--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:27:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0265/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -288.80 -291.91
2 -288.79 -292.30
--------------------------------------
TOTAL -288.80 -292.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895882 0.095827 0.380378 1.526504 0.857581 1280.96 1390.98 1.000
r(A<->C){all} 0.170543 0.020742 0.000021 0.463445 0.132601 120.02 147.04 1.002
r(A<->G){all} 0.160298 0.018971 0.000030 0.429086 0.120020 239.22 288.40 1.000
r(A<->T){all} 0.174874 0.022368 0.000063 0.473358 0.135955 140.68 161.48 1.000
r(C<->G){all} 0.149526 0.017595 0.000093 0.422501 0.110395 220.90 235.56 1.000
r(C<->T){all} 0.171901 0.020091 0.000206 0.474434 0.137472 189.30 229.00 1.000
r(G<->T){all} 0.172857 0.020666 0.000098 0.465335 0.137672 191.66 217.90 1.002
pi(A){all} 0.174210 0.000681 0.122705 0.225415 0.173436 1120.58 1310.79 1.000
pi(C){all} 0.265446 0.000891 0.209849 0.325972 0.264334 1165.55 1250.76 1.000
pi(G){all} 0.298161 0.000991 0.238360 0.361513 0.297308 1171.02 1247.74 1.001
pi(T){all} 0.262183 0.000904 0.201532 0.317675 0.261163 1313.65 1407.33 1.001
alpha{1,2} 0.417385 0.230205 0.000237 1.397936 0.243918 800.00 1011.86 1.000
alpha{3} 0.440089 0.241295 0.000216 1.442665 0.280301 1457.63 1479.31 1.000
pinvar{all} 0.992042 0.000097 0.973463 0.999992 0.995156 1356.80 1362.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -270.244501
Model 2: PositiveSelection -270.244503
Model 0: one-ratio -270.24451
Model 7: beta -270.244446
Model 8: beta&w>1 -270.244446
Model 0 vs 1 1.799999995455437E-5
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 0.0
>C1
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C2
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C3
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C4
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C5
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C6
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=70
C1 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C2 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C3 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C4 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C5 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C6 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
**************************************************
C1 PDDVVKTQLFARIVTLLTWI
C2 PDDVVKTQLFARIVTLLTWI
C3 PDDVVKTQLFARIVTLLTWI
C4 PDDVVKTQLFARIVTLLTWI
C5 PDDVVKTQLFARIVTLLTWI
C6 PDDVVKTQLFARIVTLLTWI
********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 70 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 70 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2100]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2100]--->[2100]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.446 Mb, Max= 30.589 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C2 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C3 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C4 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C5 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
C6 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
**************************************************
C1 PDDVVKTQLFARIVTLLTWI
C2 PDDVVKTQLFARIVTLLTWI
C3 PDDVVKTQLFARIVTLLTWI
C4 PDDVVKTQLFARIVTLLTWI
C5 PDDVVKTQLFARIVTLLTWI
C6 PDDVVKTQLFARIVTLLTWI
********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C2 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C3 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C4 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C5 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
C6 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
**************************************************
C1 CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C2 CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C3 CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C4 CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C5 CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
C6 CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
**************************************************
C1 GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C2 GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C3 GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C4 GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C5 GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
C6 GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
**************************************************
C1 CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C2 CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C3 CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C4 CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C5 CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
C6 CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
**************************************************
C1 CACCTGGATT
C2 CACCTGGATT
C3 CACCTGGATT
C4 CACCTGGATT
C5 CACCTGGATT
C6 CACCTGGATT
**********
>C1
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C2
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C3
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C4
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C5
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C6
TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG
CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG
GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG
CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT
CACCTGGATT
>C1
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C2
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C3
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C4
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C5
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
>C6
LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
PDDVVKTQLFARIVTLLTWI
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 210 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579796766
Setting output file names to "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 728833707
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0331645202
Seed = 1626890552
Swapseed = 1579796766
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -469.990066 -- -24.965149
Chain 2 -- -469.989995 -- -24.965149
Chain 3 -- -469.990039 -- -24.965149
Chain 4 -- -469.990039 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -469.990066 -- -24.965149
Chain 2 -- -469.989995 -- -24.965149
Chain 3 -- -469.990066 -- -24.965149
Chain 4 -- -469.990066 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-469.990] (-469.990) (-469.990) (-469.990) * [-469.990] (-469.990) (-469.990) (-469.990)
500 -- [-296.756] (-294.244) (-297.383) (-298.128) * [-298.118] (-292.830) (-303.731) (-298.410) -- 0:00:00
1000 -- [-295.469] (-298.879) (-295.113) (-303.523) * (-302.442) (-295.025) (-310.961) [-298.805] -- 0:00:00
1500 -- (-299.025) (-296.612) [-298.124] (-296.198) * (-299.352) (-297.061) [-297.810] (-301.820) -- 0:00:00
2000 -- (-304.037) (-299.893) (-298.081) [-298.618] * (-300.890) [-296.526] (-296.340) (-302.990) -- 0:00:00
2500 -- (-304.858) (-299.108) (-296.611) [-297.670] * [-299.900] (-310.998) (-298.000) (-306.024) -- 0:00:00
3000 -- (-305.127) [-298.069] (-309.682) (-298.242) * (-297.678) (-302.000) (-297.362) [-290.187] -- 0:00:00
3500 -- [-296.046] (-297.575) (-307.142) (-296.174) * (-296.787) (-296.391) (-296.995) [-301.416] -- 0:00:00
4000 -- (-296.685) (-300.525) (-306.514) [-296.977] * [-295.533] (-295.879) (-300.273) (-294.892) -- 0:00:00
4500 -- (-300.389) (-304.041) [-288.872] (-304.842) * (-303.378) (-298.979) (-299.929) [-298.694] -- 0:00:00
5000 -- [-295.091] (-298.567) (-290.245) (-294.927) * (-297.929) (-297.913) (-304.096) [-294.426] -- 0:00:00
Average standard deviation of split frequencies: 0.102479
5500 -- (-301.580) (-301.735) (-288.417) [-295.849] * (-299.987) (-294.347) (-301.274) [-297.886] -- 0:00:00
6000 -- (-298.587) [-298.374] (-287.742) (-301.108) * (-294.825) (-297.601) (-295.890) [-298.092] -- 0:00:00
6500 -- (-311.991) (-299.254) [-288.507] (-298.262) * (-292.767) [-296.668] (-309.881) (-302.145) -- 0:02:32
7000 -- (-312.440) (-293.944) [-291.247] (-295.084) * (-305.626) (-300.847) (-309.116) [-299.784] -- 0:02:21
7500 -- (-311.556) [-297.841] (-288.824) (-297.917) * (-306.973) (-305.850) (-299.859) [-299.865] -- 0:02:12
8000 -- (-299.854) (-299.855) [-290.374] (-299.160) * (-295.091) (-301.940) [-295.031] (-300.866) -- 0:02:04
8500 -- (-295.563) [-301.866] (-288.053) (-299.118) * (-301.820) (-313.839) (-296.055) [-303.693] -- 0:01:56
9000 -- (-288.246) (-305.251) (-290.561) [-296.394] * (-303.157) [-295.480] (-302.463) (-302.237) -- 0:01:50
9500 -- (-288.048) (-297.512) [-288.381] (-296.178) * (-311.109) (-302.136) (-304.769) [-297.564] -- 0:01:44
10000 -- (-287.923) [-302.054] (-291.717) (-304.131) * (-298.687) (-300.243) (-294.290) [-294.443] -- 0:01:39
Average standard deviation of split frequencies: 0.092808
10500 -- (-289.001) (-306.478) [-287.517] (-296.752) * (-297.832) (-297.892) (-298.552) [-294.818] -- 0:01:34
11000 -- (-290.324) (-300.058) [-288.892] (-294.950) * (-298.541) (-297.019) [-297.079] (-296.186) -- 0:01:29
11500 -- [-288.668] (-294.145) (-292.026) (-293.378) * (-301.085) (-301.663) [-305.248] (-302.980) -- 0:01:25
12000 -- (-289.338) [-291.873] (-292.864) (-303.774) * (-309.104) (-295.990) [-304.449] (-293.827) -- 0:01:22
12500 -- (-288.239) (-289.291) [-290.239] (-295.492) * [-295.957] (-299.447) (-298.826) (-295.418) -- 0:01:19
13000 -- (-289.696) (-290.570) [-289.018] (-299.056) * (-305.016) [-295.697] (-300.150) (-298.661) -- 0:01:15
13500 -- (-289.141) [-289.793] (-291.499) (-292.656) * (-299.781) (-304.787) [-298.170] (-300.290) -- 0:01:13
14000 -- (-289.336) [-289.264] (-289.096) (-300.185) * (-293.100) (-301.906) [-299.682] (-301.734) -- 0:01:10
14500 -- (-290.164) (-288.021) [-288.203] (-301.463) * (-301.427) (-299.334) (-295.591) [-299.880] -- 0:01:07
15000 -- (-290.758) (-290.298) (-288.792) [-297.726] * [-300.805] (-305.629) (-295.098) (-308.214) -- 0:01:05
Average standard deviation of split frequencies: 0.066679
15500 -- (-289.328) [-289.196] (-295.171) (-302.219) * (-303.162) (-307.450) (-299.754) [-296.913] -- 0:01:03
16000 -- (-291.034) [-291.581] (-288.953) (-303.476) * (-299.022) [-293.146] (-299.362) (-298.199) -- 0:01:01
16500 -- (-291.297) (-289.279) (-288.089) [-296.325] * (-299.360) (-299.002) (-303.166) [-303.418] -- 0:00:59
17000 -- (-288.899) (-291.748) [-288.116] (-289.547) * [-292.114] (-302.019) (-297.338) (-306.862) -- 0:00:57
17500 -- [-289.438] (-288.835) (-288.788) (-288.442) * (-307.405) (-298.517) [-296.785] (-301.666) -- 0:00:56
18000 -- [-288.354] (-290.230) (-288.685) (-287.876) * (-300.387) (-299.257) (-299.097) [-301.828] -- 0:00:54
18500 -- [-288.152] (-287.396) (-288.924) (-292.316) * (-294.176) [-298.920] (-310.064) (-298.438) -- 0:00:53
19000 -- (-291.116) (-289.843) (-290.639) [-288.397] * (-294.327) (-296.880) (-300.588) [-300.643] -- 0:00:51
19500 -- (-290.928) [-289.213] (-290.977) (-292.931) * (-301.788) (-303.650) (-297.539) [-299.398] -- 0:00:50
20000 -- (-288.559) (-289.934) [-288.539] (-291.579) * (-295.495) [-302.497] (-306.823) (-300.446) -- 0:00:49
Average standard deviation of split frequencies: 0.044278
20500 -- (-289.969) (-288.156) [-289.438] (-288.606) * [-299.760] (-297.937) (-308.079) (-299.246) -- 0:00:47
21000 -- (-288.164) (-289.120) [-289.388] (-289.301) * (-298.685) (-299.447) [-296.967] (-300.342) -- 0:00:46
21500 -- (-292.415) (-291.572) (-288.724) [-287.961] * [-303.575] (-302.577) (-304.371) (-299.205) -- 0:00:45
22000 -- (-290.000) [-288.632] (-291.131) (-290.270) * [-298.727] (-300.519) (-301.167) (-305.405) -- 0:00:44
22500 -- (-297.339) [-289.175] (-288.245) (-289.093) * [-299.562] (-298.824) (-295.679) (-305.044) -- 0:00:43
23000 -- (-289.513) (-287.077) [-287.296] (-289.606) * (-296.935) (-298.468) (-292.315) [-299.826] -- 0:01:24
23500 -- (-288.767) (-288.032) [-288.331] (-289.024) * (-302.897) [-298.355] (-289.709) (-294.274) -- 0:01:23
24000 -- (-289.375) (-290.654) (-288.520) [-289.940] * (-304.910) [-294.109] (-288.309) (-301.368) -- 0:01:21
24500 -- (-289.145) (-288.174) (-288.355) [-287.882] * (-291.508) (-306.088) [-288.527] (-298.195) -- 0:01:19
25000 -- (-288.500) [-292.005] (-298.531) (-288.497) * [-300.829] (-302.052) (-287.547) (-304.101) -- 0:01:18
Average standard deviation of split frequencies: 0.030493
25500 -- (-288.690) [-296.309] (-291.516) (-290.647) * (-301.535) (-296.251) [-291.262] (-298.599) -- 0:01:16
26000 -- (-290.710) (-289.948) (-290.604) [-289.865] * (-299.207) [-298.290] (-295.459) (-295.587) -- 0:01:14
26500 -- (-290.580) (-289.442) (-290.523) [-290.735] * (-297.026) (-293.532) [-292.714] (-299.428) -- 0:01:13
27000 -- [-293.444] (-287.959) (-293.909) (-293.594) * (-299.044) [-297.309] (-291.526) (-306.418) -- 0:01:12
27500 -- (-287.496) [-288.142] (-288.217) (-293.057) * (-305.123) (-305.556) [-291.248] (-301.684) -- 0:01:10
28000 -- (-293.023) (-288.006) (-290.274) [-290.004] * [-301.477] (-303.120) (-289.551) (-299.344) -- 0:01:09
28500 -- (-290.193) [-288.492] (-290.562) (-288.976) * (-298.989) [-300.524] (-294.650) (-309.876) -- 0:01:08
29000 -- (-289.142) (-290.829) [-288.751] (-290.944) * [-296.994] (-295.614) (-290.139) (-303.068) -- 0:01:06
29500 -- (-288.418) [-291.470] (-289.726) (-290.077) * (-297.273) (-293.935) (-291.242) [-299.380] -- 0:01:05
30000 -- (-290.850) (-294.438) (-291.440) [-290.706] * (-296.953) (-307.324) (-290.538) [-295.072] -- 0:01:04
Average standard deviation of split frequencies: 0.033980
30500 -- [-288.098] (-294.280) (-289.272) (-287.902) * (-295.855) (-301.901) (-288.471) [-300.135] -- 0:01:03
31000 -- (-293.436) (-290.518) [-288.436] (-289.263) * (-302.711) (-300.464) [-287.594] (-297.321) -- 0:01:02
31500 -- (-289.438) (-288.475) (-288.963) [-287.587] * (-303.068) (-295.626) (-287.915) [-295.808] -- 0:01:01
32000 -- [-289.167] (-292.945) (-290.100) (-289.359) * (-296.467) (-297.893) [-288.174] (-296.899) -- 0:01:00
32500 -- [-289.611] (-290.805) (-288.509) (-290.560) * (-296.197) (-306.417) (-288.468) [-295.625] -- 0:00:59
33000 -- (-290.209) [-288.987] (-287.832) (-289.087) * (-297.461) (-302.326) [-290.182] (-308.495) -- 0:00:58
33500 -- [-287.274] (-289.010) (-287.981) (-291.314) * (-302.352) [-296.570] (-287.624) (-297.979) -- 0:00:57
34000 -- (-290.603) (-288.952) [-289.629] (-288.449) * (-305.067) [-295.495] (-293.763) (-314.366) -- 0:00:56
34500 -- (-292.055) (-293.896) [-289.694] (-287.832) * (-296.939) [-296.062] (-290.356) (-309.299) -- 0:00:55
35000 -- (-290.715) (-287.975) (-288.557) [-287.762] * (-308.802) (-296.484) [-289.733] (-299.023) -- 0:00:55
Average standard deviation of split frequencies: 0.033770
