290.229) (-294.215) (-289.549) [-289.790] -- 0:00:20
      650000 -- (-296.400) (-289.501) [-295.294] (-293.820) * (-289.108) [-288.201] (-290.039) (-288.974) -- 0:00:20

      Average standard deviation of split frequencies: 0.008739

      650500 -- [-294.139] (-290.635) (-289.726) (-293.110) * (-287.731) (-289.710) [-292.081] (-290.129) -- 0:00:20
      651000 -- (-289.861) (-289.259) [-289.102] (-288.536) * [-287.546] (-293.492) (-289.321) (-290.933) -- 0:00:20
      651500 -- (-291.104) (-293.818) (-289.160) [-288.724] * (-287.759) [-291.510] (-289.110) (-287.867) -- 0:00:20
      652000 -- (-288.841) [-288.638] (-289.624) (-288.294) * (-290.775) (-288.075) (-287.902) [-289.693] -- 0:00:20
      652500 -- (-289.952) (-289.226) (-288.354) [-290.662] * (-289.831) (-291.007) (-288.475) [-289.272] -- 0:00:20
      653000 -- (-287.852) (-289.316) (-290.589) [-292.348] * (-287.410) [-289.056] (-290.370) (-291.253) -- 0:00:20
      653500 -- (-288.589) (-289.765) [-292.442] (-293.003) * [-289.181] (-290.795) (-295.593) (-288.369) -- 0:00:20
      654000 -- (-289.678) (-289.917) (-289.344) [-289.299] * [-287.865] (-290.844) (-289.089) (-289.276) -- 0:00:20
      654500 -- (-287.753) (-298.102) [-288.294] (-290.170) * [-292.078] (-290.780) (-290.156) (-288.824) -- 0:00:20
      655000 -- (-289.622) [-293.221] (-289.711) (-288.903) * [-288.720] (-288.016) (-289.887) (-287.436) -- 0:00:20

      Average standard deviation of split frequencies: 0.008309

      655500 -- (-290.578) (-291.565) [-289.133] (-289.432) * (-290.079) (-288.661) [-287.584] (-296.103) -- 0:00:19
      656000 -- [-293.300] (-292.249) (-288.160) (-290.116) * (-289.419) (-288.426) [-291.822] (-291.294) -- 0:00:19
      656500 -- (-288.457) (-288.582) (-288.410) [-287.683] * [-289.710] (-288.972) (-293.009) (-289.806) -- 0:00:19
      657000 -- (-289.584) [-289.572] (-290.151) (-287.594) * [-287.508] (-295.880) (-292.056) (-291.104) -- 0:00:19
      657500 -- (-291.527) [-291.280] (-289.703) (-289.004) * (-287.857) [-291.388] (-288.743) (-288.989) -- 0:00:19
      658000 -- (-297.073) (-289.216) [-290.211] (-294.343) * (-288.936) (-289.618) (-289.763) [-288.788] -- 0:00:19
      658500 -- (-291.145) (-289.833) [-287.324] (-290.396) * (-294.732) [-288.408] (-289.035) (-290.877) -- 0:00:19
      659000 -- (-288.788) (-288.561) [-289.628] (-292.177) * (-291.548) [-289.069] (-292.926) (-290.002) -- 0:00:19
      659500 -- (-287.414) [-289.243] (-289.588) (-289.145) * (-289.526) (-289.871) [-289.213] (-290.641) -- 0:00:19
      660000 -- [-287.842] (-291.000) (-290.142) (-294.262) * (-291.429) [-288.726] (-288.650) (-289.357) -- 0:00:19

      Average standard deviation of split frequencies: 0.008206

      660500 -- (-287.714) (-290.443) (-292.567) [-289.861] * (-288.420) [-288.708] (-288.427) (-289.011) -- 0:00:19
      661000 -- (-288.671) [-288.090] (-293.292) (-288.569) * (-288.551) (-288.001) [-288.293] (-289.174) -- 0:00:20
      661500 -- (-289.115) (-288.640) (-291.840) [-288.514] * (-288.423) (-289.431) [-288.726] (-291.176) -- 0:00:19
      662000 -- (-290.155) [-289.011] (-292.250) (-289.412) * (-291.639) (-293.033) [-287.616] (-288.660) -- 0:00:19
      662500 -- (-291.435) (-290.206) [-289.608] (-288.830) * (-288.793) (-291.163) (-289.221) [-290.192] -- 0:00:19
      663000 -- [-291.418] (-289.015) (-287.521) (-290.041) * (-292.968) (-297.772) (-292.030) [-288.832] -- 0:00:19
      663500 -- (-288.786) (-289.025) (-289.406) [-288.914] * (-288.176) [-291.473] (-294.874) (-289.459) -- 0:00:19
      664000 -- (-288.733) [-289.583] (-290.844) (-290.001) * (-288.009) [-290.903] (-291.632) (-290.125) -- 0:00:19
      664500 -- (-290.534) (-290.246) [-289.684] (-289.846) * (-291.293) (-296.210) [-288.837] (-288.771) -- 0:00:19
      665000 -- (-287.512) [-291.210] (-289.690) (-290.604) * (-289.133) [-291.096] (-291.176) (-289.191) -- 0:00:19

      Average standard deviation of split frequencies: 0.008140

      665500 -- (-288.349) (-289.238) (-288.364) [-288.126] * (-288.236) (-290.207) (-288.413) [-288.132] -- 0:00:19
      666000 -- (-288.817) (-290.197) [-288.907] (-289.552) * (-293.518) (-292.419) (-289.403) [-288.258] -- 0:00:19
      666500 -- (-288.094) [-291.656] (-291.743) (-287.405) * (-290.542) [-293.863] (-288.065) (-287.994) -- 0:00:19
      667000 -- [-287.875] (-289.520) (-291.452) (-288.794) * [-290.321] (-292.964) (-289.353) (-294.803) -- 0:00:19
      667500 -- (-290.206) [-289.803] (-287.947) (-291.526) * (-289.263) (-290.448) (-290.437) [-291.856] -- 0:00:19
      668000 -- [-287.289] (-289.746) (-290.115) (-292.581) * (-290.530) [-291.891] (-290.756) (-294.261) -- 0:00:19
      668500 -- (-288.686) (-287.634) [-290.646] (-288.380) * (-291.041) (-296.501) (-289.048) [-289.771] -- 0:00:19
      669000 -- (-290.956) (-287.486) (-288.737) [-288.041] * (-290.172) (-288.048) [-289.131] (-291.679) -- 0:00:19
      669500 -- (-288.210) (-289.106) (-289.588) [-291.200] * [-288.060] (-289.536) (-290.313) (-291.364) -- 0:00:19
      670000 -- (-287.796) [-287.632] (-289.306) (-292.513) * (-288.147) (-291.302) [-289.039] (-288.550) -- 0:00:19

      Average standard deviation of split frequencies: 0.008215

      670500 -- (-288.163) [-287.689] (-288.301) (-287.760) * [-292.652] (-289.629) (-287.863) (-287.822) -- 0:00:19
      671000 -- [-288.279] (-290.456) (-290.802) (-288.215) * (-288.854) (-288.877) [-288.565] (-289.021) -- 0:00:19
      671500 -- [-288.987] (-290.404) (-290.691) (-290.001) * (-289.884) (-289.605) [-289.473] (-289.188) -- 0:00:19
      672000 -- (-289.576) [-288.182] (-288.627) (-287.754) * (-288.449) (-289.166) [-288.804] (-291.647) -- 0:00:19
      672500 -- (-290.526) (-290.493) [-287.649] (-288.164) * (-290.959) (-289.289) [-288.256] (-288.383) -- 0:00:18
      673000 -- [-288.121] (-287.634) (-289.029) (-290.694) * [-287.503] (-288.784) (-289.135) (-288.339) -- 0:00:18
      673500 -- (-290.330) (-293.965) [-287.500] (-290.390) * (-292.692) [-287.460] (-289.530) (-292.450) -- 0:00:18
      674000 -- (-289.715) (-291.633) (-292.020) [-292.652] * [-289.588] (-290.756) (-289.162) (-288.071) -- 0:00:18
      674500 -- (-289.204) (-287.542) [-287.871] (-290.648) * (-288.475) (-288.661) [-289.001] (-288.443) -- 0:00:18
      675000 -- (-290.873) (-287.341) [-287.365] (-290.169) * (-289.909) [-287.396] (-291.291) (-289.172) -- 0:00:18