35500 -- (-290.797) (-290.904) [-288.410] (-288.735) * [-301.567] (-296.268) (-290.236) (-293.415) -- 0:00:54
36000 -- (-290.864) (-291.281) [-289.628] (-289.524) * [-294.848] (-304.497) (-288.595) (-287.955) -- 0:00:53
36500 -- [-289.044] (-288.435) (-289.481) (-292.041) * (-301.691) (-306.130) [-288.892] (-290.055) -- 0:00:52
37000 -- [-288.948] (-287.493) (-291.991) (-289.098) * [-296.361] (-299.990) (-291.509) (-287.693) -- 0:00:52
37500 -- (-293.653) (-290.941) (-290.042) [-288.399] * (-299.953) (-302.485) (-291.052) [-288.207] -- 0:00:51
38000 -- (-287.620) [-290.117] (-292.285) (-290.084) * [-302.450] (-311.887) (-289.644) (-290.312) -- 0:00:50
38500 -- [-288.930] (-288.561) (-289.450) (-290.137) * (-303.534) (-300.588) (-288.851) [-288.670] -- 0:00:49
39000 -- [-290.311] (-290.421) (-288.034) (-290.960) * (-297.330) (-297.709) (-288.452) [-288.057] -- 0:00:49
39500 -- [-293.204] (-290.498) (-290.953) (-290.225) * [-293.632] (-296.756) (-290.668) (-288.777) -- 0:01:12
40000 -- [-290.836] (-289.734) (-290.570) (-289.452) * [-294.819] (-310.496) (-289.259) (-288.227) -- 0:01:12
Average standard deviation of split frequencies: 0.034166
40500 -- (-289.679) (-289.911) (-292.947) [-288.947] * [-294.973] (-312.951) (-289.525) (-291.582) -- 0:01:11
41000 -- [-289.949] (-289.040) (-290.788) (-289.073) * (-307.278) (-299.018) (-288.729) [-288.408] -- 0:01:10
41500 -- [-290.070] (-289.584) (-291.342) (-288.973) * (-303.175) (-287.954) [-290.108] (-292.720) -- 0:01:09
42000 -- (-287.818) [-287.511] (-289.523) (-288.488) * [-297.433] (-289.211) (-287.921) (-290.226) -- 0:01:08
42500 -- [-287.941] (-288.414) (-287.196) (-288.077) * (-297.394) (-288.260) [-290.865] (-293.087) -- 0:01:07
43000 -- [-293.224] (-288.902) (-287.844) (-288.680) * (-300.235) (-290.216) (-293.050) [-294.198] -- 0:01:06
43500 -- (-288.847) (-289.372) (-289.576) [-289.827] * (-300.263) [-291.047] (-292.329) (-288.817) -- 0:01:05
44000 -- [-290.451] (-287.928) (-294.913) (-289.495) * [-295.101] (-293.041) (-292.814) (-289.882) -- 0:01:05
44500 -- (-289.496) (-288.556) (-289.526) [-287.899] * (-295.925) (-288.234) (-293.759) [-288.608] -- 0:01:04
45000 -- [-289.556] (-291.498) (-289.405) (-288.828) * (-298.513) [-291.109] (-292.051) (-288.326) -- 0:01:03
Average standard deviation of split frequencies: 0.038834
45500 -- (-287.327) (-288.589) (-289.426) [-291.454] * (-297.455) [-287.805] (-289.123) (-290.513) -- 0:01:02
46000 -- (-292.437) [-289.579] (-292.428) (-289.096) * [-299.893] (-292.797) (-292.001) (-288.686) -- 0:01:02
46500 -- [-290.000] (-288.646) (-292.713) (-291.702) * (-297.470) [-287.670] (-288.027) (-289.490) -- 0:01:01
47000 -- (-290.082) (-292.001) (-288.925) [-289.104] * (-299.179) [-288.940] (-288.683) (-287.607) -- 0:01:00
47500 -- (-289.298) (-291.360) (-289.961) [-291.050] * (-300.517) [-287.717] (-287.582) (-289.000) -- 0:01:00
48000 -- (-289.349) [-291.470] (-292.376) (-288.586) * (-298.037) (-290.992) (-289.909) [-287.654] -- 0:00:59
48500 -- (-289.248) (-291.993) [-289.318] (-287.872) * (-291.665) (-292.325) [-287.759] (-289.306) -- 0:00:58
49000 -- (-290.478) (-290.532) (-288.488) [-289.604] * (-300.362) [-290.445] (-293.632) (-292.135) -- 0:00:58
49500 -- (-289.207) [-290.095] (-287.307) (-289.328) * [-305.710] (-288.825) (-287.792) (-288.931) -- 0:00:57
50000 -- (-288.995) [-291.865] (-291.101) (-288.954) * (-292.620) (-293.157) [-288.900] (-292.868) -- 0:00:57
Average standard deviation of split frequencies: 0.039175
50500 -- (-288.110) [-288.979] (-288.349) (-291.067) * (-295.928) (-289.299) [-289.673] (-289.356) -- 0:00:56
51000 -- (-290.799) [-287.870] (-288.425) (-295.072) * (-301.971) [-290.592] (-288.435) (-288.700) -- 0:00:55
51500 -- [-290.876] (-292.538) (-289.112) (-293.822) * (-297.105) [-289.153] (-290.189) (-287.280) -- 0:00:55
52000 -- (-287.725) [-288.400] (-288.895) (-291.722) * [-299.478] (-289.856) (-288.320) (-289.618) -- 0:00:54
52500 -- (-287.774) [-291.910] (-288.670) (-287.963) * (-320.430) (-289.048) (-292.458) [-291.486] -- 0:00:54
53000 -- (-293.061) [-290.022] (-288.252) (-287.980) * (-311.844) [-290.971] (-288.574) (-294.071) -- 0:00:53
53500 -- (-291.654) [-290.465] (-289.508) (-289.576) * (-298.848) [-289.823] (-288.409) (-290.880) -- 0:00:53
54000 -- [-288.616] (-291.206) (-291.636) (-289.873) * [-288.851] (-291.525) (-288.186) (-288.440) -- 0:00:52
54500 -- (-292.761) (-291.458) [-288.088] (-291.065) * (-298.486) (-289.189) (-289.094) [-289.600] -- 0:00:52
55000 -- (-290.758) (-289.843) [-290.513] (-288.268) * (-300.923) [-289.854] (-288.672) (-288.934) -- 0:00:51
Average standard deviation of split frequencies: 0.038102
55500 -- (-291.841) (-290.305) [-291.674] (-290.389) * (-301.022) [-291.601] (-289.877) (-293.927) -- 0:00:51
56000 -- [-289.935] (-289.338) (-290.461) (-290.031) * (-291.628) [-288.962] (-288.939) (-289.908) -- 0:00:50
56500 -- (-288.891) (-291.513) (-288.150) [-288.922] * [-288.142] (-289.057) (-290.965) (-291.504) -- 0:01:06
57000 -- (-289.243) (-290.630) (-292.693) [-287.900] * (-288.135) [-288.061] (-290.395) (-290.240) -- 0:01:06
57500 -- (-289.441) (-289.760) (-292.651) [-290.100] * [-289.043] (-287.742) (-293.565) (-287.718) -- 0:01:05
58000 -- (-288.697) [-290.330] (-289.569) (-288.252) * (-290.567) [-289.178] (-291.345) (-287.318) -- 0:01:04
58500 -- (-287.257) (-288.165) (-296.248) [-288.851] * [-289.084] (-291.069) (-291.086) (-288.768) -- 0:01:04
59000 -- (-287.869) (-288.334) [-287.871] (-288.562) * (-288.278) (-288.300) (-290.004) [-287.605] -- 0:01:03
59500 -- [-290.397] (-288.591) (-292.801) (-292.586) * (-289.206) (-290.993) (-287.501) [-287.994] -- 0:01:03
60000 -- [-288.555] (-289.700) (-287.445) (-290.250) * [-288.496] (-287.983) (-290.456) (-290.863) -- 0:01:02
Average standard deviation of split frequencies: 0.042533
60500 -- (-287.416) (-288.944) [-289.737] (-290.436) * (-289.778) (-287.836) [-289.497] (-295.207) -- 0:01:02
61000 -- (-287.975) (-289.887) (-289.333) [-293.598] * (-288.336) (-288.419) (-287.655) [-288.944] -- 0:01:01
61500 -- [-290.850] (-289.285) (-291.310) (-295.367) * (-287.578) (-290.445) [-290.168] (-290.111) -- 0:01:01
62000 -- [-291.096] (-290.930) (-288.183) (-294.000) * [-289.202] (-289.297) (-287.817) (-288.406) -- 0:01:00
62500 -- [-288.403] (-292.437) (-288.891) (-287.673) * (-287.886) (-290.073) [-291.200] (-290.177) -- 0:01:00
63000 -- (-288.425) (-291.049) [-289.537] (-289.338) * (-292.269) (-289.847) [-289.197] (-292.236) -- 0:00:59
63500 -- [-288.273] (-290.442) (-293.151) (-287.662) * (-290.844) (-288.347) (-290.814) [-287.734] -- 0:00:58
64000 -- (-289.671) (-292.919) [-289.369] (-288.666) * (-292.351) [-289.076] (-290.715) (-288.069) -- 0:00:58
64500 -- (-289.424) [-291.373] (-294.814) (-289.309) * [-288.179] (-289.574) (-291.088) (-289.635) -- 0:00:58
65000 -- (-292.197) [-289.007] (-292.077) (-294.598) * (-289.842) [-289.986] (-289.169) (-290.978) -- 0:00:57
Average standard deviation of split frequencies: 0.037753
65500 -- (-290.148) (-292.103) (-290.380) [-288.323] * [-288.008] (-293.442) (-289.011) (-291.206) -- 0:00:57
66000 -- [-288.586] (-291.238) (-291.787) (-289.718) * [-287.303] (-292.272) (-289.841) (-288.963) -- 0:00:56
66500 -- (-289.510) [-290.596] (-292.573) (-292.826) * (-288.763) [-287.872] (-289.106) (-289.089) -- 0:00:56
67000 -- (-292.499) [-289.428] (-288.305) (-292.553) * (-288.432) [-287.795] (-288.059) (-289.720) -- 0:00:55
67500 -- (-292.303) (-289.979) (-289.435) [-289.162] * (-288.328) (-287.917) [-287.954] (-289.546) -- 0:00:55
68000 -- (-289.341) [-288.725] (-290.128) (-290.777) * (-288.999) [-287.321] (-290.391) (-290.129) -- 0:00:54
68500 -- (-287.866) (-290.564) [-288.445] (-289.339) * [-288.340] (-292.788) (-287.664) (-289.212) -- 0:00:54
69000 -- (-289.183) (-289.527) (-290.330) [-288.668] * [-289.608] (-294.780) (-291.086) (-289.162) -- 0:00:53
69500 -- [-288.700] (-287.767) (-291.207) (-287.970) * [-289.228] (-287.876) (-289.916) (-290.343) -- 0:00:53
70000 -- (-290.267) (-288.643) (-295.766) [-289.021] * (-290.646) [-292.133] (-288.882) (-288.994) -- 0:00:53
Average standard deviation of split frequencies: 0.038024
70500 -- (-290.950) (-288.449) (-289.935) [-289.007] * (-294.225) (-290.044) (-289.608) [-287.387] -- 0:00:52
71000 -- (-294.412) [-289.200] (-291.869) (-290.079) * (-288.741) [-289.039] (-289.002) (-287.522) -- 0:00:52
71500 -- (-292.008) (-287.776) (-290.902) [-290.177] * (-289.774) [-292.505] (-290.906) (-288.270) -- 0:00:51
72000 -- (-288.872) [-289.183] (-287.919) (-288.072) * (-290.352) (-290.345) [-289.794] (-289.623) -- 0:00:51
72500 -- (-288.915) (-289.123) [-287.624] (-291.376) * [-290.013] (-287.389) (-288.873) (-290.095) -- 0:00:51
73000 -- (-289.348) (-291.226) (-287.428) [-291.311] * (-290.514) (-291.414) [-289.406] (-295.263) -- 0:00:50
73500 -- (-289.552) (-289.128) (-287.443) [-289.092] * (-287.863) (-287.523) (-290.706) [-289.897] -- 0:00:50
74000 -- (-289.718) (-289.528) [-288.876] (-289.291) * (-290.221) [-290.920] (-290.687) (-291.255) -- 0:01:02
74500 -- [-288.223] (-290.927) (-288.195) (-289.010) * (-288.867) (-288.850) [-287.233] (-294.213) -- 0:01:02
75000 -- (-290.570) [-292.360] (-287.137) (-291.828) * [-290.716] (-292.128) (-288.291) (-288.165) -- 0:01:01
Average standard deviation of split frequencies: 0.038196
75500 -- [-289.239] (-288.596) (-287.308) (-288.531) * (-288.156) (-293.105) (-288.638) [-291.217] -- 0:01:01
76000 -- (-288.952) (-289.143) [-287.142] (-290.887) * (-287.246) [-291.773] (-287.729) (-290.986) -- 0:01:00
76500 -- (-289.545) (-288.839) [-290.341] (-288.517) * (-289.398) (-290.273) (-289.941) [-290.274] -- 0:01:00
77000 -- [-290.024] (-289.889) (-288.388) (-291.103) * (-289.913) [-288.181] (-287.969) (-293.149) -- 0:00:59
77500 -- [-290.012] (-288.795) (-289.882) (-295.141) * (-292.292) [-288.366] (-290.263) (-290.637) -- 0:00:59
78000 -- [-288.728] (-290.065) (-294.608) (-293.112) * (-289.921) [-290.965] (-288.832) (-292.029) -- 0:00:59
78500 -- (-291.245) [-289.917] (-288.984) (-293.316) * (-288.790) (-295.589) [-290.412] (-290.285) -- 0:00:58
79000 -- (-288.670) (-288.872) [-290.886] (-290.068) * (-293.734) (-296.584) (-288.575) [-289.797] -- 0:00:58
79500 -- [-288.972] (-291.008) (-294.328) (-288.233) * (-292.607) [-290.382] (-288.280) (-288.195) -- 0:00:57
80000 -- (-292.458) (-294.124) (-289.450) [-288.994] * (-290.179) [-294.075] (-290.656) (-290.779) -- 0:00:57
Average standard deviation of split frequencies: 0.038844
80500 -- (-290.825) (-287.718) [-287.203] (-290.970) * (-292.113) (-293.150) (-289.820) [-290.058] -- 0:00:57
81000 -- (-289.442) [-288.414] (-287.643) (-287.909) * [-289.975] (-290.948) (-289.841) (-290.658) -- 0:00:56
81500 -- (-288.883) (-288.654) [-290.163] (-290.671) * (-289.498) (-296.254) (-289.969) [-288.447] -- 0:00:56
82000 -- (-287.904) (-288.961) [-292.259] (-292.793) * (-290.989) (-293.644) (-291.981) [-294.077] -- 0:00:55
82500 -- [-290.428] (-288.204) (-292.945) (-290.919) * (-290.700) (-292.259) [-288.712] (-288.416) -- 0:00:55
83000 -- (-290.267) (-288.448) (-291.058) [-288.407] * (-288.446) (-291.688) (-287.775) [-293.485] -- 0:00:55
83500 -- (-289.081) (-287.359) [-289.391] (-289.218) * (-289.091) (-292.491) [-289.219] (-292.669) -- 0:00:54
84000 -- [-288.368] (-290.575) (-288.879) (-289.270) * (-288.652) [-288.084] (-288.822) (-295.862) -- 0:00:54
84500 -- (-289.234) [-290.116] (-288.324) (-290.856) * (-288.810) (-287.812) [-290.268] (-294.671) -- 0:00:54
85000 -- (-288.759) (-289.478) [-288.623] (-289.924) * (-289.521) [-289.178] (-292.642) (-288.268) -- 0:00:53
Average standard deviation of split frequencies: 0.033985
85500 -- (-290.929) (-289.408) (-293.698) [-288.363] * (-292.039) (-288.518) (-291.200) [-287.431] -- 0:00:53
86000 -- (-289.778) [-287.787] (-289.771) (-287.737) * (-293.071) (-288.716) (-290.954) [-288.157] -- 0:00:53
86500 -- (-288.707) (-288.756) [-292.014] (-287.561) * [-290.449] (-288.689) (-288.654) (-289.914) -- 0:00:52
87000 -- (-287.404) (-290.632) [-287.884] (-288.369) * (-290.010) [-291.064] (-292.811) (-293.452) -- 0:00:52
87500 -- (-294.488) (-289.448) [-288.271] (-289.606) * (-287.742) [-290.607] (-297.536) (-290.920) -- 0:00:52
88000 -- (-292.637) (-289.437) (-288.974) [-289.193] * [-288.493] (-289.529) (-289.391) (-291.673) -- 0:00:51
88500 -- (-290.024) (-292.016) [-290.886] (-288.895) * (-287.779) (-288.173) (-291.115) [-291.490] -- 0:00:51
89000 -- (-289.449) (-290.716) (-290.575) [-289.197] * (-290.543) [-288.248] (-290.809) (-291.927) -- 0:00:51
89500 -- (-290.007) [-288.311] (-291.862) (-291.377) * (-290.778) (-293.976) [-290.161] (-291.272) -- 0:00:50
90000 -- (-290.176) (-289.854) [-289.184] (-288.499) * [-288.248] (-292.049) (-287.935) (-288.986) -- 0:00:50
Average standard deviation of split frequencies: 0.033659
90500 -- (-289.808) (-292.633) [-293.182] (-287.931) * [-287.812] (-290.435) (-288.681) (-288.363) -- 0:00:50
91000 -- (-289.456) (-290.619) (-290.724) [-292.301] * [-287.762] (-291.872) (-292.026) (-288.829) -- 0:00:59
91500 -- [-288.119] (-289.708) (-290.165) (-291.636) * [-288.671] (-291.147) (-292.336) (-292.417) -- 0:00:59
92000 -- (-287.838) [-287.626] (-292.242) (-293.753) * (-290.512) (-288.927) (-288.924) [-287.328] -- 0:00:59
92500 -- (-288.498) [-291.358] (-289.746) (-289.674) * (-289.516) [-290.839] (-289.137) (-287.825) -- 0:00:58
93000 -- (-287.646) (-290.310) (-289.905) [-289.445] * (-291.373) (-293.025) (-289.612) [-288.822] -- 0:00:58
93500 -- [-288.582] (-290.059) (-288.517) (-291.606) * (-290.068) (-290.169) [-292.439] (-288.252) -- 0:00:58
94000 -- [-288.186] (-289.803) (-288.661) (-290.987) * [-288.948] (-292.025) (-292.527) (-292.984) -- 0:00:57
94500 -- (-289.622) (-289.787) (-292.627) [-289.046] * (-288.176) [-291.874] (-292.047) (-287.637) -- 0:00:57
95000 -- (-287.973) [-290.911] (-288.416) (-290.880) * [-289.724] (-290.595) (-287.170) (-289.199) -- 0:00:57
Average standard deviation of split frequencies: 0.028946
95500 -- (-291.671) [-289.409] (-288.883) (-291.119) * (-290.750) [-292.023] (-289.765) (-289.061) -- 0:00:56
96000 -- (-288.344) [-289.674] (-292.198) (-293.783) * [-287.515] (-288.748) (-291.836) (-289.056) -- 0:00:56
96500 -- (-289.991) (-287.652) (-288.291) [-289.285] * (-288.314) (-295.933) [-290.864] (-287.511) -- 0:00:56
97000 -- [-292.284] (-290.457) (-289.115) (-289.936) * (-290.987) [-289.136] (-291.501) (-290.291) -- 0:00:55
97500 -- (-288.247) [-295.907] (-296.751) (-289.145) * [-288.670] (-291.911) (-289.660) (-288.588) -- 0:00:55
98000 -- [-290.439] (-288.914) (-293.997) (-287.633) * (-291.998) [-290.131] (-288.080) (-288.590) -- 0:00:55
98500 -- (-291.363) (-289.950) [-292.109] (-290.287) * [-288.175] (-287.330) (-288.804) (-290.160) -- 0:00:54
99000 -- (-288.940) (-290.214) (-289.066) [-289.103] * (-288.708) (-289.988) [-289.985] (-288.485) -- 0:00:54
99500 -- [-287.388] (-289.935) (-290.370) (-290.792) * [-288.281] (-290.858) (-294.050) (-289.196) -- 0:00:54
100000 -- [-289.620] (-287.473) (-289.121) (-288.439) * (-290.281) [-291.442] (-291.097) (-288.035) -- 0:00:54