      Average standard deviation of split frequencies: 0.008063

      675500 -- [-290.397] (-290.791) (-287.985) (-295.681) * [-289.655] (-288.310) (-290.756) (-288.869) -- 0:00:18
      676000 -- (-291.552) (-292.559) (-288.278) [-287.708] * [-291.062] (-289.974) (-298.841) (-290.756) -- 0:00:18
      676500 -- [-290.019] (-289.619) (-287.650) (-291.434) * (-291.054) (-291.582) (-287.577) [-290.269] -- 0:00:18
      677000 -- [-291.466] (-288.268) (-287.482) (-290.091) * (-288.542) (-291.704) (-288.272) [-288.311] -- 0:00:18
      677500 -- (-289.766) [-288.318] (-291.490) (-288.055) * (-289.249) [-288.631] (-289.451) (-287.719) -- 0:00:18
      678000 -- (-287.672) (-289.555) (-288.361) [-291.855] * (-288.445) [-287.465] (-289.732) (-292.868) -- 0:00:18
      678500 -- (-287.549) [-289.388] (-289.305) (-289.570) * (-290.692) [-290.376] (-288.394) (-287.804) -- 0:00:18
      679000 -- (-288.719) (-288.357) [-290.738] (-288.461) * (-288.591) (-290.045) [-288.837] (-289.721) -- 0:00:18
      679500 -- [-288.818] (-289.840) (-290.911) (-288.885) * [-288.281] (-291.200) (-289.313) (-289.157) -- 0:00:18
      680000 -- (-287.822) (-288.744) (-290.149) [-288.372] * [-288.009] (-288.706) (-288.922) (-289.743) -- 0:00:18

      Average standard deviation of split frequencies: 0.008138

      680500 -- [-289.685] (-289.640) (-293.531) (-292.376) * (-291.609) (-287.477) (-290.778) [-290.450] -- 0:00:18
      681000 -- (-288.418) (-288.704) (-290.773) [-294.630] * (-292.243) (-287.875) [-289.560] (-290.295) -- 0:00:18
      681500 -- (-291.085) [-291.588] (-290.346) (-295.180) * (-290.622) (-288.783) [-289.472] (-293.899) -- 0:00:18
      682000 -- (-287.801) [-289.814] (-289.492) (-291.311) * [-292.467] (-294.167) (-289.795) (-296.343) -- 0:00:18
      682500 -- (-288.082) [-288.360] (-289.946) (-289.224) * (-287.349) (-293.894) [-289.265] (-294.217) -- 0:00:18
      683000 -- (-289.755) (-290.164) [-295.535] (-292.164) * [-287.291] (-289.938) (-290.241) (-288.394) -- 0:00:18
      683500 -- (-288.819) (-288.287) (-292.310) [-291.089] * [-293.573] (-289.927) (-291.115) (-289.754) -- 0:00:18
      684000 -- (-289.821) [-289.372] (-297.054) (-293.367) * (-290.900) (-289.817) (-289.406) [-291.995] -- 0:00:18
      684500 -- [-293.883] (-289.410) (-289.300) (-288.080) * (-289.102) (-292.217) [-290.119] (-289.744) -- 0:00:18
      685000 -- (-288.845) (-290.462) [-288.632] (-288.779) * [-288.611] (-291.098) (-289.763) (-290.553) -- 0:00:18

      Average standard deviation of split frequencies: 0.007988

      685500 -- [-289.785] (-288.689) (-290.652) (-291.161) * (-289.079) (-289.165) (-290.314) [-292.197] -- 0:00:18
      686000 -- (-291.873) [-289.830] (-290.607) (-292.564) * (-290.143) [-289.288] (-297.628) (-291.881) -- 0:00:18
      686500 -- [-288.113] (-292.372) (-289.891) (-289.022) * [-288.726] (-291.931) (-299.426) (-293.106) -- 0:00:18
      687000 -- [-288.602] (-288.001) (-288.577) (-288.630) * [-288.155] (-290.193) (-291.147) (-290.038) -- 0:00:18
      687500 -- [-289.490] (-287.741) (-288.773) (-287.726) * (-292.623) (-290.137) [-289.043] (-290.099) -- 0:00:18
      688000 -- (-290.037) (-292.037) [-289.076] (-288.321) * [-289.782] (-289.666) (-288.293) (-292.253) -- 0:00:18
      688500 -- (-289.675) (-290.979) (-290.399) [-288.858] * [-290.023] (-287.328) (-287.958) (-295.813) -- 0:00:18
      689000 -- (-291.729) (-289.380) [-289.313] (-288.750) * [-291.894] (-290.565) (-290.958) (-295.574) -- 0:00:18
      689500 -- (-290.837) (-289.076) [-290.889] (-288.860) * [-290.792] (-288.095) (-294.212) (-293.272) -- 0:00:18
      690000 -- (-291.599) [-289.537] (-289.979) (-288.476) * (-288.283) (-288.354) (-289.009) [-290.804] -- 0:00:17

      Average standard deviation of split frequencies: 0.008233

      690500 -- [-289.310] (-288.414) (-292.504) (-290.947) * (-288.602) [-289.984] (-289.276) (-291.524) -- 0:00:17
      691000 -- (-289.231) (-287.645) (-291.842) [-287.730] * (-289.013) [-288.385] (-288.410) (-290.743) -- 0:00:17
      691500 -- [-293.779] (-294.530) (-288.637) (-290.667) * (-293.277) (-291.012) (-290.263) [-289.743] -- 0:00:17
      692000 -- (-289.534) [-291.435] (-288.228) (-289.663) * (-290.921) (-289.456) (-288.492) [-294.005] -- 0:00:17
      692500 -- (-294.145) (-290.010) (-289.607) [-289.099] * (-292.998) [-290.980] (-290.002) (-294.278) -- 0:00:17
      693000 -- (-292.407) (-289.187) [-292.088] (-289.251) * (-292.762) [-287.945] (-291.470) (-289.387) -- 0:00:17
      693500 -- (-289.966) (-289.470) (-289.006) [-294.155] * (-291.378) (-289.213) (-289.590) [-288.197] -- 0:00:17
      694000 -- [-288.280] (-287.631) (-288.584) (-289.271) * (-291.094) [-289.387] (-288.799) (-287.715) -- 0:00:17
      694500 -- (-295.051) (-289.046) [-287.540] (-291.365) * [-290.844] (-290.099) (-288.468) (-289.078) -- 0:00:17
      695000 -- (-288.608) [-288.041] (-288.490) (-291.447) * (-291.614) [-290.127] (-288.960) (-289.779) -- 0:00:17

      Average standard deviation of split frequencies: 0.008845

      695500 -- (-289.730) [-288.565] (-290.245) (-287.609) * [-287.967] (-290.518) (-288.212) (-289.380) -- 0:00:17
      696000 -- [-289.070] (-287.896) (-296.651) (-287.404) * [-288.194] (-288.881) (-288.832) (-290.706) -- 0:00:17
      696500 -- [-288.182] (-288.811) (-294.947) (-288.684) * [-287.867] (-289.113) (-289.687) (-288.522) -- 0:00:17
      697000 -- (-292.062) [-290.408] (-288.966) (-290.469) * (-287.202) (-288.593) [-292.030] (-290.054) -- 0:00:17
      697500 -- (-288.919) [-288.580] (-289.727) (-290.210) * (-290.551) (-287.622) [-291.816] (-287.641) -- 0:00:17
      698000 -- (-288.285) [-288.200] (-289.270) (-293.195) * [-289.213] (-288.826) (-291.224) (-290.639) -- 0:00:17
      698500 -- (-288.798) (-290.601) [-288.290] (-294.206) * [-288.002] (-291.552) (-290.955) (-291.291) -- 0:00:17
      699000 -- (-290.001) [-288.809] (-292.389) (-287.741) * (-287.747) [-294.129] (-290.397) (-288.805) -- 0:00:17
      699500 -- (-292.601) [-288.886] (-290.081) (-290.100) * [-290.240] (-291.748) (-290.931) (-294.111) -- 0:00:17
      700000 -- (-292.919) (-287.994) (-289.246) [-288.808] * [-288.009] (-289.440) (-291.907) (-288.564) -- 0:00:17