Average standard deviation of split frequencies: 0.028923
100500 -- (-289.625) (-289.015) [-288.016] (-287.832) * [-289.911] (-290.650) (-290.357) (-293.541) -- 0:00:53
101000 -- (-291.455) (-289.090) (-291.162) [-288.630] * (-289.265) (-289.285) (-290.304) [-287.882] -- 0:00:53
101500 -- [-289.680] (-287.744) (-289.525) (-288.972) * (-291.849) (-288.952) [-290.051] (-287.200) -- 0:00:53
102000 -- [-289.153] (-291.754) (-288.830) (-288.374) * (-288.786) [-290.721] (-289.665) (-288.663) -- 0:00:52
102500 -- [-287.673] (-295.851) (-288.482) (-287.942) * (-287.859) (-289.863) (-288.047) [-288.683] -- 0:00:52
103000 -- (-288.181) [-292.969] (-288.336) (-290.253) * (-288.384) [-296.496] (-287.858) (-290.958) -- 0:00:52
103500 -- (-289.312) [-289.681] (-290.939) (-288.659) * (-293.121) (-294.711) (-288.989) [-289.919] -- 0:00:51
104000 -- (-288.278) (-291.923) (-290.386) [-288.385] * [-289.245] (-292.151) (-292.312) (-287.653) -- 0:00:51
104500 -- (-291.991) [-289.350] (-292.040) (-290.292) * (-291.709) [-287.082] (-291.971) (-293.446) -- 0:00:51
105000 -- (-290.882) (-290.445) (-296.127) [-288.756] * (-291.456) [-288.846] (-290.931) (-294.295) -- 0:00:51
Average standard deviation of split frequencies: 0.024577
105500 -- (-290.717) [-291.125] (-287.815) (-292.168) * (-289.540) (-289.044) [-289.325] (-290.607) -- 0:00:50
106000 -- (-287.758) (-288.027) (-288.565) [-287.525] * (-287.593) [-291.006] (-287.393) (-289.673) -- 0:00:50
106500 -- (-289.350) (-288.097) (-288.567) [-290.993] * (-289.709) (-294.217) (-288.148) [-287.830] -- 0:00:50
107000 -- [-287.944] (-287.865) (-289.859) (-290.649) * (-291.439) [-290.686] (-287.931) (-288.103) -- 0:00:50
107500 -- (-288.402) (-292.061) [-290.785] (-288.246) * (-288.718) (-290.686) [-289.070] (-294.867) -- 0:00:49
108000 -- (-288.047) (-295.383) [-287.915] (-288.994) * (-290.145) (-289.705) [-288.843] (-294.109) -- 0:00:57
108500 -- [-287.911] (-293.391) (-287.732) (-291.482) * (-292.104) [-289.915] (-291.250) (-289.006) -- 0:00:57
109000 -- (-290.143) (-295.455) (-290.551) [-288.768] * [-289.880] (-289.589) (-291.292) (-291.426) -- 0:00:57
109500 -- (-289.171) [-290.430] (-288.782) (-289.443) * (-289.012) (-293.883) (-288.502) [-288.980] -- 0:00:56
110000 -- (-287.639) (-289.203) [-289.907] (-288.368) * (-290.603) (-296.586) [-291.088] (-290.696) -- 0:00:56
Average standard deviation of split frequencies: 0.024437
110500 -- [-287.948] (-288.139) (-288.832) (-288.892) * (-287.378) (-288.708) (-291.484) [-291.202] -- 0:00:56
111000 -- (-288.540) (-290.682) [-288.980] (-290.914) * (-288.150) (-288.183) (-289.969) [-288.314] -- 0:00:56
111500 -- [-289.687] (-290.981) (-288.843) (-288.499) * (-289.884) [-288.000] (-293.057) (-290.897) -- 0:00:55
112000 -- (-293.724) (-289.362) (-287.162) [-288.437] * [-289.082] (-293.354) (-294.756) (-291.693) -- 0:00:55
112500 -- (-288.810) (-289.439) [-288.408] (-288.584) * (-288.518) [-289.698] (-293.213) (-290.426) -- 0:00:55
113000 -- (-289.714) (-290.764) [-287.934] (-291.010) * [-288.375] (-288.796) (-291.403) (-291.507) -- 0:00:54
113500 -- (-287.965) (-289.840) (-292.075) [-290.585] * (-292.599) (-289.947) [-291.051] (-288.184) -- 0:00:54
114000 -- [-289.318] (-288.956) (-289.626) (-290.153) * (-290.558) (-288.749) [-288.801] (-289.563) -- 0:00:54
114500 -- [-289.575] (-288.692) (-290.239) (-288.546) * (-290.471) (-292.239) (-291.527) [-290.064] -- 0:00:54
115000 -- (-289.909) (-287.662) (-288.890) [-287.192] * [-288.464] (-292.110) (-288.560) (-289.381) -- 0:00:53
Average standard deviation of split frequencies: 0.024383
115500 -- (-290.673) (-288.303) [-292.336] (-289.998) * (-288.457) (-296.952) (-288.121) [-290.108] -- 0:00:53
116000 -- (-290.479) (-288.932) (-289.777) [-289.777] * (-289.115) [-288.160] (-296.179) (-293.551) -- 0:00:53
116500 -- (-289.960) (-293.548) [-287.821] (-288.265) * (-290.127) (-287.653) [-291.838] (-290.180) -- 0:00:53
117000 -- (-289.353) [-289.651] (-289.866) (-291.754) * (-288.308) [-288.292] (-290.010) (-289.770) -- 0:00:52
117500 -- (-293.410) (-288.650) [-288.060] (-290.961) * (-288.397) (-290.168) [-287.539] (-290.948) -- 0:00:52
118000 -- [-292.218] (-290.610) (-287.825) (-291.441) * (-289.797) [-287.743] (-289.014) (-288.390) -- 0:00:52
118500 -- (-290.404) (-289.242) (-288.339) [-290.142] * (-288.933) (-289.723) (-287.633) [-289.309] -- 0:00:52
119000 -- [-292.057] (-292.409) (-289.295) (-290.096) * (-289.327) (-295.131) (-288.263) [-290.263] -- 0:00:51
119500 -- (-287.970) [-289.970] (-288.762) (-293.016) * (-293.026) [-290.700] (-290.449) (-291.339) -- 0:00:51
120000 -- (-292.013) [-289.700] (-289.389) (-290.156) * (-289.780) (-289.869) (-289.201) [-290.060] -- 0:00:51
Average standard deviation of split frequencies: 0.024674
120500 -- (-290.931) [-290.060] (-292.030) (-288.180) * (-292.626) (-291.453) [-288.611] (-288.992) -- 0:00:51
121000 -- (-290.807) [-291.298] (-295.558) (-292.214) * (-289.810) [-290.866] (-291.052) (-287.860) -- 0:00:50
121500 -- (-289.922) (-293.214) (-293.950) [-289.134] * (-294.179) [-289.622] (-288.410) (-292.507) -- 0:00:50
122000 -- (-289.002) (-291.221) [-288.857] (-294.435) * (-290.227) (-288.247) [-289.586] (-294.372) -- 0:00:50
122500 -- (-289.634) [-289.749] (-288.231) (-290.277) * (-288.227) (-297.524) (-293.911) [-291.781] -- 0:00:50
123000 -- (-293.306) (-288.831) (-289.872) [-289.061] * [-287.851] (-297.607) (-288.594) (-295.880) -- 0:00:49
123500 -- (-288.853) (-292.277) (-290.156) [-290.772] * [-288.611] (-289.997) (-291.115) (-291.184) -- 0:00:49
124000 -- [-290.205] (-289.449) (-293.228) (-290.235) * [-289.601] (-288.928) (-291.230) (-288.747) -- 0:00:49
124500 -- [-289.832] (-293.054) (-288.658) (-289.055) * (-290.647) (-288.946) [-289.100] (-288.658) -- 0:00:49
125000 -- [-290.169] (-290.315) (-288.758) (-287.933) * (-292.665) (-288.320) (-289.498) [-288.323] -- 0:00:49
Average standard deviation of split frequencies: 0.023570
125500 -- (-288.885) (-288.606) [-287.876] (-287.304) * (-292.659) (-290.579) [-289.737] (-287.805) -- 0:00:55
126000 -- (-289.401) [-289.580] (-290.561) (-289.753) * (-287.779) [-290.922] (-289.179) (-289.095) -- 0:00:55
126500 -- (-289.252) (-289.865) [-289.796] (-287.445) * (-288.851) (-290.524) (-289.025) [-287.934] -- 0:00:55
127000 -- (-291.430) (-289.538) (-290.637) [-289.361] * (-289.338) (-288.461) [-289.326] (-294.239) -- 0:00:54
127500 -- (-292.543) [-292.403] (-296.194) (-289.256) * [-291.184] (-288.292) (-290.847) (-292.826) -- 0:00:54
128000 -- (-290.390) [-288.086] (-289.518) (-288.554) * (-293.047) (-289.042) (-293.489) [-290.051] -- 0:00:54
128500 -- (-291.591) (-292.252) [-290.656] (-288.316) * (-290.320) (-289.421) [-289.392] (-288.234) -- 0:00:54
129000 -- (-290.476) (-288.219) [-288.482] (-287.907) * (-291.375) (-288.650) [-290.617] (-288.695) -- 0:00:54
129500 -- (-290.897) (-288.079) (-290.792) [-287.586] * [-292.676] (-288.641) (-288.751) (-295.429) -- 0:00:53
130000 -- [-291.548] (-288.222) (-290.522) (-288.881) * (-298.694) (-288.335) (-290.701) [-288.917] -- 0:00:53
Average standard deviation of split frequencies: 0.022026
130500 -- (-287.803) (-290.738) (-290.299) [-289.352] * (-292.092) (-290.008) [-287.808] (-291.157) -- 0:00:53
131000 -- (-289.870) [-292.413] (-288.366) (-288.816) * (-292.588) (-293.560) (-289.514) [-288.347] -- 0:00:53
131500 -- (-291.030) (-289.480) (-291.315) [-291.328] * (-290.190) [-288.128] (-291.526) (-291.772) -- 0:00:52
132000 -- [-289.285] (-289.209) (-290.038) (-288.740) * (-288.676) (-288.520) [-288.511] (-287.852) -- 0:00:52
132500 -- (-290.041) (-289.240) [-290.849] (-289.579) * (-292.789) (-289.074) [-290.105] (-289.378) -- 0:00:52
133000 -- (-293.188) [-288.285] (-288.109) (-290.192) * (-289.943) (-289.054) (-291.378) [-290.048] -- 0:00:52
133500 -- (-288.595) (-289.851) (-290.708) [-288.152] * (-290.490) (-292.296) (-290.037) [-290.862] -- 0:00:51
134000 -- (-289.706) (-289.175) (-288.175) [-289.450] * (-290.627) [-291.767] (-288.262) (-292.134) -- 0:00:51
134500 -- (-287.762) [-290.176] (-293.042) (-289.728) * (-291.532) (-289.899) (-288.595) [-288.046] -- 0:00:51
135000 -- (-290.244) (-288.110) (-290.662) [-287.612] * (-295.079) [-288.131] (-289.310) (-290.133) -- 0:00:51
Average standard deviation of split frequencies: 0.020797
135500 -- (-288.323) (-292.378) (-290.737) [-290.420] * [-290.155] (-289.492) (-297.470) (-288.270) -- 0:00:51
136000 -- (-288.591) [-291.517] (-289.333) (-287.886) * [-288.308] (-289.244) (-288.070) (-288.171) -- 0:00:50
136500 -- (-288.586) (-294.067) [-289.683] (-290.419) * (-290.932) [-290.201] (-288.422) (-289.126) -- 0:00:50
137000 -- (-288.678) (-289.824) [-289.108] (-290.481) * [-287.803] (-287.751) (-288.628) (-292.176) -- 0:00:50
137500 -- (-289.669) (-293.616) [-287.442] (-291.813) * (-288.325) (-287.847) [-288.487] (-290.596) -- 0:00:50
138000 -- [-290.207] (-289.386) (-287.316) (-288.980) * (-291.479) [-288.541] (-287.416) (-289.831) -- 0:00:49
138500 -- (-289.393) (-288.811) [-288.348] (-292.395) * (-291.297) (-292.825) (-287.252) [-288.161] -- 0:00:49
139000 -- [-288.075] (-290.449) (-293.312) (-292.093) * (-292.164) (-291.836) (-288.165) [-288.540] -- 0:00:49
139500 -- [-289.617] (-289.731) (-288.334) (-290.037) * [-288.384] (-288.597) (-288.528) (-292.146) -- 0:00:49
140000 -- [-288.382] (-291.048) (-288.146) (-290.393) * (-293.663) (-291.481) [-288.168] (-288.274) -- 0:00:49
Average standard deviation of split frequencies: 0.017687
140500 -- (-289.648) [-291.440] (-292.469) (-289.127) * (-288.791) (-290.814) [-288.357] (-292.114) -- 0:00:48
141000 -- (-288.579) (-289.875) [-287.220] (-290.208) * (-289.677) [-288.269] (-292.732) (-289.748) -- 0:00:48
141500 -- (-289.707) (-287.668) [-288.119] (-287.612) * (-289.392) [-289.638] (-291.737) (-289.356) -- 0:00:48
142000 -- (-288.724) (-288.577) [-288.228] (-288.399) * (-291.683) [-291.520] (-289.962) (-287.797) -- 0:00:48
142500 -- (-287.695) (-289.419) (-289.497) [-288.138] * (-296.845) (-290.950) [-289.790] (-289.270) -- 0:00:54
143000 -- (-291.334) [-287.917] (-287.455) (-291.503) * (-294.431) (-290.747) [-289.422] (-291.695) -- 0:00:53
143500 -- [-287.853] (-289.360) (-288.923) (-288.499) * (-290.549) [-288.033] (-291.500) (-289.267) -- 0:00:53
144000 -- (-288.826) [-289.564] (-290.341) (-288.682) * [-290.427] (-293.807) (-290.478) (-291.761) -- 0:00:53
144500 -- (-287.486) [-287.382] (-288.244) (-288.042) * [-288.932] (-288.579) (-287.836) (-288.245) -- 0:00:53
145000 -- [-287.726] (-291.139) (-288.957) (-289.631) * (-289.586) (-289.132) (-289.757) [-291.167] -- 0:00:53
Average standard deviation of split frequencies: 0.018523
145500 -- (-290.318) (-288.362) [-288.575] (-292.605) * (-288.297) [-289.370] (-291.460) (-291.252) -- 0:00:52
146000 -- (-289.500) [-289.220] (-291.725) (-288.150) * [-287.512] (-290.243) (-291.785) (-289.940) -- 0:00:52
146500 -- (-288.628) (-288.438) (-291.287) [-289.277] * [-291.223] (-287.471) (-288.076) (-292.104) -- 0:00:52
147000 -- (-287.553) (-289.392) [-287.879] (-288.823) * (-294.434) (-289.521) (-288.728) [-289.100] -- 0:00:52
147500 -- (-287.891) (-289.109) [-289.225] (-289.721) * (-291.203) [-294.041] (-288.738) (-295.399) -- 0:00:52
148000 -- (-287.887) (-290.016) (-289.581) [-288.778] * (-287.856) (-291.138) [-288.919] (-289.754) -- 0:00:51
148500 -- [-289.237] (-288.502) (-290.062) (-288.540) * [-289.031] (-287.591) (-290.941) (-288.880) -- 0:00:51
149000 -- (-288.668) (-287.987) [-288.158] (-288.814) * (-294.200) (-290.842) [-288.802] (-287.146) -- 0:00:51
149500 -- (-292.028) (-288.731) [-288.744] (-288.901) * (-290.043) (-290.189) [-290.120] (-287.949) -- 0:00:51
150000 -- (-289.126) [-288.580] (-289.487) (-290.695) * (-288.294) (-290.608) (-290.546) [-290.637] -- 0:00:51
Average standard deviation of split frequencies: 0.015973
150500 -- (-288.509) (-290.939) [-288.123] (-289.557) * (-290.737) (-290.709) [-287.816] (-289.811) -- 0:00:50
151000 -- (-288.542) (-287.676) [-290.353] (-289.063) * (-288.393) [-290.059] (-289.415) (-289.371) -- 0:00:50
151500 -- (-289.255) (-288.106) [-288.484] (-289.700) * (-290.598) (-288.422) (-287.954) [-291.119] -- 0:00:50
152000 -- [-290.120] (-291.328) (-289.615) (-289.604) * (-288.683) (-292.119) (-287.785) [-290.865] -- 0:00:50
152500 -- [-290.021] (-288.299) (-288.450) (-289.051) * (-290.214) (-290.311) (-291.946) [-290.006] -- 0:00:50
153000 -- [-288.179] (-287.352) (-291.054) (-294.684) * [-288.328] (-290.243) (-288.008) (-294.438) -- 0:00:49
153500 -- [-288.912] (-292.213) (-288.590) (-288.156) * (-290.037) (-289.995) (-289.001) [-289.685] -- 0:00:49
154000 -- (-289.947) (-288.051) [-289.036] (-288.226) * (-289.037) [-289.569] (-291.765) (-293.575) -- 0:00:49
154500 -- [-288.268] (-289.564) (-287.968) (-288.109) * (-289.701) (-287.962) [-292.452] (-292.996) -- 0:00:49
155000 -- (-289.365) (-290.442) (-289.366) [-293.824] * (-288.045) (-288.682) (-288.475) [-288.044] -- 0:00:49
Average standard deviation of split frequencies: 0.015904
155500 -- (-291.784) (-292.568) (-290.548) [-287.818] * (-288.601) (-292.778) [-290.188] (-290.157) -- 0:00:48
156000 -- (-288.235) (-291.463) [-289.611] (-287.571) * [-288.780] (-287.756) (-288.129) (-287.929) -- 0:00:48
156500 -- (-292.898) [-288.578] (-292.595) (-289.365) * [-291.132] (-288.598) (-290.313) (-288.465) -- 0:00:48
157000 -- (-288.723) [-289.943] (-289.639) (-287.861) * (-288.685) (-289.025) [-290.099] (-288.859) -- 0:00:48
157500 -- [-290.067] (-289.913) (-288.274) (-292.178) * [-288.226] (-288.254) (-287.722) (-290.451) -- 0:00:48
158000 -- (-289.598) (-287.430) [-289.668] (-291.364) * [-288.383] (-288.271) (-288.488) (-289.882) -- 0:00:47
158500 -- (-290.319) (-287.592) (-290.054) [-289.938] * (-291.074) [-289.954] (-287.760) (-292.516) -- 0:00:47
159000 -- [-289.425] (-289.195) (-288.755) (-289.827) * [-287.700] (-297.606) (-289.043) (-292.789) -- 0:00:47
159500 -- [-290.179] (-290.608) (-295.224) (-288.476) * [-289.404] (-291.196) (-292.640) (-295.514) -- 0:00:47
160000 -- (-290.047) [-288.566] (-288.151) (-289.890) * (-290.356) [-288.494] (-297.165) (-290.527) -- 0:00:52
Average standard deviation of split frequencies: 0.015134
160500 -- (-287.488) (-290.273) [-287.444] (-288.694) * (-289.580) (-288.374) (-290.561) [-290.900] -- 0:00:52
161000 -- (-289.592) (-288.106) (-288.411) [-290.596] * [-288.629] (-288.280) (-294.700) (-290.636) -- 0:00:52
161500 -- (-290.672) (-290.699) [-291.305] (-292.495) * (-287.345) [-288.809] (-290.499) (-287.851) -- 0:00:51
162000 -- [-288.928] (-290.104) (-289.310) (-290.064) * (-293.080) [-289.244] (-290.587) (-287.470) -- 0:00:51
162500 -- (-288.702) [-289.236] (-292.498) (-291.934) * (-293.175) [-288.153] (-288.965) (-289.802) -- 0:00:51
163000 -- [-288.990] (-291.728) (-294.417) (-287.953) * (-292.626) (-290.056) (-293.331) [-287.776] -- 0:00:51
163500 -- (-289.821) [-290.244] (-293.296) (-289.644) * [-292.476] (-290.296) (-290.777) (-288.163) -- 0:00:51