      Average standard deviation of split frequencies: 0.008984

      700500 -- (-290.293) (-289.313) [-287.776] (-287.810) * (-288.203) (-290.150) [-295.198] (-289.252) -- 0:00:17
      701000 -- (-291.220) (-288.576) (-288.463) [-288.748] * (-288.003) [-288.693] (-292.207) (-289.676) -- 0:00:17
      701500 -- (-287.832) (-289.135) [-288.630] (-290.033) * (-291.471) (-288.869) [-288.281] (-289.123) -- 0:00:17
      702000 -- (-291.646) (-294.899) (-287.953) [-289.291] * (-290.730) (-289.328) (-288.302) [-288.348] -- 0:00:17
      702500 -- [-288.412] (-295.110) (-289.307) (-288.246) * (-290.920) (-291.022) (-288.097) [-287.820] -- 0:00:17
      703000 -- [-288.583] (-296.595) (-288.976) (-289.282) * (-288.930) [-289.889] (-289.924) (-288.828) -- 0:00:17
      703500 -- [-288.785] (-291.054) (-289.812) (-293.895) * (-288.950) [-289.656] (-287.442) (-292.186) -- 0:00:17
      704000 -- (-288.374) (-289.796) [-293.330] (-291.049) * [-288.492] (-288.117) (-290.843) (-289.380) -- 0:00:17
      704500 -- (-289.407) (-292.788) (-290.638) [-288.289] * [-288.055] (-288.906) (-288.032) (-290.711) -- 0:00:17
      705000 -- (-289.809) (-290.267) (-291.170) [-290.746] * [-288.454] (-290.727) (-287.606) (-288.495) -- 0:00:17

      Average standard deviation of split frequencies: 0.009544

      705500 -- (-289.077) [-289.750] (-291.259) (-291.350) * (-288.620) (-293.869) (-289.036) [-288.496] -- 0:00:17
      706000 -- (-289.684) (-287.923) [-290.406] (-289.481) * (-289.722) (-287.909) (-289.176) [-288.186] -- 0:00:17
      706500 -- [-290.724] (-288.290) (-288.716) (-287.547) * (-294.547) [-287.377] (-289.794) (-289.031) -- 0:00:17
      707000 -- [-288.459] (-288.783) (-289.175) (-288.000) * (-290.668) [-290.741] (-294.019) (-289.864) -- 0:00:16
      707500 -- (-289.029) (-289.423) (-287.534) [-291.331] * (-289.190) (-289.520) [-289.281] (-289.556) -- 0:00:16
      708000 -- [-288.311] (-289.021) (-288.307) (-290.073) * (-287.940) (-289.721) (-290.061) [-287.172] -- 0:00:16
      708500 -- (-288.485) (-291.610) (-289.983) [-288.834] * [-289.314] (-290.697) (-290.098) (-289.355) -- 0:00:16
      709000 -- (-296.483) [-287.424] (-292.481) (-294.293) * [-291.097] (-289.685) (-287.929) (-288.519) -- 0:00:16
      709500 -- (-290.251) [-289.131] (-290.282) (-289.979) * (-290.845) [-288.816] (-289.032) (-288.690) -- 0:00:16
      710000 -- (-289.553) [-287.284] (-288.607) (-287.320) * (-289.530) (-287.680) (-288.938) [-290.471] -- 0:00:16