164000 -- (-289.852) [-288.279] (-291.900) (-288.815) * (-297.574) [-294.139] (-288.445) (-291.940) -- 0:00:50
164500 -- (-288.581) [-291.055] (-292.122) (-291.658) * (-292.118) [-288.056] (-289.367) (-289.044) -- 0:00:50
165000 -- [-287.616] (-293.112) (-292.803) (-289.581) * (-288.450) (-288.548) (-289.403) [-288.597] -- 0:00:50
Average standard deviation of split frequencies: 0.014946
165500 -- (-290.124) (-288.547) (-287.674) [-288.079] * (-288.928) (-287.757) [-290.105] (-290.600) -- 0:00:50
166000 -- (-290.796) (-288.588) [-287.564] (-291.630) * (-287.151) (-291.927) [-287.474] (-291.426) -- 0:00:50
166500 -- (-293.001) (-290.500) [-289.072] (-291.611) * (-291.374) (-291.492) [-290.416] (-292.708) -- 0:00:50
167000 -- [-292.331] (-290.902) (-288.454) (-290.042) * [-287.723] (-288.356) (-293.625) (-289.304) -- 0:00:49
167500 -- (-290.437) [-294.009] (-287.533) (-288.588) * (-292.537) [-288.968] (-289.577) (-288.583) -- 0:00:49
168000 -- (-292.382) [-289.082] (-290.741) (-287.895) * (-289.548) [-290.015] (-290.103) (-290.066) -- 0:00:49
168500 -- (-293.789) (-287.196) [-288.438] (-290.839) * (-289.969) (-288.841) (-291.566) [-289.142] -- 0:00:49
169000 -- (-289.693) (-289.075) [-288.668] (-289.950) * (-290.017) (-288.957) (-291.322) [-288.831] -- 0:00:49
169500 -- (-289.040) (-290.563) [-287.837] (-294.276) * [-289.019] (-287.464) (-291.998) (-291.108) -- 0:00:48
170000 -- [-289.430] (-295.523) (-289.069) (-288.045) * [-288.282] (-287.511) (-296.390) (-287.285) -- 0:00:48
Average standard deviation of split frequencies: 0.013229
170500 -- [-293.635] (-288.203) (-289.029) (-288.159) * (-288.653) (-287.719) [-289.937] (-289.083) -- 0:00:48
171000 -- [-289.261] (-290.221) (-290.586) (-289.218) * (-289.867) (-288.790) [-288.438] (-290.959) -- 0:00:48
171500 -- (-289.644) (-288.857) [-288.349] (-289.848) * (-289.219) (-290.572) (-288.193) [-288.072] -- 0:00:48
172000 -- [-288.425] (-287.802) (-288.186) (-290.439) * [-287.656] (-291.177) (-289.555) (-290.555) -- 0:00:48
172500 -- (-287.992) (-288.805) [-289.112] (-289.349) * (-290.091) [-291.068] (-293.129) (-288.873) -- 0:00:47
173000 -- (-289.661) (-288.591) [-288.351] (-296.899) * (-292.083) (-289.894) (-290.290) [-290.438] -- 0:00:47
173500 -- [-289.242] (-290.278) (-289.453) (-290.376) * (-292.013) [-289.700] (-289.388) (-290.113) -- 0:00:47
174000 -- (-288.155) (-290.545) [-290.694] (-288.979) * (-288.742) (-291.283) (-289.176) [-291.995] -- 0:00:47
174500 -- (-293.715) [-287.929] (-289.780) (-287.974) * (-292.854) [-288.553] (-288.744) (-288.899) -- 0:00:47
175000 -- (-288.601) (-289.214) (-293.582) [-287.669] * [-288.388] (-289.096) (-290.112) (-292.097) -- 0:00:47
Average standard deviation of split frequencies: 0.014379
175500 -- [-290.680] (-288.611) (-290.768) (-288.223) * [-288.499] (-291.700) (-287.837) (-290.033) -- 0:00:46
176000 -- (-291.277) (-288.293) (-296.945) [-287.655] * [-288.306] (-293.250) (-288.538) (-288.314) -- 0:00:46
176500 -- (-288.273) (-296.268) (-289.779) [-288.777] * (-290.196) (-290.965) (-288.715) [-288.418] -- 0:00:46
177000 -- [-290.921] (-293.613) (-289.337) (-291.196) * [-289.459] (-287.782) (-292.347) (-295.017) -- 0:00:51
177500 -- (-288.255) [-289.721] (-289.317) (-290.857) * (-292.259) (-287.590) [-288.310] (-293.280) -- 0:00:50
178000 -- (-288.861) (-292.452) [-291.298] (-289.629) * (-290.766) [-288.769] (-289.879) (-288.005) -- 0:00:50
178500 -- (-294.418) [-291.235] (-290.619) (-289.817) * (-289.419) (-294.531) (-293.269) [-288.270] -- 0:00:50
179000 -- (-290.611) [-289.189] (-290.557) (-289.474) * [-289.761] (-293.433) (-290.075) (-290.547) -- 0:00:50
179500 -- (-288.727) [-288.729] (-291.474) (-288.904) * [-287.919] (-291.175) (-290.840) (-289.349) -- 0:00:50
180000 -- (-294.490) (-291.076) (-290.069) [-289.427] * (-290.918) (-289.548) (-291.235) [-287.895] -- 0:00:50
Average standard deviation of split frequencies: 0.014694
180500 -- (-288.805) [-290.696] (-289.718) (-289.058) * (-289.955) (-290.561) [-291.744] (-288.108) -- 0:00:49
181000 -- (-290.758) [-289.844] (-288.985) (-290.714) * [-293.109] (-288.357) (-288.162) (-287.680) -- 0:00:49
181500 -- [-290.687] (-291.532) (-289.980) (-289.303) * (-293.302) [-292.649] (-288.269) (-288.586) -- 0:00:49
182000 -- (-290.454) (-289.292) (-287.485) [-288.213] * (-294.302) (-288.597) [-288.197] (-288.058) -- 0:00:49
182500 -- (-292.369) (-291.622) [-288.755] (-288.832) * [-288.299] (-289.379) (-288.052) (-289.085) -- 0:00:49
183000 -- (-293.231) (-287.225) [-289.837] (-292.437) * [-289.599] (-288.544) (-288.562) (-288.437) -- 0:00:49
183500 -- (-290.819) [-288.333] (-291.769) (-288.201) * (-287.539) (-291.375) [-291.384] (-292.828) -- 0:00:48
184000 -- (-288.227) (-288.679) (-289.304) [-288.624] * (-287.658) (-292.045) (-289.115) [-290.395] -- 0:00:48
184500 -- [-289.894] (-294.055) (-288.642) (-291.612) * (-287.968) (-293.431) [-289.161] (-291.674) -- 0:00:48
185000 -- [-287.699] (-291.866) (-291.427) (-291.378) * (-292.839) (-289.272) (-292.243) [-288.892] -- 0:00:48
Average standard deviation of split frequencies: 0.012806
185500 -- [-288.045] (-288.888) (-287.797) (-289.316) * (-288.655) [-291.295] (-289.641) (-288.980) -- 0:00:48
186000 -- [-289.203] (-291.014) (-288.248) (-289.292) * (-290.408) (-288.548) (-288.935) [-290.748] -- 0:00:48
186500 -- (-288.830) [-290.188] (-289.175) (-292.343) * (-288.284) [-288.898] (-289.471) (-289.276) -- 0:00:47
187000 -- [-289.825] (-288.260) (-291.477) (-295.537) * (-291.724) (-289.284) (-289.887) [-289.902] -- 0:00:47
187500 -- (-289.969) (-292.385) (-289.623) [-287.676] * (-290.477) [-288.354] (-288.795) (-288.844) -- 0:00:47
188000 -- (-288.891) (-290.856) [-291.505] (-287.594) * (-291.020) [-289.065] (-292.339) (-290.135) -- 0:00:47
188500 -- (-293.349) [-291.252] (-292.493) (-289.047) * [-288.696] (-290.406) (-290.441) (-288.274) -- 0:00:47
189000 -- (-294.895) (-290.338) (-288.463) [-291.286] * (-292.398) [-287.556] (-289.114) (-288.318) -- 0:00:47
189500 -- (-291.089) (-291.006) [-289.121] (-288.576) * (-288.181) [-289.301] (-288.530) (-288.315) -- 0:00:47
190000 -- (-287.270) [-291.128] (-289.106) (-290.337) * [-289.080] (-289.570) (-289.776) (-291.377) -- 0:00:46
Average standard deviation of split frequencies: 0.011842
190500 -- (-291.898) [-290.891] (-288.564) (-288.768) * (-288.302) (-293.431) [-289.219] (-291.792) -- 0:00:46
191000 -- [-290.629] (-290.378) (-288.531) (-293.978) * (-291.156) (-289.429) (-288.672) [-288.429] -- 0:00:46
191500 -- (-288.842) (-289.816) (-291.577) [-288.430] * (-289.111) (-288.337) [-290.458] (-291.614) -- 0:00:46
192000 -- (-290.524) (-288.193) (-292.022) [-291.245] * (-289.940) (-288.525) (-287.319) [-289.686] -- 0:00:46
192500 -- [-291.413] (-293.213) (-288.944) (-289.748) * (-289.693) (-288.138) (-289.329) [-290.820] -- 0:00:46
193000 -- (-288.343) (-289.516) [-288.421] (-287.567) * (-289.268) (-292.317) [-288.300] (-292.294) -- 0:00:45
193500 -- (-287.481) (-290.109) [-289.418] (-288.948) * (-295.892) (-293.560) [-288.051] (-291.604) -- 0:00:45
194000 -- (-288.843) [-287.988] (-287.886) (-287.882) * (-288.259) (-288.135) [-289.983] (-290.647) -- 0:00:49
194500 -- [-287.890] (-288.333) (-294.173) (-292.804) * [-288.766] (-289.354) (-289.863) (-289.655) -- 0:00:49
195000 -- (-289.763) (-288.886) (-293.648) [-296.512] * (-288.680) (-287.623) (-291.381) [-291.479] -- 0:00:49
Average standard deviation of split frequencies: 0.012026
195500 -- [-290.904] (-289.110) (-291.719) (-289.352) * (-289.154) [-288.868] (-290.099) (-287.474) -- 0:00:49
196000 -- (-290.412) (-290.316) [-290.743] (-289.976) * [-290.399] (-290.102) (-293.094) (-288.154) -- 0:00:49
196500 -- [-289.218] (-289.397) (-289.964) (-289.697) * (-290.375) [-288.160] (-293.630) (-290.051) -- 0:00:49
197000 -- [-289.117] (-288.410) (-289.855) (-287.326) * [-289.589] (-290.711) (-291.065) (-291.261) -- 0:00:48
197500 -- (-289.107) (-291.814) [-289.322] (-291.884) * (-288.715) (-291.988) (-287.923) [-288.189] -- 0:00:48
198000 -- (-291.613) [-289.128] (-290.795) (-290.989) * (-294.242) (-289.161) (-290.726) [-288.562] -- 0:00:48
198500 -- (-288.114) (-289.799) (-296.622) [-288.115] * (-289.968) (-290.352) [-289.912] (-289.096) -- 0:00:48
199000 -- (-288.144) (-289.047) [-287.721] (-288.089) * (-290.573) (-287.456) [-289.692] (-290.611) -- 0:00:48
199500 -- (-288.570) (-288.688) [-288.644] (-292.084) * [-290.107] (-291.240) (-289.507) (-289.413) -- 0:00:48
200000 -- (-288.216) (-288.557) [-288.480] (-288.588) * [-287.416] (-290.568) (-289.478) (-289.721) -- 0:00:48
Average standard deviation of split frequencies: 0.011055
200500 -- [-287.457] (-290.322) (-287.786) (-288.864) * (-287.752) (-290.504) (-289.039) [-289.695] -- 0:00:47
201000 -- (-288.401) (-296.465) (-292.796) [-288.351] * (-288.657) (-290.315) (-288.943) [-288.038] -- 0:00:47
201500 -- (-288.011) (-290.473) (-290.472) [-291.082] * (-291.086) [-288.389] (-293.479) (-290.307) -- 0:00:47
202000 -- (-289.298) [-289.775] (-288.131) (-288.160) * (-291.048) [-288.686] (-290.236) (-290.704) -- 0:00:47
202500 -- (-287.705) (-288.925) [-289.090] (-289.750) * [-290.477] (-289.652) (-288.683) (-290.545) -- 0:00:47
203000 -- (-288.143) [-289.906] (-289.513) (-294.015) * [-290.392] (-289.395) (-287.317) (-288.999) -- 0:00:47
203500 -- [-289.564] (-290.616) (-293.868) (-287.098) * (-290.850) (-288.317) (-289.061) [-288.026] -- 0:00:46
204000 -- (-289.704) (-288.968) [-289.995] (-287.289) * (-292.104) (-289.793) [-289.410] (-291.065) -- 0:00:46
204500 -- (-288.522) (-291.049) (-289.929) [-290.248] * (-293.262) (-288.918) [-288.646] (-290.996) -- 0:00:46
205000 -- [-290.293] (-289.762) (-291.203) (-288.845) * (-288.859) (-292.366) (-290.716) [-289.301] -- 0:00:46
Average standard deviation of split frequencies: 0.010806
205500 -- [-288.377] (-289.281) (-290.461) (-289.541) * (-289.542) (-291.893) [-289.964] (-287.841) -- 0:00:46
206000 -- (-288.801) [-287.800] (-292.381) (-290.181) * (-287.654) [-291.179] (-290.579) (-292.633) -- 0:00:46
206500 -- (-293.722) [-290.832] (-294.004) (-288.498) * (-290.382) [-289.809] (-289.469) (-288.329) -- 0:00:46
207000 -- [-291.269] (-292.558) (-289.836) (-289.908) * [-291.194] (-289.030) (-289.466) (-288.320) -- 0:00:45
207500 -- (-287.931) (-288.456) (-288.422) [-289.311] * [-293.275] (-290.147) (-289.658) (-289.705) -- 0:00:45
208000 -- [-288.569] (-289.187) (-288.875) (-287.604) * (-287.795) (-289.144) [-291.620] (-291.347) -- 0:00:45
208500 -- (-288.045) (-289.880) [-290.945] (-289.610) * (-287.747) (-289.206) (-288.586) [-289.009] -- 0:00:45
209000 -- (-290.458) (-287.985) [-291.133] (-295.399) * (-288.576) (-288.432) [-290.183] (-287.286) -- 0:00:45
209500 -- (-288.627) (-288.558) [-290.131] (-291.470) * (-290.194) (-288.283) (-291.119) [-288.007] -- 0:00:45
210000 -- (-287.682) (-289.480) (-292.209) [-291.504] * (-287.588) (-290.462) [-290.470] (-287.323) -- 0:00:45
Average standard deviation of split frequencies: 0.010717
210500 -- [-287.483] (-288.999) (-290.390) (-289.246) * (-289.813) (-289.914) (-292.964) [-289.151] -- 0:00:45
211000 -- (-291.109) (-290.435) (-292.287) [-292.772] * (-293.228) [-288.175] (-291.112) (-289.993) -- 0:00:44
211500 -- (-289.235) (-290.265) [-289.559] (-290.311) * (-289.548) (-287.613) [-289.424] (-291.335) -- 0:00:48
212000 -- [-288.538] (-290.148) (-290.174) (-288.801) * (-288.559) (-288.215) (-289.437) [-289.272] -- 0:00:48
212500 -- (-289.391) [-291.500] (-293.923) (-295.148) * [-287.394] (-287.802) (-291.829) (-288.508) -- 0:00:48
213000 -- (-288.775) [-291.511] (-287.832) (-295.537) * [-287.413] (-289.439) (-290.817) (-289.148) -- 0:00:48
213500 -- [-288.752] (-289.187) (-290.420) (-293.637) * (-289.737) (-291.402) [-290.093] (-290.958) -- 0:00:47
214000 -- (-292.906) [-288.974] (-294.638) (-288.884) * [-290.576] (-288.937) (-292.139) (-289.094) -- 0:00:47
214500 -- (-289.980) (-288.157) (-295.369) [-288.796] * (-288.811) (-289.448) (-290.277) [-291.371] -- 0:00:47
215000 -- (-289.753) [-288.172] (-289.995) (-288.224) * [-289.986] (-292.076) (-293.874) (-288.342) -- 0:00:47
Average standard deviation of split frequencies: 0.012125
215500 -- (-289.533) (-289.017) (-291.108) [-289.365] * (-287.512) [-287.517] (-290.453) (-288.004) -- 0:00:47
216000 -- [-294.777] (-293.533) (-289.570) (-289.972) * (-287.806) (-291.598) [-291.284] (-290.001) -- 0:00:47
216500 -- [-288.699] (-292.017) (-291.516) (-290.551) * (-290.740) (-292.175) [-290.993] (-287.576) -- 0:00:47
217000 -- (-289.004) (-292.306) [-289.787] (-289.629) * (-289.895) [-291.909] (-288.004) (-291.724) -- 0:00:46
217500 -- [-288.039] (-291.812) (-292.421) (-289.061) * (-292.041) (-291.392) (-289.403) [-288.745] -- 0:00:46
218000 -- [-291.729] (-288.601) (-292.482) (-292.863) * (-290.946) (-290.092) [-287.943] (-293.106) -- 0:00:46
218500 -- (-288.865) (-292.269) (-293.121) [-288.875] * (-293.019) [-288.740] (-290.888) (-287.663) -- 0:00:46
219000 -- (-290.801) (-291.959) (-289.170) [-288.169] * (-288.849) (-288.965) (-291.192) [-292.315] -- 0:00:46
219500 -- (-288.040) (-290.291) (-289.864) [-290.169] * (-287.611) [-289.671] (-288.161) (-288.468) -- 0:00:46
220000 -- (-288.421) [-291.723] (-289.597) (-288.914) * [-290.565] (-291.409) (-292.456) (-290.165) -- 0:00:46
Average standard deviation of split frequencies: 0.014200
220500 -- (-287.765) (-289.306) (-290.892) [-289.973] * [-290.645] (-290.616) (-295.391) (-292.209) -- 0:00:45
221000 -- (-290.683) [-288.667] (-293.236) (-287.519) * (-292.392) (-299.340) [-288.494] (-289.339) -- 0:00:45
221500 -- (-291.176) (-292.357) [-289.171] (-292.746) * (-288.864) (-293.890) (-292.995) [-288.267] -- 0:00:45
222000 -- (-293.960) [-288.856] (-290.272) (-288.768) * (-289.623) (-293.599) [-290.277] (-287.821) -- 0:00:45
222500 -- (-288.761) [-290.214] (-292.908) (-290.378) * (-289.961) (-287.353) (-289.923) [-290.582] -- 0:00:45
223000 -- (-289.628) [-291.206] (-291.458) (-289.785) * [-287.764] (-289.663) (-288.812) (-287.400) -- 0:00:45
223500 -- [-290.330] (-289.074) (-287.886) (-291.248) * (-288.487) [-287.560] (-288.683) (-294.237) -- 0:00:45
224000 -- [-288.298] (-290.265) (-289.000) (-291.891) * (-288.908) [-290.158] (-289.565) (-294.331) -- 0:00:45
224500 -- (-289.425) (-290.980) [-290.366] (-291.615) * (-289.056) (-291.381) (-288.852) [-287.462] -- 0:00:44
225000 -- (-290.967) (-287.438) [-289.979] (-288.597) * (-294.382) [-290.199] (-290.755) (-292.105) -- 0:00:44
Average standard deviation of split frequencies: 0.014356
225500 -- (-287.825) (-288.163) [-290.238] (-288.852) * (-291.523) (-288.943) (-289.713) [-288.049] -- 0:00:44
226000 -- (-287.888) (-287.662) [-290.384] (-288.460) * (-289.977) (-288.779) (-289.228) [-289.765] -- 0:00:44
226500 -- (-292.422) (-291.499) [-290.092] (-291.270) * (-290.280) [-288.167] (-288.895) (-289.335) -- 0:00:44
227000 -- [-290.342] (-293.373) (-290.457) (-292.411) * [-290.057] (-287.955) (-292.438) (-291.037) -- 0:00:44
227500 -- (-287.906) (-291.357) (-288.139) [-289.310] * (-293.905) (-290.404) [-289.977] (-290.091) -- 0:00:44