      Average standard deviation of split frequencies: 0.009287

      710500 -- (-296.093) (-288.199) [-291.792] (-288.500) * (-293.139) (-287.966) (-290.679) [-292.785] -- 0:00:16
      711000 -- (-294.779) (-290.723) (-292.504) [-290.866] * (-290.208) (-290.576) [-287.129] (-292.851) -- 0:00:16
      711500 -- (-291.075) (-288.743) [-288.780] (-287.862) * [-289.111] (-291.083) (-290.845) (-289.379) -- 0:00:16
      712000 -- (-288.487) [-291.337] (-289.155) (-288.202) * (-290.915) (-288.537) [-292.191] (-291.951) -- 0:00:16
      712500 -- (-292.202) [-290.052] (-287.943) (-290.042) * (-290.925) [-292.143] (-289.369) (-292.486) -- 0:00:16
      713000 -- (-289.653) (-290.489) [-292.858] (-291.749) * (-290.264) [-289.970] (-290.231) (-290.796) -- 0:00:16
      713500 -- [-288.860] (-289.681) (-288.460) (-287.536) * [-288.691] (-291.863) (-291.870) (-287.841) -- 0:00:16
      714000 -- (-291.074) (-291.249) (-292.513) [-288.303] * [-289.354] (-288.954) (-290.383) (-288.926) -- 0:00:16
      714500 -- (-288.917) (-292.343) [-291.710] (-289.026) * [-287.871] (-288.530) (-288.273) (-290.548) -- 0:00:16
      715000 -- (-289.616) (-289.825) [-288.171] (-292.471) * (-287.917) [-288.742] (-288.495) (-288.534) -- 0:00:16

      Average standard deviation of split frequencies: 0.008946

      715500 -- [-290.499] (-291.270) (-289.303) (-289.103) * (-289.584) (-289.204) [-287.663] (-291.942) -- 0:00:16
      716000 -- [-287.997] (-288.004) (-289.284) (-289.285) * [-287.882] (-288.563) (-289.295) (-288.661) -- 0:00:16
      716500 -- [-291.416] (-293.148) (-287.386) (-289.677) * (-288.056) (-290.263) [-288.896] (-297.516) -- 0:00:16
      717000 -- (-288.483) [-288.355] (-289.246) (-291.211) * (-289.548) (-288.857) [-290.082] (-296.996) -- 0:00:16
      717500 -- (-293.093) [-289.347] (-288.822) (-293.766) * [-291.374] (-289.071) (-288.507) (-291.252) -- 0:00:16
      718000 -- (-294.516) (-287.210) (-289.202) [-292.756] * (-293.485) (-290.568) (-288.783) [-288.732] -- 0:00:16
      718500 -- (-296.339) (-287.403) [-290.546] (-287.540) * (-291.234) [-288.260] (-287.801) (-292.954) -- 0:00:16
      719000 -- (-289.680) [-290.384] (-290.450) (-291.933) * (-293.156) (-288.988) [-287.531] (-290.157) -- 0:00:16
      719500 -- (-293.552) [-289.572] (-292.405) (-290.070) * (-292.599) (-289.515) [-287.447] (-296.070) -- 0:00:16
      720000 -- (-293.433) (-290.452) (-288.838) [-287.919] * (-289.460) (-288.158) (-293.992) [-289.105] -- 0:00:16