228000 -- (-289.033) (-288.698) (-288.095) [-287.932] * (-288.639) [-288.310] (-289.625) (-289.026) -- 0:00:44
228500 -- (-292.793) (-289.496) [-292.729] (-292.260) * (-288.681) [-287.359] (-291.473) (-290.660) -- 0:00:47
229000 -- (-289.062) (-288.214) (-289.653) [-288.416] * (-287.956) (-290.184) [-290.383] (-291.968) -- 0:00:47
229500 -- (-290.344) (-292.111) (-288.112) [-287.702] * (-288.042) (-290.007) [-291.855] (-289.527) -- 0:00:47
230000 -- [-290.916] (-289.718) (-289.869) (-291.555) * (-288.326) (-288.369) (-287.841) [-287.943] -- 0:00:46
Average standard deviation of split frequencies: 0.015327
230500 -- [-288.520] (-288.035) (-292.152) (-293.301) * (-292.428) (-289.237) (-291.335) [-288.801] -- 0:00:46
231000 -- (-287.885) (-288.392) (-289.979) [-289.123] * (-293.412) [-288.574] (-289.210) (-288.062) -- 0:00:46
231500 -- (-290.635) [-288.193] (-291.056) (-289.256) * (-296.156) (-289.090) (-292.633) [-290.225] -- 0:00:46
232000 -- [-289.561] (-288.912) (-290.538) (-288.184) * [-289.394] (-289.081) (-290.743) (-290.386) -- 0:00:46
232500 -- (-288.012) [-290.403] (-287.864) (-291.858) * (-289.082) [-287.475] (-291.307) (-289.137) -- 0:00:46
233000 -- (-289.030) (-290.249) [-288.453] (-290.341) * (-291.165) (-290.920) [-290.185] (-288.453) -- 0:00:46
233500 -- (-294.650) (-290.914) [-291.617] (-289.099) * (-287.353) (-289.018) (-293.099) [-288.230] -- 0:00:45
234000 -- (-287.765) (-289.481) (-288.436) [-287.766] * (-290.716) [-298.900] (-293.386) (-288.408) -- 0:00:45
234500 -- [-287.824] (-293.062) (-289.756) (-288.531) * (-291.209) [-292.462] (-288.585) (-294.064) -- 0:00:45
235000 -- (-290.861) (-295.657) (-289.062) [-288.753] * (-294.781) [-287.572] (-291.709) (-289.384) -- 0:00:45
Average standard deviation of split frequencies: 0.014981
235500 -- (-289.592) (-292.395) [-287.852] (-287.699) * (-287.851) [-288.293] (-297.527) (-294.211) -- 0:00:45
236000 -- [-289.977] (-287.431) (-289.864) (-287.340) * (-290.807) (-288.471) (-289.282) [-294.418] -- 0:00:45
236500 -- (-290.935) (-292.404) (-288.931) [-289.783] * (-292.523) (-292.098) [-288.232] (-291.795) -- 0:00:45
237000 -- [-287.787] (-288.869) (-291.653) (-290.807) * (-289.564) (-288.156) (-288.552) [-288.123] -- 0:00:45
237500 -- (-289.417) [-287.856] (-290.119) (-288.835) * (-290.173) (-289.200) [-292.148] (-288.671) -- 0:00:44
238000 -- [-287.676] (-289.221) (-294.987) (-289.273) * (-291.315) (-293.353) [-294.638] (-295.870) -- 0:00:44
238500 -- (-288.904) [-289.780] (-287.820) (-289.583) * (-288.752) (-293.200) (-295.551) [-290.562] -- 0:00:44
239000 -- (-290.353) (-292.747) (-289.390) [-289.309] * [-288.383] (-290.855) (-292.293) (-297.826) -- 0:00:44
239500 -- (-290.529) (-288.294) [-288.394] (-288.432) * (-287.965) (-289.133) (-296.493) [-291.787] -- 0:00:44
240000 -- (-290.784) (-291.870) (-293.042) [-291.836] * (-288.861) (-290.276) [-287.612] (-289.957) -- 0:00:44
Average standard deviation of split frequencies: 0.013711
240500 -- (-289.668) (-296.026) [-292.758] (-290.132) * (-289.017) [-288.736] (-290.866) (-287.690) -- 0:00:44
241000 -- (-289.899) (-288.597) (-290.640) [-291.038] * (-290.810) (-289.832) [-289.534] (-287.774) -- 0:00:44
241500 -- [-288.821] (-292.189) (-290.265) (-291.905) * (-287.960) (-289.411) [-290.547] (-289.093) -- 0:00:43
242000 -- (-288.231) [-288.696] (-290.668) (-288.686) * (-288.963) (-288.953) (-290.191) [-288.788] -- 0:00:43
242500 -- (-292.020) (-289.711) (-292.630) [-287.696] * (-290.638) [-289.220] (-290.972) (-294.865) -- 0:00:43
243000 -- (-295.118) [-288.434] (-291.916) (-289.329) * [-288.982] (-289.364) (-292.708) (-289.583) -- 0:00:43
243500 -- (-290.522) (-289.368) [-288.911] (-290.972) * (-289.012) (-288.230) (-292.231) [-288.037] -- 0:00:43
244000 -- (-288.569) (-288.507) [-287.968] (-292.588) * (-291.666) [-288.023] (-289.022) (-287.476) -- 0:00:43
244500 -- (-288.188) (-288.717) [-290.694] (-287.923) * (-292.141) [-292.873] (-289.731) (-290.734) -- 0:00:43
245000 -- [-290.061] (-291.832) (-288.276) (-289.962) * (-292.449) [-287.907] (-290.862) (-289.870) -- 0:00:43
Average standard deviation of split frequencies: 0.014564
245500 -- (-288.977) (-291.183) (-288.372) [-288.391] * (-291.100) [-288.369] (-291.423) (-291.760) -- 0:00:43
246000 -- (-293.139) [-288.638] (-289.070) (-288.537) * (-291.733) [-289.369] (-298.165) (-288.737) -- 0:00:45
246500 -- (-289.048) (-291.127) (-287.642) [-289.896] * [-289.228] (-287.847) (-292.552) (-288.566) -- 0:00:45
247000 -- (-290.841) (-287.410) [-290.192] (-291.029) * (-290.186) [-289.398] (-287.307) (-288.620) -- 0:00:45
247500 -- (-288.582) (-289.147) (-295.727) [-289.079] * (-289.651) (-289.828) (-289.768) [-288.004] -- 0:00:45
248000 -- (-288.807) (-288.666) [-291.251] (-291.260) * (-289.697) [-290.507] (-296.643) (-290.125) -- 0:00:45
248500 -- (-291.747) [-289.181] (-289.369) (-292.520) * (-288.813) (-287.440) [-293.928] (-288.424) -- 0:00:45
249000 -- (-290.636) (-287.951) [-289.316] (-289.907) * (-290.240) (-292.178) [-289.044] (-289.365) -- 0:00:45
249500 -- (-288.978) (-291.024) [-287.716] (-289.358) * [-289.217] (-291.538) (-288.369) (-289.671) -- 0:00:45
250000 -- [-290.410] (-294.125) (-288.847) (-288.142) * [-291.777] (-291.519) (-287.836) (-289.041) -- 0:00:45
Average standard deviation of split frequencies: 0.015342
250500 -- (-289.239) [-289.572] (-287.991) (-289.897) * (-289.295) [-290.967] (-288.613) (-288.367) -- 0:00:44
251000 -- (-291.120) (-287.860) [-287.354] (-289.362) * [-288.457] (-291.334) (-287.382) (-289.438) -- 0:00:44
251500 -- (-289.877) (-289.187) (-288.406) [-289.553] * [-288.669] (-291.800) (-288.076) (-290.997) -- 0:00:44
252000 -- [-289.797] (-290.344) (-296.258) (-289.996) * (-287.413) (-295.887) [-290.067] (-288.317) -- 0:00:44
252500 -- (-288.135) (-289.326) [-291.158] (-287.930) * (-289.337) (-295.333) [-288.800] (-288.432) -- 0:00:44
253000 -- (-287.872) (-287.542) [-289.193] (-289.511) * [-291.865] (-288.690) (-293.856) (-288.928) -- 0:00:44
253500 -- [-288.314] (-287.941) (-288.624) (-287.822) * [-289.304] (-287.813) (-289.606) (-287.504) -- 0:00:44
254000 -- [-292.563] (-290.767) (-288.900) (-291.703) * (-289.302) (-288.031) [-290.149] (-287.919) -- 0:00:44
254500 -- [-292.307] (-291.349) (-293.727) (-292.094) * (-289.162) [-288.796] (-289.050) (-290.117) -- 0:00:43
255000 -- (-292.767) [-287.995] (-289.886) (-288.437) * (-289.596) (-287.932) (-292.695) [-287.587] -- 0:00:43
Average standard deviation of split frequencies: 0.014731
255500 -- [-288.560] (-290.244) (-287.671) (-288.685) * (-289.641) [-288.407] (-290.734) (-289.990) -- 0:00:43
256000 -- (-289.053) (-288.649) [-287.634] (-288.464) * [-289.591] (-288.140) (-287.829) (-290.046) -- 0:00:43
256500 -- (-288.630) (-288.962) (-289.163) [-288.147] * (-292.354) (-290.313) (-287.823) [-292.595] -- 0:00:43
257000 -- (-294.466) [-288.876] (-288.186) (-289.313) * [-289.434] (-290.852) (-289.688) (-289.621) -- 0:00:43
257500 -- (-289.538) (-288.750) (-288.283) [-287.515] * (-289.643) (-292.252) [-289.296] (-288.917) -- 0:00:43
258000 -- (-289.596) (-293.926) [-288.915] (-289.375) * (-289.797) (-289.178) [-288.410] (-291.576) -- 0:00:43
258500 -- (-288.840) (-289.090) [-287.712] (-292.138) * (-288.596) (-288.327) [-288.880] (-290.173) -- 0:00:43
259000 -- (-291.234) (-294.291) [-287.155] (-288.993) * (-289.052) (-289.319) (-288.578) [-288.316] -- 0:00:42
259500 -- [-287.734] (-288.836) (-288.834) (-291.925) * [-287.611] (-289.135) (-289.592) (-289.006) -- 0:00:42
260000 -- (-292.073) [-288.974] (-288.796) (-289.424) * (-287.852) (-288.150) (-287.684) [-288.209] -- 0:00:42
Average standard deviation of split frequencies: 0.013965
260500 -- (-290.699) (-291.006) (-291.745) [-288.640] * [-289.529] (-288.361) (-291.458) (-293.008) -- 0:00:42
261000 -- (-287.514) (-288.649) (-288.821) [-289.838] * (-290.539) (-289.022) (-290.275) [-288.404] -- 0:00:42
261500 -- (-289.515) (-293.935) [-289.598] (-290.464) * (-288.834) [-291.797] (-293.901) (-287.704) -- 0:00:42
262000 -- (-291.716) (-289.159) (-293.130) [-288.270] * (-288.452) [-288.178] (-291.880) (-292.340) -- 0:00:42
262500 -- (-293.764) [-288.586] (-287.774) (-287.681) * (-292.503) (-289.141) [-288.431] (-289.329) -- 0:00:42
263000 -- (-291.393) (-289.773) [-289.479] (-288.405) * (-290.271) (-289.351) [-287.774] (-290.179) -- 0:00:44
263500 -- (-295.579) [-290.498] (-290.765) (-289.479) * (-291.127) (-287.769) [-290.297] (-293.238) -- 0:00:44
264000 -- (-289.741) (-288.145) [-292.896] (-288.171) * (-288.940) (-292.968) (-290.224) [-293.868] -- 0:00:44
264500 -- [-288.918] (-288.284) (-294.647) (-289.201) * (-288.067) (-293.005) (-290.610) [-292.404] -- 0:00:44
265000 -- (-292.668) (-290.860) (-289.482) [-287.786] * (-291.625) (-288.084) [-290.315] (-288.342) -- 0:00:44
Average standard deviation of split frequencies: 0.015297
265500 -- (-290.066) [-288.749] (-289.818) (-296.475) * (-287.524) (-288.285) (-290.117) [-289.377] -- 0:00:44
266000 -- (-288.485) (-287.634) [-290.830] (-289.314) * (-292.403) (-290.035) (-288.282) [-290.093] -- 0:00:44
266500 -- (-289.024) (-290.648) (-290.133) [-291.312] * (-290.852) [-292.185] (-290.439) (-287.686) -- 0:00:44
267000 -- [-288.233] (-292.432) (-293.256) (-288.615) * (-294.460) [-291.810] (-290.048) (-291.014) -- 0:00:43
267500 -- (-289.103) [-289.165] (-287.302) (-288.030) * [-287.657] (-289.645) (-288.762) (-288.560) -- 0:00:43
268000 -- (-289.500) (-288.946) [-288.576] (-290.933) * [-288.145] (-290.814) (-287.439) (-290.461) -- 0:00:43
268500 -- (-291.428) (-289.384) (-288.761) [-288.156] * (-294.309) (-289.220) (-290.040) [-288.576] -- 0:00:43
269000 -- (-291.270) (-288.814) (-290.331) [-289.324] * (-292.699) [-289.484] (-288.747) (-291.853) -- 0:00:43
269500 -- (-288.765) (-289.159) [-287.957] (-290.059) * [-289.941] (-289.537) (-290.550) (-287.950) -- 0:00:43
270000 -- (-288.430) (-287.739) (-290.487) [-288.489] * (-295.341) [-289.755] (-287.958) (-290.338) -- 0:00:43
Average standard deviation of split frequencies: 0.013933
270500 -- (-290.401) (-288.457) [-288.375] (-288.346) * (-288.392) [-288.907] (-290.724) (-292.155) -- 0:00:43
271000 -- (-288.979) (-291.816) [-289.490] (-289.948) * (-292.373) [-287.891] (-289.970) (-289.459) -- 0:00:43
271500 -- (-288.870) [-293.186] (-291.896) (-289.813) * (-297.337) [-290.670] (-290.235) (-288.206) -- 0:00:42
272000 -- (-289.619) (-294.003) [-292.361] (-289.064) * [-288.008] (-289.080) (-292.907) (-288.724) -- 0:00:42
272500 -- (-290.298) [-292.087] (-289.952) (-293.969) * [-288.874] (-288.174) (-290.361) (-290.171) -- 0:00:42
273000 -- [-288.441] (-291.053) (-289.543) (-288.047) * (-287.214) [-290.921] (-292.032) (-288.870) -- 0:00:42
273500 -- (-289.102) (-293.303) (-293.410) [-288.978] * (-287.515) (-289.081) [-290.870] (-288.394) -- 0:00:42
274000 -- (-289.982) (-289.769) [-289.941] (-288.801) * [-287.515] (-288.097) (-292.004) (-288.365) -- 0:00:42
274500 -- (-290.709) (-288.718) [-287.595] (-294.292) * (-288.536) (-291.246) (-291.034) [-288.578] -- 0:00:42
275000 -- [-289.896] (-288.515) (-289.608) (-289.953) * [-288.013] (-291.511) (-292.473) (-288.927) -- 0:00:42
Average standard deviation of split frequencies: 0.014563
275500 -- (-289.024) (-290.511) [-289.100] (-290.939) * [-290.017] (-292.652) (-290.082) (-289.561) -- 0:00:42
276000 -- (-288.550) [-287.682] (-289.969) (-287.906) * [-287.407] (-290.323) (-291.036) (-292.073) -- 0:00:41
276500 -- (-287.250) [-290.778] (-292.010) (-288.304) * (-292.191) (-293.754) (-294.010) [-291.418] -- 0:00:41
277000 -- (-287.960) (-294.708) (-288.015) [-288.317] * (-287.893) (-292.782) [-291.946] (-289.918) -- 0:00:41
277500 -- (-288.162) [-292.390] (-291.251) (-287.936) * (-290.635) (-290.788) (-289.291) [-288.818] -- 0:00:41
278000 -- (-290.773) (-289.757) [-287.277] (-288.910) * (-290.972) [-289.164] (-288.598) (-290.360) -- 0:00:41
278500 -- (-290.266) (-289.196) (-289.537) [-289.020] * (-287.789) (-288.243) [-288.018] (-290.359) -- 0:00:41
279000 -- [-289.138] (-293.072) (-289.348) (-290.254) * (-289.752) (-288.872) [-291.226] (-287.846) -- 0:00:41
279500 -- (-287.412) (-289.087) (-289.785) [-289.497] * (-288.954) [-288.047] (-290.384) (-288.842) -- 0:00:41
280000 -- (-290.395) (-291.393) [-288.117] (-289.813) * (-290.476) [-288.919] (-291.621) (-287.662) -- 0:00:41
Average standard deviation of split frequencies: 0.015205
280500 -- (-289.056) [-289.809] (-291.170) (-290.112) * (-290.443) [-289.086] (-288.107) (-291.139) -- 0:00:43
281000 -- (-288.097) (-296.876) (-292.277) [-290.642] * [-288.608] (-289.737) (-290.206) (-288.051) -- 0:00:43
281500 -- (-291.064) (-288.959) [-288.472] (-287.746) * (-290.671) [-288.560] (-290.285) (-290.767) -- 0:00:43
282000 -- [-287.577] (-290.028) (-288.502) (-287.782) * [-289.382] (-289.045) (-291.466) (-291.585) -- 0:00:43
282500 -- (-290.073) (-289.230) (-288.340) [-287.763] * (-289.834) (-291.570) (-296.682) [-289.121] -- 0:00:43
283000 -- [-290.483] (-289.084) (-291.495) (-288.467) * (-291.678) (-291.184) (-292.369) [-291.522] -- 0:00:43
283500 -- [-289.211] (-288.474) (-292.213) (-290.577) * (-291.705) (-289.962) [-292.731] (-291.116) -- 0:00:42
284000 -- (-289.736) (-287.604) (-293.283) [-291.832] * (-289.060) (-288.413) [-292.792] (-287.830) -- 0:00:42
284500 -- (-289.337) (-289.274) [-291.509] (-291.814) * (-289.398) (-288.061) [-288.439] (-293.499) -- 0:00:42
285000 -- [-290.563] (-290.312) (-290.040) (-295.228) * (-292.547) (-291.577) (-288.768) [-290.078] -- 0:00:42
Average standard deviation of split frequencies: 0.015008
285500 -- (-290.570) (-287.708) [-288.567] (-293.166) * (-292.606) [-289.273] (-293.572) (-288.039) -- 0:00:42
286000 -- [-288.156] (-291.265) (-289.405) (-287.993) * (-289.759) (-290.228) [-291.079] (-288.733) -- 0:00:42
286500 -- [-289.362] (-292.308) (-289.132) (-289.711) * (-291.173) (-289.102) (-289.052) [-289.613] -- 0:00:42
287000 -- (-289.780) (-291.873) (-289.680) [-288.155] * (-289.963) (-289.630) [-288.187] (-289.687) -- 0:00:42
287500 -- [-291.076] (-289.580) (-291.356) (-288.646) * [-290.827] (-292.719) (-288.449) (-290.186) -- 0:00:42
288000 -- (-292.224) [-289.999] (-292.666) (-290.208) * [-288.805] (-288.304) (-288.590) (-289.786) -- 0:00:42
288500 -- (-293.600) (-292.945) (-291.781) [-287.570] * (-292.024) (-291.717) (-292.167) [-288.778] -- 0:00:41
289000 -- [-292.165] (-290.371) (-293.178) (-289.013) * (-289.034) [-290.422] (-290.214) (-290.554) -- 0:00:41
289500 -- (-287.807) [-289.920] (-287.814) (-292.468) * (-293.243) (-288.531) [-288.615] (-290.967) -- 0:00:41
290000 -- (-288.391) [-289.596] (-287.632) (-290.711) * (-289.562) (-289.020) (-288.748) [-288.057] -- 0:00:41
Average standard deviation of split frequencies: 0.014340
290500 -- [-294.227] (-290.106) (-289.129) (-288.470) * (-291.787) [-290.509] (-295.666) (-291.447) -- 0:00:41
291000 -- [-293.617] (-292.177) (-288.348) (-287.481) * [-296.216] (-287.518) (-292.491) (-292.174) -- 0:00:41
291500 -- [-289.599] (-289.733) (-288.364) (-289.715) * (-288.550) [-288.163] (-289.660) (-289.321) -- 0:00:41
292000 -- (-297.248) [-287.271] (-295.500) (-288.811) * [-287.823] (-287.306) (-292.590) (-290.195) -- 0:00:41
292500 -- (-292.480) (-287.436) (-292.259) [-289.629] * (-289.153) (-289.845) (-290.605) [-288.144] -- 0:00:41
293000 -- (-294.330) [-288.323] (-291.906) (-288.355) * (-291.772) (-287.826) (-292.531) [-289.758] -- 0:00:41
293500 -- (-288.734) (-288.549) (-289.594) [-287.997] * (-289.797) (-294.411) [-292.168] (-291.058) -- 0:00:40
294000 -- (-296.568) [-288.087] (-289.409) (-287.410) * [-287.515] (-290.661) (-289.143) (-294.061) -- 0:00:40
294500 -- (-294.843) (-288.869) [-291.586] (-287.402) * [-288.499] (-291.679) (-291.505) (-289.648) -- 0:00:40
295000 -- (-287.938) [-287.558] (-289.978) (-288.996) * (-288.478) (-287.718) [-288.823] (-289.325) -- 0:00:40
Average standard deviation of split frequencies: 0.014249
295500 -- [-287.816] (-289.786) (-291.134) (-287.710) * [-289.529] (-287.372) (-292.505) (-289.493) -- 0:00:40
296000 -- (-289.822) (-295.763) [-289.207] (-290.457) * [-288.136] (-287.860) (-288.299) (-289.204) -- 0:00:40
296500 -- (-290.680) (-288.454) (-289.061) [-288.479] * (-290.751) [-291.426] (-290.603) (-288.026) -- 0:00:40
297000 -- (-290.507) [-288.294] (-291.824) (-291.612) * [-288.924] (-287.762) (-289.951) (-288.148) -- 0:00:40
297500 -- (-290.077) [-289.008] (-291.190) (-291.783) * (-289.812) (-287.444) (-290.550) [-293.223] -- 0:00:42
298000 -- (-287.909) (-288.916) [-288.473] (-289.688) * (-288.569) (-287.828) (-291.987) [-290.075] -- 0:00:42
298500 -- (-290.435) (-291.800) (-293.238) [-289.107] * (-290.331) (-288.314) [-290.419] (-291.589) -- 0:00:42
299000 -- [-289.014] (-289.344) (-290.920) (-290.033) * (-289.555) [-288.892] (-290.482) (-294.953) -- 0:00:42
299500 -- (-288.421) [-290.631] (-291.479) (-288.537) * (-290.725) [-290.196] (-290.057) (-293.255) -- 0:00:42
300000 -- (-288.488) (-291.384) [-288.904] (-288.778) * (-290.072) (-289.625) (-291.178) [-288.245] -- 0:00:42
Average standard deviation of split frequencies: 0.014193
300500 -- (-290.644) (-291.048) (-291.972) [-287.604] * (-289.950) (-289.337) (-290.830) [-287.490] -- 0:00:41
301000 -- (-288.979) (-287.811) [-289.085] (-289.776) * (-289.150) (-288.050) (-290.184) [-287.810] -- 0:00:41
301500 -- (-291.107) (-287.721) (-294.050) [-289.060] * [-289.614] (-291.476) (-289.329) (-288.079) -- 0:00:41
302000 -- (-289.748) (-288.163) (-288.703) [-287.495] * (-289.306) (-290.005) (-292.538) [-289.254] -- 0:00:41
302500 -- (-289.244) (-294.111) (-288.666) [-289.840] * (-287.893) (-290.193) [-289.205] (-290.113) -- 0:00:41
303000 -- [-287.833] (-291.278) (-287.557) (-287.837) * (-289.959) (-295.162) [-292.253] (-288.839) -- 0:00:41
303500 -- (-288.201) [-289.617] (-290.919) (-288.855) * (-291.322) [-287.505] (-289.318) (-290.717) -- 0:00:41
304000 -- [-288.753] (-288.769) (-290.306) (-287.489) * [-287.982] (-289.763) (-289.845) (-291.389) -- 0:00:41
304500 -- (-290.771) (-288.395) [-290.076] (-289.588) * (-288.609) (-288.450) [-290.174] (-292.825) -- 0:00:41
305000 -- [-287.956] (-288.480) (-288.078) (-291.287) * (-288.742) (-290.006) [-288.547] (-288.078) -- 0:00:41
Average standard deviation of split frequencies: 0.014432
305500 -- [-288.088] (-288.433) (-289.263) (-288.598) * (-293.639) (-289.243) (-294.446) [-288.950] -- 0:00:40
306000 -- [-287.729] (-292.632) (-289.569) (-287.864) * (-288.249) (-289.221) [-288.733] (-288.025) -- 0:00:40
306500 -- (-288.602) (-298.469) (-289.164) [-288.230] * (-291.272) (-289.049) (-289.157) [-290.390] -- 0:00:40
307000 -- (-291.506) [-288.897] (-290.842) (-290.166) * (-291.560) (-288.399) (-292.611) [-289.529] -- 0:00:40
307500 -- (-293.368) (-289.843) (-288.339) [-287.543] * (-291.193) (-290.426) [-288.660] (-291.731) -- 0:00:40
308000 -- (-290.323) (-289.642) [-290.494] (-288.792) * [-287.816] (-290.672) (-290.372) (-295.043) -- 0:00:40
308500 -- (-291.046) (-288.727) (-291.159) [-288.863] * (-288.031) (-288.596) (-292.655) [-288.547] -- 0:00:40
309000 -- [-290.333] (-289.821) (-288.976) (-287.774) * (-289.080) [-287.901] (-289.164) (-289.605) -- 0:00:40
309500 -- (-290.409) (-288.374) [-289.054] (-288.563) * (-289.910) (-289.199) [-289.763] (-289.521) -- 0:00:40
310000 -- (-288.197) (-289.982) [-291.941] (-290.181) * (-289.001) (-290.943) [-289.400] (-287.894) -- 0:00:40
Average standard deviation of split frequencies: 0.013018
310500 -- (-288.137) [-288.441] (-288.273) (-288.667) * [-287.777] (-291.177) (-287.688) (-289.295) -- 0:00:39
311000 -- (-287.853) (-289.525) (-287.953) [-290.623] * [-290.035] (-289.222) (-289.890) (-289.711) -- 0:00:39
311500 -- (-289.711) (-292.967) [-289.712] (-288.673) * (-288.655) [-289.927] (-289.985) (-289.877) -- 0:00:39
312000 -- [-289.209] (-293.382) (-288.625) (-292.789) * (-289.300) (-289.251) [-288.402] (-291.715) -- 0:00:39
312500 -- [-291.076] (-294.872) (-288.184) (-289.685) * (-288.751) (-289.118) (-288.612) [-289.426] -- 0:00:39
313000 -- (-290.502) [-288.264] (-288.217) (-290.617) * (-289.638) (-289.452) [-288.223] (-289.260) -- 0:00:39
313500 -- [-287.774] (-289.042) (-289.691) (-289.945) * [-288.803] (-293.502) (-292.888) (-289.466) -- 0:00:39
314000 -- (-288.862) (-288.177) [-289.813] (-289.103) * [-289.243] (-287.428) (-290.385) (-290.145) -- 0:00:39
314500 -- [-289.241] (-291.186) (-290.804) (-287.789) * (-288.535) (-289.494) [-290.269] (-288.059) -- 0:00:39
315000 -- (-288.056) (-292.138) (-289.101) [-288.727] * [-288.400] (-288.526) (-290.148) (-290.695) -- 0:00:41
Average standard deviation of split frequencies: 0.014054
315500 -- (-289.511) [-292.128] (-288.097) (-290.894) * [-288.753] (-289.087) (-288.006) (-288.460) -- 0:00:41
316000 -- (-291.073) (-292.931) (-287.687) [-292.273] * (-287.621) (-289.313) [-290.082] (-289.107) -- 0:00:41
316500 -- (-287.147) [-292.813] (-289.198) (-291.051) * (-289.834) (-291.011) (-298.504) [-291.615] -- 0:00:41
317000 -- (-287.957) [-288.631] (-288.732) (-292.568) * (-288.222) [-289.416] (-288.385) (-288.115) -- 0:00:40
317500 -- (-289.466) (-290.713) (-291.993) [-289.232] * (-289.514) (-288.941) [-290.618] (-287.553) -- 0:00:40
318000 -- [-289.077] (-290.081) (-290.003) (-288.753) * [-290.680] (-288.961) (-292.119) (-289.102) -- 0:00:40
318500 -- [-288.067] (-296.945) (-289.828) (-291.166) * [-289.512] (-293.442) (-293.831) (-289.032) -- 0:00:40
319000 -- (-291.566) [-290.407] (-289.054) (-293.115) * (-290.145) (-294.629) (-290.214) [-289.839] -- 0:00:40
319500 -- [-292.460] (-291.293) (-290.758) (-292.923) * (-290.252) (-291.074) (-291.944) [-288.200] -- 0:00:40
320000 -- (-287.249) (-287.383) [-290.127] (-288.113) * (-292.738) (-289.243) (-288.974) [-287.450] -- 0:00:40
Average standard deviation of split frequencies: 0.012577
320500 -- (-289.203) (-289.876) (-294.329) [-289.102] * (-292.424) (-291.499) [-289.126] (-288.254) -- 0:00:40
321000 -- (-289.972) [-288.991] (-291.098) (-287.530) * [-289.597] (-293.119) (-293.682) (-288.618) -- 0:00:40
321500 -- (-292.293) (-291.175) (-288.064) [-290.499] * (-289.236) [-290.220] (-287.810) (-291.293) -- 0:00:40
322000 -- [-289.700] (-290.105) (-289.208) (-293.595) * (-288.825) (-290.487) [-287.826] (-289.278) -- 0:00:40
322500 -- (-289.096) (-289.856) [-289.812] (-291.619) * [-287.895] (-289.137) (-288.840) (-288.343) -- 0:00:39
323000 -- (-287.992) [-288.303] (-289.297) (-289.596) * (-287.949) [-288.930] (-289.868) (-287.880) -- 0:00:39
323500 -- (-289.506) (-290.403) [-289.742] (-290.589) * (-287.678) (-288.472) [-289.207] (-289.437) -- 0:00:39
324000 -- (-289.554) (-288.380) [-288.687] (-288.603) * [-288.457] (-289.419) (-289.293) (-295.294) -- 0:00:39
324500 -- (-288.666) [-288.063] (-291.946) (-289.183) * (-289.326) (-293.717) (-287.749) [-291.299] -- 0:00:39
325000 -- (-290.301) (-296.484) [-296.076] (-290.773) * [-290.190] (-288.504) (-288.496) (-291.693) -- 0:00:39
Average standard deviation of split frequencies: 0.012131
325500 -- (-289.169) [-289.226] (-295.764) (-289.294) * [-289.985] (-290.021) (-292.379) (-287.513) -- 0:00:39
326000 -- (-289.988) (-288.302) (-288.644) [-290.879] * (-290.434) (-290.526) [-289.224] (-289.604) -- 0:00:39
326500 -- (-289.979) (-291.554) (-288.713) [-288.203] * (-289.905) (-288.460) (-291.116) [-287.159] -- 0:00:39
327000 -- (-291.708) [-287.772] (-294.939) (-288.364) * (-291.815) (-289.169) (-291.286) [-293.066] -- 0:00:39
327500 -- (-291.878) (-290.570) [-289.434] (-289.301) * (-288.940) (-291.760) [-290.100] (-297.000) -- 0:00:39
328000 -- (-289.035) [-289.246] (-290.896) (-289.754) * [-288.507] (-292.776) (-290.428) (-298.349) -- 0:00:38
328500 -- [-288.625] (-291.210) (-291.822) (-288.934) * [-288.100] (-291.457) (-291.810) (-293.688) -- 0:00:38
329000 -- (-289.193) [-291.098] (-290.379) (-288.413) * (-288.864) (-291.865) (-290.756) [-290.923] -- 0:00:38
329500 -- (-289.677) (-290.925) (-289.662) [-287.795] * [-291.711] (-293.307) (-292.489) (-289.065) -- 0:00:38
330000 -- (-288.143) (-290.815) (-290.254) [-288.606] * [-290.648] (-291.532) (-291.514) (-288.054) -- 0:00:38
Average standard deviation of split frequencies: 0.013334
330500 -- (-290.182) (-289.057) [-291.202] (-288.330) * (-291.689) [-289.300] (-291.815) (-287.935) -- 0:00:38
331000 -- (-287.941) (-289.186) [-288.655] (-290.206) * (-291.636) [-288.942] (-288.746) (-288.304) -- 0:00:38
331500 -- (-291.273) [-290.082] (-289.168) (-287.956) * [-292.313] (-292.193) (-291.427) (-290.273) -- 0:00:38
332000 -- (-292.876) (-289.964) (-289.579) [-288.688] * (-298.677) [-288.034] (-291.561) (-289.516) -- 0:00:40
332500 -- (-287.970) (-290.802) [-288.971] (-289.328) * (-291.811) (-291.613) [-291.135] (-288.281) -- 0:00:40
333000 -- [-290.403] (-290.327) (-293.726) (-287.550) * (-295.518) (-289.042) [-290.677] (-288.643) -- 0:00:40
333500 -- (-289.021) (-290.937) (-295.847) [-288.145] * (-293.896) (-290.168) [-288.286] (-294.258) -- 0:00:39
334000 -- [-289.278] (-287.381) (-292.028) (-288.443) * (-292.865) (-289.267) [-288.491] (-287.857) -- 0:00:39
334500 -- (-290.257) [-288.045] (-296.405) (-291.060) * (-293.682) (-288.559) [-290.200] (-288.506) -- 0:00:39
335000 -- (-293.913) [-287.708] (-289.010) (-289.835) * (-287.960) [-287.540] (-287.697) (-288.980) -- 0:00:39
Average standard deviation of split frequencies: 0.013370
335500 -- (-290.555) [-288.951] (-288.696) (-288.021) * (-288.076) [-288.115] (-287.734) (-288.144) -- 0:00:39
336000 -- [-287.751] (-289.301) (-291.332) (-292.704) * [-288.799] (-290.427) (-290.630) (-289.295) -- 0:00:39
336500 -- (-288.366) (-296.202) (-289.404) [-288.562] * (-291.453) [-288.002] (-290.035) (-289.489) -- 0:00:39
337000 -- [-288.208] (-294.879) (-291.214) (-289.264) * (-290.701) [-288.081] (-290.884) (-289.149) -- 0:00:39
337500 -- (-288.784) [-290.579] (-290.094) (-293.097) * (-289.293) (-288.147) [-290.665] (-289.041) -- 0:00:39
338000 -- (-294.701) [-287.404] (-291.443) (-290.273) * (-288.867) (-290.495) (-288.325) [-287.924] -- 0:00:39
338500 -- (-289.951) (-288.122) [-290.512] (-290.140) * (-287.661) (-288.698) (-289.316) [-288.856] -- 0:00:39
339000 -- [-288.224] (-294.251) (-291.559) (-290.805) * (-287.781) [-288.717] (-287.446) (-288.928) -- 0:00:38
339500 -- (-287.264) (-293.760) (-289.178) [-294.149] * (-290.773) (-289.822) (-288.294) [-288.971] -- 0:00:38
340000 -- (-289.595) (-292.948) [-289.661] (-291.715) * (-287.720) (-292.401) [-287.727] (-288.252) -- 0:00:38
Average standard deviation of split frequencies: 0.012617
340500 -- [-287.586] (-291.306) (-289.369) (-287.555) * (-288.420) [-289.328] (-290.468) (-290.637) -- 0:00:38
341000 -- (-288.302) [-288.986] (-290.327) (-288.420) * [-292.384] (-289.137) (-293.170) (-290.870) -- 0:00:38
341500 -- (-288.905) [-288.861] (-289.672) (-288.920) * [-291.979] (-288.986) (-291.394) (-289.875) -- 0:00:38
342000 -- (-291.673) [-288.360] (-289.251) (-289.318) * (-288.367) [-290.284] (-292.046) (-289.772) -- 0:00:38
342500 -- (-287.442) (-287.925) [-289.685] (-289.859) * (-291.654) (-292.411) [-290.490] (-295.397) -- 0:00:38
343000 -- (-291.717) (-290.634) (-287.723) [-288.509] * (-291.904) (-289.151) (-292.085) [-292.143] -- 0:00:38
343500 -- (-290.037) (-291.943) (-288.253) [-288.953] * (-289.429) [-290.872] (-290.621) (-288.880) -- 0:00:38
344000 -- (-288.082) (-292.040) [-290.348] (-288.908) * (-289.232) [-288.698] (-290.558) (-288.501) -- 0:00:38
344500 -- (-288.878) (-290.584) [-292.772] (-288.645) * (-289.470) [-288.389] (-289.535) (-288.015) -- 0:00:38
345000 -- (-289.480) [-288.851] (-289.838) (-288.338) * (-288.895) (-290.614) [-288.393] (-288.210) -- 0:00:37
Average standard deviation of split frequencies: 0.012182
345500 -- [-289.333] (-293.734) (-290.444) (-288.422) * (-289.369) [-290.340] (-290.223) (-290.559) -- 0:00:37
346000 -- (-296.973) (-288.136) (-292.059) [-291.375] * (-290.550) (-288.669) [-289.343] (-289.125) -- 0:00:37
346500 -- (-291.205) (-287.719) [-290.483] (-289.161) * (-289.990) (-293.492) [-288.781] (-290.188) -- 0:00:37
347000 -- (-288.342) (-290.694) [-288.901] (-290.643) * [-290.120] (-296.467) (-291.583) (-290.401) -- 0:00:37
347500 -- (-290.701) [-288.538] (-288.956) (-289.006) * (-287.862) [-287.663] (-290.870) (-291.738) -- 0:00:37
348000 -- (-290.080) (-287.693) (-291.844) [-289.837] * [-288.482] (-287.801) (-287.891) (-294.451) -- 0:00:37
348500 -- (-288.477) (-289.648) (-289.974) [-288.665] * (-290.846) (-291.085) [-291.401] (-290.615) -- 0:00:37
349000 -- [-292.817] (-287.683) (-290.293) (-288.151) * (-291.092) [-292.372] (-292.019) (-290.561) -- 0:00:37
349500 -- (-289.441) (-296.660) (-291.102) [-288.192] * [-291.440] (-288.756) (-289.221) (-287.801) -- 0:00:39
350000 -- (-291.062) (-288.914) [-291.876] (-288.196) * (-289.537) (-289.591) [-292.534] (-288.657) -- 0:00:39
Average standard deviation of split frequencies: 0.012020
350500 -- (-289.560) [-289.025] (-287.922) (-288.337) * (-294.166) (-289.427) (-291.099) [-288.950] -- 0:00:38
351000 -- (-289.933) [-289.503] (-288.776) (-290.669) * [-289.242] (-290.395) (-290.017) (-290.679) -- 0:00:38
351500 -- (-289.793) (-291.390) [-288.580] (-288.367) * (-287.257) [-288.978] (-289.946) (-289.263) -- 0:00:38
352000 -- [-287.700] (-288.097) (-288.528) (-287.501) * (-288.596) (-288.734) [-290.976] (-288.499) -- 0:00:38
352500 -- [-289.800] (-289.737) (-289.234) (-292.015) * (-287.683) (-288.774) (-289.335) [-289.241] -- 0:00:38
353000 -- (-290.394) (-294.629) [-288.268] (-289.156) * (-288.363) (-288.128) (-288.942) [-290.010] -- 0:00:38
353500 -- (-291.058) (-297.581) [-288.609] (-290.427) * (-290.411) (-292.232) (-293.981) [-288.779] -- 0:00:38
354000 -- [-290.328] (-294.110) (-290.584) (-289.578) * (-293.993) (-288.294) [-292.408] (-287.975) -- 0:00:38
354500 -- (-288.129) (-290.006) [-288.456] (-289.097) * (-290.713) [-288.009] (-291.748) (-291.153) -- 0:00:38
355000 -- (-290.087) (-293.773) [-287.184] (-291.220) * [-294.590] (-288.895) (-288.139) (-290.262) -- 0:00:38