      Average standard deviation of split frequencies: 0.008427

      720500 -- (-290.159) (-288.825) [-287.571] (-288.402) * (-288.435) (-290.410) [-291.575] (-291.466) -- 0:00:16
      721000 -- (-289.096) (-289.721) [-287.792] (-289.848) * [-288.481] (-291.975) (-293.973) (-289.204) -- 0:00:16
      721500 -- (-287.575) [-290.583] (-290.195) (-288.527) * [-288.653] (-288.121) (-289.129) (-290.244) -- 0:00:16
      722000 -- [-291.761] (-290.829) (-289.298) (-289.677) * [-289.175] (-291.738) (-287.648) (-290.677) -- 0:00:16
      722500 -- [-289.359] (-288.971) (-288.078) (-287.515) * [-288.611] (-289.242) (-289.571) (-288.323) -- 0:00:16
      723000 -- (-287.795) (-288.887) (-290.431) [-290.571] * (-291.977) (-289.464) [-289.180] (-292.034) -- 0:00:16
      723500 -- [-288.099] (-287.764) (-288.726) (-290.475) * [-296.772] (-288.364) (-289.604) (-287.917) -- 0:00:16
      724000 -- (-291.792) (-292.715) (-288.131) [-288.583] * (-288.598) (-290.836) [-291.790] (-287.899) -- 0:00:16
      724500 -- [-290.447] (-289.182) (-289.828) (-290.398) * (-290.744) (-288.896) (-290.471) [-287.806] -- 0:00:15
      725000 -- (-290.041) [-288.302] (-289.512) (-289.838) * (-289.475) (-288.979) [-293.956] (-288.935) -- 0:00:15

      Average standard deviation of split frequencies: 0.008403

      725500 -- (-289.610) (-290.691) [-289.994] (-289.692) * (-290.367) (-289.298) [-289.481] (-289.316) -- 0:00:15
      726000 -- [-288.926] (-289.612) (-288.736) (-288.587) * [-290.362] (-287.556) (-291.387) (-292.568) -- 0:00:15
      726500 -- (-288.411) (-293.154) (-289.613) [-291.253] * (-290.617) (-288.017) [-292.324] (-289.825) -- 0:00:15
      727000 -- (-289.902) [-289.694] (-287.773) (-288.237) * (-291.103) (-288.598) (-288.276) [-289.118] -- 0:00:15
      727500 -- (-289.932) (-290.508) [-289.307] (-289.449) * (-287.789) (-288.478) (-289.441) [-287.998] -- 0:00:15
      728000 -- (-288.795) [-292.207] (-288.831) (-288.868) * [-287.667] (-287.641) (-291.503) (-288.826) -- 0:00:15
      728500 -- [-289.204] (-289.747) (-292.119) (-289.070) * (-288.552) (-288.553) [-289.841] (-294.203) -- 0:00:15
      729000 -- [-292.702] (-288.106) (-291.082) (-290.236) * (-288.247) [-287.861] (-291.659) (-293.550) -- 0:00:15
      729500 -- (-289.570) [-287.983] (-289.623) (-288.999) * (-291.904) (-290.746) (-289.072) [-287.460] -- 0:00:15
      730000 -- (-287.348) (-289.158) [-291.413] (-291.704) * (-287.719) [-287.565] (-293.280) (-287.914) -- 0:00:15

      Average standard deviation of split frequencies: 0.008425

      730500 -- (-288.636) [-288.447] (-295.166) (-291.556) * (-290.816) [-290.042] (-287.287) (-293.062) -- 0:00:15
      731000 -- (-288.921) (-287.469) [-290.554] (-290.403) * (-287.683) (-291.311) [-288.462] (-289.756) -- 0:00:15
      731500 -- (-288.022) [-287.799] (-289.168) (-291.009) * (-288.897) (-288.255) [-288.923] (-288.763) -- 0:00:15
      732000 -- (-288.858) (-289.720) [-291.627] (-288.884) * [-288.825] (-291.022) (-289.848) (-289.431) -- 0:00:15
      732500 -- (-289.241) [-289.184] (-294.453) (-287.619) * (-288.154) (-292.253) (-291.453) [-288.478] -- 0:00:15
      733000 -- (-290.020) (-292.016) [-288.466] (-294.872) * (-290.730) (-289.940) (-289.463) [-287.533] -- 0:00:15
      733500 -- (-292.465) (-289.576) [-288.308] (-287.738) * (-288.649) (-288.074) (-290.266) [-288.241] -- 0:00:15
      734000 -- (-288.354) [-289.244] (-292.096) (-288.672) * (-288.259) (-290.150) (-288.693) [-291.817] -- 0:00:1