Average standard deviation of split frequencies: 0.013242
355500 -- [-289.124] (-288.523) (-290.714) (-289.099) * (-290.863) [-287.971] (-288.909) (-288.870) -- 0:00:38
356000 -- (-287.725) (-290.006) (-287.195) [-289.145] * (-296.217) (-291.809) [-295.696] (-288.900) -- 0:00:37
356500 -- (-287.746) (-297.015) (-288.080) [-288.513] * (-291.670) (-289.754) (-292.663) [-290.600] -- 0:00:37
357000 -- [-289.804] (-290.251) (-289.119) (-292.587) * (-289.934) (-288.016) (-290.233) [-288.387] -- 0:00:37
357500 -- [-288.517] (-289.097) (-288.372) (-290.650) * [-288.363] (-288.618) (-291.707) (-289.548) -- 0:00:37
358000 -- [-288.405] (-297.259) (-290.321) (-290.798) * (-290.346) (-287.965) (-291.483) [-290.726] -- 0:00:37
358500 -- (-289.627) (-289.823) (-288.227) [-288.715] * [-291.348] (-288.461) (-289.800) (-293.237) -- 0:00:37
359000 -- (-288.497) (-290.118) [-290.696] (-290.723) * [-290.964] (-289.110) (-290.285) (-293.553) -- 0:00:37
359500 -- [-292.597] (-292.221) (-291.454) (-290.548) * (-288.458) [-287.829] (-289.756) (-288.508) -- 0:00:37
360000 -- (-288.515) (-292.407) [-288.613] (-291.345) * (-287.730) (-289.477) [-290.424] (-291.983) -- 0:00:37
Average standard deviation of split frequencies: 0.012378
360500 -- [-289.780] (-290.371) (-289.222) (-287.476) * (-288.815) (-292.548) [-289.187] (-289.492) -- 0:00:37
361000 -- (-291.859) (-289.056) (-291.247) [-288.263] * (-287.597) (-288.874) (-294.317) [-288.768] -- 0:00:37
361500 -- [-289.734] (-289.330) (-288.518) (-291.158) * (-291.490) (-291.855) [-288.667] (-287.611) -- 0:00:37
362000 -- (-288.301) (-292.226) [-287.820] (-292.932) * (-289.407) (-289.361) [-287.829] (-287.270) -- 0:00:37
362500 -- [-288.663] (-290.575) (-289.878) (-292.092) * (-289.369) (-288.479) (-290.633) [-287.793] -- 0:00:36
363000 -- (-288.185) [-292.752] (-289.369) (-292.567) * (-288.341) (-287.883) [-289.195] (-291.178) -- 0:00:36
363500 -- (-287.611) (-292.111) (-288.000) [-295.978] * [-289.286] (-287.645) (-287.976) (-292.078) -- 0:00:36
364000 -- (-288.610) [-291.887] (-288.796) (-288.084) * [-291.672] (-290.110) (-290.816) (-290.547) -- 0:00:36
364500 -- (-289.408) [-289.115] (-288.155) (-290.230) * (-290.363) (-287.976) [-289.969] (-290.072) -- 0:00:36
365000 -- (-292.751) (-289.368) (-290.956) [-290.932] * [-288.998] (-291.032) (-287.352) (-289.138) -- 0:00:36
Average standard deviation of split frequencies: 0.012122
365500 -- [-289.274] (-289.947) (-288.483) (-290.356) * [-287.981] (-289.120) (-290.002) (-289.879) -- 0:00:36
366000 -- (-289.476) [-290.038] (-291.351) (-290.169) * (-288.849) (-290.174) (-290.830) [-292.612] -- 0:00:36
366500 -- [-290.270] (-288.348) (-289.567) (-296.183) * (-290.752) (-291.608) (-289.948) [-288.061] -- 0:00:36
367000 -- [-290.139] (-288.775) (-288.443) (-291.163) * [-290.919] (-289.144) (-291.516) (-289.102) -- 0:00:37
367500 -- (-290.452) [-290.224] (-288.833) (-295.485) * (-288.006) [-290.760] (-288.975) (-288.661) -- 0:00:37
368000 -- (-291.417) (-289.051) (-290.856) [-290.190] * [-289.400] (-292.351) (-289.985) (-288.816) -- 0:00:37
368500 -- (-290.058) (-290.387) [-289.164] (-289.712) * (-291.014) [-289.014] (-293.698) (-291.087) -- 0:00:37
369000 -- (-288.630) [-291.491] (-290.444) (-289.703) * (-297.012) (-290.796) [-289.933] (-289.869) -- 0:00:37
369500 -- (-289.599) (-289.697) [-291.760] (-287.905) * [-294.852] (-287.970) (-289.267) (-291.258) -- 0:00:37
370000 -- [-287.832] (-292.921) (-289.196) (-291.553) * (-288.837) (-288.983) [-289.790] (-295.423) -- 0:00:37
Average standard deviation of split frequencies: 0.011745
370500 -- (-288.886) (-288.696) [-289.348] (-289.426) * [-287.664] (-291.674) (-288.506) (-291.339) -- 0:00:37
371000 -- (-293.580) (-288.735) [-290.140] (-288.082) * (-289.108) (-290.869) [-287.982] (-288.509) -- 0:00:37
371500 -- (-292.315) (-287.507) (-292.847) [-287.993] * (-288.222) [-288.367] (-288.482) (-289.984) -- 0:00:37
372000 -- [-287.965] (-291.290) (-288.583) (-289.124) * (-289.529) [-288.122] (-289.690) (-289.303) -- 0:00:37
372500 -- (-293.602) [-288.414] (-287.648) (-288.420) * (-288.563) (-291.015) (-291.433) [-290.736] -- 0:00:37
373000 -- (-288.766) (-287.796) (-289.086) [-288.203] * (-288.601) (-288.937) (-288.892) [-292.357] -- 0:00:36
373500 -- (-289.698) [-289.585] (-289.961) (-289.241) * (-289.659) (-289.351) (-288.784) [-290.425] -- 0:00:36
374000 -- (-290.996) (-289.212) [-289.108] (-287.673) * [-295.306] (-289.022) (-291.205) (-288.496) -- 0:00:36
374500 -- (-291.227) [-290.745] (-288.651) (-288.061) * (-289.152) (-287.669) [-287.560] (-290.023) -- 0:00:36
375000 -- [-288.816] (-289.606) (-287.183) (-291.147) * (-289.486) (-289.151) (-290.596) [-289.098] -- 0:00:36
Average standard deviation of split frequencies: 0.011431
375500 -- [-288.138] (-289.679) (-289.677) (-293.384) * (-289.581) (-287.769) (-289.031) [-292.930] -- 0:00:36
376000 -- (-287.409) (-290.534) (-290.038) [-289.761] * (-289.198) [-287.987] (-291.702) (-290.074) -- 0:00:36
376500 -- (-288.858) (-288.753) [-290.074] (-291.159) * (-290.963) (-291.418) (-289.856) [-287.830] -- 0:00:36
377000 -- (-293.857) [-288.667] (-290.248) (-288.796) * (-288.583) (-290.014) [-287.307] (-288.866) -- 0:00:36
377500 -- [-292.088] (-291.831) (-288.265) (-290.321) * [-290.553] (-289.869) (-288.712) (-290.544) -- 0:00:36
378000 -- (-292.038) (-290.572) (-288.572) [-291.535] * (-290.891) [-289.705] (-288.955) (-288.017) -- 0:00:36
378500 -- (-291.238) (-290.200) [-288.986] (-291.931) * (-290.717) (-288.024) (-288.736) [-288.083] -- 0:00:36
379000 -- (-289.074) [-287.421] (-290.296) (-290.174) * (-290.498) (-289.945) [-289.001] (-287.582) -- 0:00:36
379500 -- (-289.709) (-294.191) [-287.780] (-289.327) * [-292.724] (-288.022) (-293.340) (-288.104) -- 0:00:35
380000 -- [-289.725] (-290.026) (-289.286) (-290.271) * (-291.920) [-290.887] (-290.285) (-291.289) -- 0:00:35
Average standard deviation of split frequencies: 0.012311
380500 -- (-295.519) (-293.598) [-292.607] (-290.859) * (-294.551) (-295.317) [-288.914] (-289.209) -- 0:00:35
381000 -- (-290.935) (-294.899) (-292.436) [-292.078] * (-287.309) [-292.531] (-291.540) (-288.678) -- 0:00:35
381500 -- (-293.731) (-291.554) (-291.617) [-289.560] * [-289.649] (-290.295) (-287.839) (-291.127) -- 0:00:35
382000 -- (-289.556) (-291.521) [-288.401] (-291.114) * (-291.590) [-288.946] (-291.561) (-291.655) -- 0:00:35
382500 -- [-294.132] (-287.804) (-289.149) (-290.906) * (-287.699) [-288.050] (-289.223) (-297.140) -- 0:00:35
383000 -- (-289.422) [-288.438] (-295.948) (-289.670) * (-287.866) (-288.106) [-288.914] (-296.011) -- 0:00:35
383500 -- [-289.606] (-296.881) (-288.687) (-290.618) * (-293.205) (-287.997) [-291.065] (-291.236) -- 0:00:35
384000 -- [-288.993] (-288.109) (-287.558) (-289.620) * (-292.054) (-287.593) [-288.211] (-289.290) -- 0:00:35
384500 -- (-289.401) (-291.026) [-288.469] (-294.387) * (-288.920) [-289.992] (-291.903) (-291.747) -- 0:00:36
385000 -- (-290.110) (-290.855) [-290.238] (-288.871) * (-287.272) (-291.027) (-291.090) [-289.933] -- 0:00:36
Average standard deviation of split frequencies: 0.012428
385500 -- (-289.113) (-289.684) (-292.239) [-290.454] * [-289.194] (-290.104) (-288.406) (-288.449) -- 0:00:36
386000 -- (-287.648) (-293.425) [-288.547] (-288.728) * (-288.478) [-289.119] (-288.716) (-288.145) -- 0:00:36
386500 -- (-290.984) (-287.782) [-289.423] (-289.491) * (-291.387) (-288.982) [-292.432] (-288.928) -- 0:00:36
387000 -- (-289.161) (-290.629) [-288.312] (-289.926) * (-289.035) (-289.902) (-298.076) [-288.203] -- 0:00:36
387500 -- (-288.227) (-289.491) [-288.664] (-289.737) * (-291.186) [-289.750] (-293.139) (-291.447) -- 0:00:36
388000 -- (-289.666) (-289.922) [-287.885] (-290.747) * (-288.045) [-287.952] (-290.540) (-288.434) -- 0:00:36
388500 -- (-290.570) [-288.665] (-291.686) (-288.452) * (-289.008) (-289.174) [-292.616] (-295.092) -- 0:00:36
389000 -- (-289.511) (-289.519) [-291.125] (-288.083) * (-288.599) (-290.512) (-289.708) [-287.644] -- 0:00:36
389500 -- (-287.634) (-290.498) [-290.551] (-290.988) * (-289.954) [-289.540] (-289.607) (-289.352) -- 0:00:36
390000 -- (-287.124) (-288.082) (-287.926) [-288.438] * (-290.751) (-292.042) (-291.892) [-288.091] -- 0:00:35
Average standard deviation of split frequencies: 0.012280
390500 -- (-289.028) (-290.423) [-288.776] (-288.004) * (-288.389) (-289.667) (-292.224) [-288.719] -- 0:00:35
391000 -- (-289.239) [-289.946] (-292.370) (-288.031) * (-289.679) (-288.749) (-297.015) [-288.703] -- 0:00:35
391500 -- (-288.978) (-289.051) [-289.809] (-289.200) * [-287.985] (-291.922) (-293.899) (-290.602) -- 0:00:35
392000 -- (-287.338) (-294.419) [-290.623] (-291.542) * (-289.324) (-292.575) [-289.523] (-287.850) -- 0:00:35
392500 -- (-291.708) (-288.473) (-288.105) [-288.302] * [-290.043] (-289.409) (-290.830) (-289.145) -- 0:00:35
393000 -- [-293.066] (-288.245) (-287.225) (-290.191) * (-289.236) [-291.970] (-290.799) (-289.627) -- 0:00:35
393500 -- (-288.438) (-289.260) (-287.870) [-288.981] * (-290.463) [-288.963] (-288.199) (-293.431) -- 0:00:35
394000 -- (-292.255) (-290.913) (-292.485) [-288.714] * [-289.292] (-294.282) (-290.590) (-288.193) -- 0:00:35
394500 -- (-291.465) (-291.374) [-289.623] (-288.783) * [-297.975] (-292.908) (-290.060) (-288.715) -- 0:00:35
395000 -- (-287.486) (-290.535) (-293.792) [-288.490] * (-287.916) [-290.005] (-293.285) (-291.616) -- 0:00:35
Average standard deviation of split frequencies: 0.012254
395500 -- (-289.241) (-287.770) (-289.094) [-290.098] * (-287.998) (-291.022) (-288.335) [-289.177] -- 0:00:35
396000 -- (-288.570) (-291.160) (-287.541) [-290.046] * (-288.766) [-290.288] (-288.722) (-289.925) -- 0:00:35
396500 -- (-289.537) (-294.448) (-289.059) [-288.888] * [-292.985] (-291.223) (-288.613) (-287.720) -- 0:00:35
397000 -- (-288.314) [-290.704] (-291.898) (-287.668) * (-290.740) [-289.774] (-289.749) (-287.424) -- 0:00:34
397500 -- (-293.229) [-291.407] (-289.137) (-287.439) * (-289.408) (-289.489) (-293.733) [-290.457] -- 0:00:34
398000 -- (-296.818) (-289.184) [-293.548] (-290.549) * [-288.745] (-288.907) (-288.663) (-288.158) -- 0:00:34
398500 -- (-290.421) (-290.757) [-289.958] (-291.890) * (-288.669) [-288.629] (-290.578) (-290.841) -- 0:00:34
399000 -- (-290.646) [-289.371] (-288.258) (-290.387) * (-287.961) (-288.726) [-292.701] (-288.027) -- 0:00:34
399500 -- [-290.080] (-288.915) (-292.814) (-294.583) * (-288.871) (-287.818) (-287.776) [-287.815] -- 0:00:34
400000 -- (-291.703) [-289.740] (-288.083) (-290.478) * (-287.889) (-288.211) [-289.164] (-288.097) -- 0:00:34
Average standard deviation of split frequencies: 0.012665
400500 -- (-289.219) (-288.999) (-289.169) [-287.591] * (-288.069) (-288.820) [-290.200] (-290.004) -- 0:00:34
401000 -- (-289.177) (-288.118) (-290.947) [-290.952] * (-289.379) (-288.726) (-288.392) [-289.571] -- 0:00:34
401500 -- (-292.269) [-288.255] (-288.189) (-290.822) * (-290.908) [-291.392] (-291.166) (-289.596) -- 0:00:35
402000 -- (-288.687) (-289.410) [-291.315] (-288.657) * (-289.873) (-292.371) (-288.833) [-290.246] -- 0:00:35
402500 -- (-288.117) (-292.575) [-292.976] (-292.453) * (-288.346) (-293.822) (-288.433) [-290.159] -- 0:00:35
403000 -- (-290.549) (-289.791) [-289.961] (-291.756) * [-289.642] (-292.094) (-287.830) (-291.777) -- 0:00:35
403500 -- (-295.370) [-288.910] (-291.859) (-290.058) * (-289.706) (-288.156) (-287.488) [-289.862] -- 0:00:35
404000 -- (-291.856) (-288.031) [-290.119] (-288.871) * [-288.755] (-288.542) (-288.022) (-290.667) -- 0:00:35
404500 -- [-288.556] (-291.039) (-289.426) (-288.483) * [-290.981] (-289.569) (-289.840) (-289.525) -- 0:00:35
405000 -- (-293.208) [-289.897] (-287.453) (-290.438) * (-290.382) (-288.288) (-288.813) [-288.515] -- 0:00:35
Average standard deviation of split frequencies: 0.012256
405500 -- (-289.980) (-289.550) [-290.677] (-289.791) * (-290.638) [-288.878] (-289.757) (-288.472) -- 0:00:35
406000 -- [-288.666] (-289.769) (-288.517) (-291.444) * (-293.784) (-288.847) [-288.342] (-289.641) -- 0:00:35
406500 -- (-294.701) (-289.423) [-288.943] (-287.856) * (-291.528) (-288.822) [-288.465] (-288.795) -- 0:00:35
407000 -- (-290.204) (-289.121) [-288.102] (-287.579) * (-289.446) (-289.592) [-289.915] (-288.898) -- 0:00:34
407500 -- (-289.810) (-292.001) [-288.838] (-293.051) * (-289.280) [-290.223] (-290.010) (-288.599) -- 0:00:34
408000 -- [-291.655] (-292.017) (-287.350) (-291.847) * (-290.243) (-288.332) (-291.544) [-291.705] -- 0:00:34
408500 -- (-289.463) (-287.543) [-291.009] (-290.982) * (-291.086) (-290.680) [-288.567] (-287.955) -- 0:00:34
409000 -- [-289.452] (-290.262) (-290.545) (-290.019) * (-288.953) (-288.701) [-290.220] (-288.257) -- 0:00:34
409500 -- [-290.029] (-289.505) (-288.024) (-287.797) * (-288.029) (-288.500) [-288.486] (-290.553) -- 0:00:34
410000 -- [-288.322] (-289.042) (-289.800) (-289.399) * [-288.714] (-288.353) (-288.592) (-289.507) -- 0:00:34
Average standard deviation of split frequencies: 0.011989
410500 -- (-287.352) (-289.143) (-289.265) [-289.281] * (-288.672) (-291.418) [-289.132] (-288.525) -- 0:00:34
411000 -- (-288.864) (-296.386) (-287.709) [-289.976] * (-291.011) (-289.616) [-289.564] (-290.938) -- 0:00:34
411500 -- (-289.003) (-293.646) [-289.700] (-291.755) * [-289.399] (-290.457) (-289.584) (-292.297) -- 0:00:34
412000 -- (-288.565) (-291.236) (-288.844) [-288.999] * [-287.790] (-289.125) (-289.876) (-294.078) -- 0:00:34
412500 -- (-289.683) [-292.068] (-294.037) (-289.613) * [-289.417] (-287.453) (-292.721) (-290.653) -- 0:00:34
413000 -- [-290.444] (-289.825) (-292.890) (-292.065) * [-289.103] (-291.013) (-289.475) (-291.580) -- 0:00:34
413500 -- (-289.717) [-290.621] (-295.310) (-289.084) * [-288.142] (-289.282) (-289.418) (-293.109) -- 0:00:34
414000 -- (-288.166) (-287.132) [-293.922] (-295.375) * [-289.476] (-291.127) (-291.362) (-291.387) -- 0:00:33
414500 -- (-292.615) [-289.604] (-293.503) (-290.339) * (-290.372) (-289.702) (-288.095) [-289.941] -- 0:00:33
415000 -- (-288.859) (-292.362) [-291.183] (-297.417) * (-287.276) (-289.164) [-291.611] (-290.342) -- 0:00:33
Average standard deviation of split frequencies: 0.012065
415500 -- (-287.962) [-289.428] (-290.565) (-287.971) * (-289.580) (-288.743) (-288.081) [-288.773] -- 0:00:33
416000 -- (-288.766) [-289.276] (-288.127) (-294.918) * (-289.050) (-289.610) (-289.252) [-288.895] -- 0:00:33
416500 -- (-289.862) (-287.964) (-290.416) [-289.425] * (-288.697) [-287.631] (-289.624) (-291.644) -- 0:00:33
417000 -- [-287.759] (-289.294) (-290.652) (-290.282) * (-289.816) [-288.615] (-289.674) (-287.749) -- 0:00:33
417500 -- (-287.838) [-289.489] (-290.869) (-290.731) * (-288.821) [-292.081] (-291.381) (-287.406) -- 0:00:33
418000 -- (-288.422) (-290.789) (-291.151) [-288.425] * (-287.733) (-289.773) [-294.268] (-291.705) -- 0:00:33
418500 -- (-288.258) (-287.748) [-292.571] (-288.868) * [-287.417] (-288.578) (-289.744) (-290.294) -- 0:00:34
419000 -- (-291.923) (-289.273) (-290.300) [-289.181] * (-288.771) [-287.944] (-291.451) (-288.072) -- 0:00:34
419500 -- (-289.254) [-289.159] (-288.615) (-292.235) * [-287.347] (-288.016) (-291.173) (-287.636) -- 0:00:34
420000 -- (-288.347) [-289.488] (-288.147) (-288.946) * [-287.862] (-290.914) (-288.258) (-288.663) -- 0:00:34
Average standard deviation of split frequencies: 0.011931
420500 -- (-289.036) [-288.367] (-292.056) (-288.206) * [-288.474] (-290.001) (-289.821) (-289.140) -- 0:00:34
421000 -- (-289.561) (-289.831) (-290.188) [-289.333] * [-291.897] (-291.435) (-291.227) (-290.533) -- 0:00:34
421500 -- (-291.973) [-288.276] (-290.919) (-291.759) * (-296.013) (-291.490) [-292.102] (-292.155) -- 0:00:34
422000 -- (-287.784) (-289.675) (-289.362) [-291.200] * [-294.570] (-290.347) (-290.330) (-288.369) -- 0:00:34
422500 -- (-290.349) (-292.840) (-291.184) [-288.552] * [-289.295] (-289.105) (-290.457) (-289.526) -- 0:00:34
423000 -- (-289.665) [-289.529] (-288.170) (-288.490) * [-289.359] (-291.319) (-289.352) (-289.946) -- 0:00:34
423500 -- [-289.383] (-288.778) (-288.074) (-289.755) * [-288.721] (-292.742) (-288.192) (-294.739) -- 0:00:34
424000 -- [-292.614] (-288.650) (-290.077) (-290.107) * [-289.518] (-288.754) (-291.613) (-291.548) -- 0:00:33
424500 -- (-289.506) (-290.502) (-290.742) [-288.169] * (-290.104) (-287.996) [-289.372] (-287.948) -- 0:00:33
425000 -- (-288.743) (-291.198) (-290.336) [-290.120] * [-289.499] (-288.253) (-288.549) (-292.533) -- 0:00:33
Average standard deviation of split frequencies: 0.012303
425500 -- (-289.425) (-289.364) (-288.309) [-288.349] * (-290.673) (-288.496) [-292.823] (-288.818) -- 0:00:33
426000 -- (-290.084) (-287.629) (-289.551) [-289.026] * (-291.056) (-289.025) [-291.193] (-289.114) -- 0:00:33
426500 -- [-288.643] (-290.301) (-289.776) (-292.286) * [-288.446] (-288.434) (-288.614) (-289.322) -- 0:00:33
427000 -- (-288.667) [-287.614] (-292.504) (-290.617) * (-288.967) (-289.022) (-287.550) [-288.572] -- 0:00:33
427500 -- [-288.185] (-288.908) (-288.795) (-290.154) * (-289.438) (-288.116) [-290.434] (-290.160) -- 0:00:33
428000 -- [-287.333] (-289.485) (-291.030) (-288.305) * [-287.979] (-288.542) (-288.067) (-289.502) -- 0:00:33
428500 -- (-290.372) [-292.603] (-290.010) (-294.120) * (-288.728) [-288.278] (-291.755) (-288.717) -- 0:00:33
429000 -- [-289.935] (-288.911) (-288.947) (-290.504) * [-289.933] (-289.543) (-294.008) (-289.817) -- 0:00:33
429500 -- (-289.458) (-289.076) [-288.133] (-287.607) * (-290.838) [-293.257] (-290.685) (-288.750) -- 0:00:33
430000 -- (-292.415) (-288.721) (-291.658) [-288.129] * (-288.124) [-288.323] (-290.732) (-287.811) -- 0:00:33
Average standard deviation of split frequencies: 0.012383
430500 -- (-290.854) [-290.730] (-290.899) (-288.295) * [-288.022] (-289.149) (-289.728) (-293.165) -- 0:00:33
431000 -- [-289.424] (-288.307) (-292.734) (-287.909) * [-288.656] (-287.802) (-288.278) (-289.180) -- 0:00:33
431500 -- [-288.903] (-288.506) (-290.426) (-287.754) * [-288.434] (-288.424) (-290.677) (-289.215) -- 0:00:32
432000 -- [-287.751] (-289.903) (-289.207) (-289.838) * (-289.361) (-289.764) [-288.275] (-288.252) -- 0:00:32
432500 -- [-287.727] (-288.362) (-288.384) (-288.475) * (-287.901) (-289.593) (-289.616) [-290.920] -- 0:00:32
433000 -- (-287.818) (-291.449) (-288.822) [-290.460] * (-289.993) (-290.149) [-289.797] (-289.548) -- 0:00:32
433500 -- [-288.910] (-290.535) (-291.145) (-291.994) * [-287.213] (-290.460) (-290.365) (-287.791) -- 0:00:32
434000 -- (-288.287) (-289.760) [-291.206] (-294.004) * [-289.737] (-291.491) (-288.282) (-289.341) -- 0:00:32
434500 -- (-289.929) (-292.337) [-288.407] (-293.893) * (-287.709) [-291.002] (-291.236) (-288.511) -- 0:00:32
435000 -- [-288.844] (-288.316) (-291.457) (-292.640) * (-293.471) [-289.658] (-290.562) (-288.327) -- 0:00:32
Average standard deviation of split frequencies: 0.012164
435500 -- (-288.415) [-287.743] (-291.151) (-288.258) * (-289.418) (-289.963) (-288.913) [-288.186] -- 0:00:32
436000 -- (-288.470) [-287.224] (-288.649) (-289.613) * [-289.197] (-289.653) (-288.514) (-287.683) -- 0:00:33
436500 -- (-292.411) [-288.920] (-290.312) (-293.673) * (-288.313) (-288.066) [-289.608] (-289.561) -- 0:00:33
437000 -- [-290.056] (-288.249) (-290.889) (-287.700) * (-290.092) [-289.370] (-289.764) (-287.842) -- 0:00:33
437500 -- [-288.114] (-288.126) (-290.397) (-288.769) * [-288.517] (-290.235) (-289.160) (-288.079) -- 0:00:33
438000 -- (-288.461) (-292.229) (-288.979) [-290.311] * (-290.327) [-288.155] (-292.660) (-291.300) -- 0:00:33
438500 -- [-290.302] (-291.018) (-288.359) (-289.622) * [-289.471] (-289.638) (-293.186) (-292.501) -- 0:00:33
439000 -- [-290.734] (-289.898) (-289.127) (-287.586) * (-290.400) (-287.930) [-288.911] (-288.161) -- 0:00:33
439500 -- [-288.633] (-288.654) (-287.873) (-289.142) * (-290.581) (-289.289) [-288.587] (-290.796) -- 0:00:33
440000 -- (-288.512) (-288.965) [-293.504] (-289.391) * (-289.068) (-291.315) [-288.534] (-290.973) -- 0:00:33
Average standard deviation of split frequencies: 0.012235
440500 -- (-289.473) [-288.700] (-296.230) (-291.916) * (-292.093) (-288.077) [-292.569] (-290.563) -- 0:00:33
441000 -- (-289.245) (-288.330) [-288.367] (-291.544) * (-288.853) (-288.690) (-291.582) [-288.165] -- 0:00:32
441500 -- (-293.358) [-289.911] (-290.179) (-291.529) * (-290.443) (-288.265) (-292.640) [-288.417] -- 0:00:32
442000 -- (-289.436) [-290.376] (-290.272) (-287.800) * (-289.126) (-292.511) [-289.373] (-290.064) -- 0:00:32
442500 -- [-289.312] (-290.999) (-294.073) (-289.934) * (-287.818) (-290.472) [-290.145] (-292.591) -- 0:00:32
443000 -- (-292.652) [-289.118] (-292.456) (-290.867) * (-287.785) [-288.408] (-289.501) (-290.568) -- 0:00:32
443500 -- (-295.820) (-289.229) [-291.504] (-287.823) * [-291.631] (-288.554) (-290.911) (-292.486) -- 0:00:32
444000 -- (-298.067) (-291.494) (-291.611) [-287.390] * [-288.228] (-288.676) (-289.828) (-289.984) -- 0:00:32
444500 -- (-290.061) [-289.808] (-291.343) (-289.515) * (-287.527) (-289.676) (-289.418) [-289.573] -- 0:00:32
445000 -- [-288.163] (-292.330) (-288.365) (-287.651) * (-288.136) (-288.255) (-288.769) [-290.226] -- 0:00:32
Average standard deviation of split frequencies: 0.011362
445500 -- (-288.271) (-288.754) (-292.621) [-290.920] * [-293.033] (-292.774) (-290.658) (-290.728) -- 0:00:32
446000 -- (-292.741) (-290.178) [-289.253] (-290.318) * (-290.973) (-288.552) [-289.336] (-291.326) -- 0:00:32
446500 -- (-289.492) (-292.662) [-291.199] (-290.609) * (-289.059) (-290.210) (-290.616) [-288.030] -- 0:00:32
447000 -- (-292.132) (-293.981) [-291.792] (-292.305) * (-289.072) (-291.644) [-289.373] (-289.044) -- 0:00:32
447500 -- (-290.694) (-291.258) (-288.381) [-289.580] * (-293.735) (-292.745) (-289.788) [-288.460] -- 0:00:32
448000 -- (-291.654) (-289.994) [-288.006] (-288.633) * [-290.225] (-288.770) (-289.000) (-291.214) -- 0:00:32
448500 -- (-288.820) (-289.673) (-288.251) [-288.881] * (-289.104) (-289.092) [-291.751] (-290.972) -- 0:00:31
449000 -- (-289.142) [-291.885] (-288.087) (-290.008) * [-288.108] (-289.521) (-291.281) (-288.756) -- 0:00:31
449500 -- (-290.059) (-288.312) [-287.577] (-291.156) * [-289.885] (-290.679) (-288.260) (-290.524) -- 0:00:31
450000 -- (-289.905) (-290.512) [-289.350] (-290.981) * (-290.559) (-291.479) [-290.676] (-287.706) -- 0:00:31
Average standard deviation of split frequencies: 0.011310
450500 -- (-288.942) (-289.691) (-290.157) [-290.498] * (-298.104) (-289.221) (-289.292) [-289.075] -- 0:00:31
451000 -- (-289.718) (-293.892) (-291.674) [-288.806] * (-292.511) [-289.397] (-288.337) (-287.866) -- 0:00:31
451500 -- (-289.705) (-290.444) (-289.859) [-288.005] * [-288.640] (-288.547) (-297.483) (-289.547) -- 0:00:31
452000 -- [-288.470] (-289.398) (-288.423) (-290.154) * (-294.230) (-289.671) (-288.774) [-289.061] -- 0:00:31
452500 -- (-287.501) (-294.022) (-289.585) [-287.504] * (-289.165) (-287.586) (-289.626) [-289.053] -- 0:00:31
453000 -- (-289.240) [-288.330] (-289.639) (-293.566) * (-288.739) (-288.029) [-291.112] (-288.942) -- 0:00:31
453500 -- (-290.513) (-291.713) [-287.782] (-289.497) * (-288.095) [-288.201] (-288.566) (-291.017) -- 0:00:32
454000 -- (-290.621) (-288.387) [-288.560] (-290.642) * (-288.464) (-290.771) [-288.401] (-289.729) -- 0:00:32
454500 -- (-289.667) [-288.971] (-290.332) (-290.963) * (-289.665) [-288.940] (-289.895) (-288.317) -- 0:00:32
455000 -- (-290.492) [-290.800] (-287.429) (-290.539) * (-290.522) [-288.659] (-291.450) (-288.573) -- 0:00:32
Average standard deviation of split frequencies: 0.011888
455500 -- (-289.051) [-288.317] (-289.690) (-287.687) * (-290.443) (-290.025) (-296.677) [-288.621] -- 0:00:32
456000 -- (-292.243) (-289.909) [-290.641] (-288.210) * (-289.425) [-291.858] (-289.346) (-288.678) -- 0:00:32
456500 -- [-290.327] (-289.475) (-288.367) (-295.333) * (-289.834) [-288.280] (-292.880) (-289.164) -- 0:00:32
457000 -- (-293.436) (-290.223) [-289.164] (-287.739) * [-288.168] (-289.693) (-289.890) (-287.277) -- 0:00:32
457500 -- (-293.918) (-288.983) (-289.419) [-288.636] * (-288.953) [-288.577] (-289.091) (-288.887) -- 0:00:32
458000 -- (-292.895) [-288.168] (-289.795) (-289.648) * (-291.732) (-291.221) (-290.199) [-289.230] -- 0:00:31
458500 -- (-293.388) [-289.091] (-292.284) (-291.078) * (-290.138) [-291.835] (-289.467) (-289.138) -- 0:00:31
459000 -- [-291.534] (-291.121) (-288.950) (-292.611) * (-291.588) (-288.529) [-287.519] (-289.918) -- 0:00:31
459500 -- (-293.721) [-289.919] (-290.491) (-292.354) * (-291.156) (-287.277) (-288.507) [-289.293] -- 0:00:31
460000 -- (-290.710) [-288.471] (-292.229) (-289.935) * (-297.991) (-289.290) (-291.053) [-288.174] -- 0:00:31
Average standard deviation of split frequencies: 0.011256
460500 -- (-291.384) (-289.186) (-295.623) [-288.221] * (-288.510) (-289.761) [-287.790] (-291.948) -- 0:00:31
461000 -- (-294.254) [-289.574] (-292.033) (-287.724) * (-288.271) (-291.394) [-290.432] (-289.320) -- 0:00:31
461500 -- (-291.356) (-291.129) [-289.144] (-289.240) * [-290.321] (-294.491) (-293.142) (-289.533) -- 0:00:31
462000 -- (-289.062) (-288.918) [-290.307] (-289.996) * (-288.852) (-290.316) (-288.879) [-288.893] -- 0:00:31
462500 -- (-290.112) (-288.831) [-288.198] (-291.007) * [-288.150] (-291.530) (-289.310) (-290.446) -- 0:00:31
463000 -- (-289.675) [-287.333] (-288.833) (-291.074) * [-288.213] (-290.885) (-289.664) (-289.158) -- 0:00:31
463500 -- (-289.589) (-289.182) [-287.753] (-288.279) * (-289.730) [-287.867] (-288.790) (-293.310) -- 0:00:31
464000 -- [-287.817] (-292.470) (-290.362) (-287.814) * (-288.933) (-293.191) [-288.209] (-288.923) -- 0:00:31
464500 -- (-291.886) (-291.881) [-288.671] (-292.655) * (-293.340) [-288.130] (-288.462) (-289.812) -- 0:00:31
465000 -- (-293.584) (-288.491) [-290.417] (-289.364) * (-299.036) (-289.047) (-291.081) [-288.563] -- 0:00:31
Average standard deviation of split frequencies: 0.011380
465500 -- (-292.483) (-288.936) [-287.504] (-287.683) * (-287.837) (-292.172) [-289.230] (-289.208) -- 0:00:31
466000 -- (-291.204) (-289.298) (-288.484) [-289.850] * (-289.891) (-290.778) [-289.686] (-287.266) -- 0:00:30
466500 -- (-292.017) (-290.124) [-290.888] (-288.989) * (-291.055) [-290.011] (-289.504) (-290.407) -- 0:00:30
467000 -- (-293.301) (-290.550) [-291.418] (-293.140) * [-288.572] (-287.620) (-291.034) (-291.460) -- 0:00:30
467500 -- [-291.095] (-291.491) (-291.899) (-291.624) * [-289.903] (-290.455) (-289.610) (-288.900) -- 0:00:30
468000 -- (-288.245) (-290.203) (-288.389) [-291.481] * [-290.733] (-289.544) (-290.209) (-288.416) -- 0:00:30
468500 -- (-287.489) (-288.717) [-288.635] (-289.294) * (-288.117) (-289.387) (-290.331) [-288.641] -- 0:00:30
469000 -- (-287.906) (-287.493) [-287.524] (-289.929) * (-289.841) [-288.813] (-290.807) (-287.650) -- 0:00:30
469500 -- (-287.447) [-289.895] (-288.908) (-289.462) * (-289.363) (-290.023) (-290.244) [-290.227] -- 0:00:30
470000 -- (-288.218) [-289.812] (-290.572) (-290.968) * (-288.979) (-288.465) (-290.143) [-292.409] -- 0:00:30
Average standard deviation of split frequencies: 0.010767
470500 -- (-288.383) [-290.785] (-291.610) (-292.049) * (-289.605) (-291.792) (-288.545) [-288.930] -- 0:00:31
471000 -- (-289.180) (-295.571) (-292.273) [-287.769] * (-292.040) (-289.711) [-288.249] (-288.224) -- 0:00:31
471500 -- (-291.070) (-290.792) (-290.334) [-287.457] * [-290.452] (-287.908) (-288.190) (-291.124) -- 0:00:31
472000 -- (-290.882) (-289.012) (-291.775) [-290.962] * [-289.070] (-289.938) (-288.010) (-292.659) -- 0:00:31
472500 -- (-291.649) (-289.706) (-291.616) [-290.263] * [-292.139] (-289.687) (-288.214) (-294.097) -- 0:00:31
473000 -- (-292.679) [-289.857] (-291.253) (-289.860) * (-289.778) (-288.277) [-291.878] (-288.793) -- 0:00:31
473500 -- [-290.753] (-288.580) (-291.742) (-289.958) * (-291.317) (-290.975) [-289.539] (-291.384) -- 0:00:31
474000 -- (-288.024) (-287.894) (-289.235) [-291.319] * (-287.814) (-288.869) [-289.375] (-290.920) -- 0:00:31
474500 -- (-288.941) (-287.434) [-289.187] (-290.558) * [-290.932] (-290.117) (-293.305) (-289.315) -- 0:00:31
475000 -- (-291.092) (-288.605) (-287.553) [-290.083] * (-288.670) [-290.556] (-288.064) (-292.321) -- 0:00:30
Average standard deviation of split frequencies: 0.011637
475500 -- (-287.809) (-289.002) [-291.820] (-289.306) * [-289.196] (-288.507) (-290.282) (-289.352) -- 0:00:30
476000 -- (-290.287) (-288.282) (-288.593) [-291.494] * (-292.392) [-287.482] (-289.179) (-288.470) -- 0:00:30
476500 -- [-288.511] (-288.320) (-289.095) (-288.373) * [-288.195] (-287.788) (-290.835) (-289.173) -- 0:00:30
477000 -- (-287.816) (-289.111) [-288.157] (-292.269) * (-289.221) (-290.146) (-288.916) [-289.044] -- 0:00:30
477500 -- (-300.233) [-287.339] (-288.895) (-290.076) * (-289.833) (-294.100) (-288.820) [-289.644] -- 0:00:30
478000 -- (-293.262) (-288.612) (-289.051) [-289.723] * (-289.954) [-290.046] (-288.951) (-287.390) -- 0:00:30
478500 -- [-289.997] (-289.433) (-289.058) (-289.979) * (-288.606) (-288.679) [-288.326] (-287.418) -- 0:00:30
479000 -- (-288.601) (-293.304) (-291.719) [-289.043] * [-288.080] (-289.545) (-289.398) (-287.644) -- 0:00:30
479500 -- [-291.080] (-291.819) (-288.115) (-292.812) * (-288.844) (-291.583) [-290.586] (-291.317) -- 0:00:30
480000 -- (-287.771) (-288.775) [-287.964] (-297.056) * [-288.788] (-288.832) (-289.115) (-288.997) -- 0:00:30
Average standard deviation of split frequencies: 0.011033
480500 -- (-289.075) (-288.995) (-290.189) [-290.056] * (-289.866) (-287.355) [-287.435] (-289.035) -- 0:00:30
481000 -- [-289.587] (-289.062) (-290.949) (-289.646) * (-288.894) [-288.115] (-289.842) (-291.204) -- 0:00:30
481500 -- [-287.790] (-287.965) (-291.825) (-289.407) * [-288.010] (-288.664) (-290.033) (-289.675) -- 0:00:30
482000 -- [-288.059] (-289.014) (-289.173) (-294.528) * [-288.793] (-288.308) (-287.905) (-290.420) -- 0:00:30
482500 -- [-290.641] (-287.950) (-291.902) (-289.088) * (-290.928) (-289.144) (-290.572) [-291.592] -- 0:00:30
483000 -- (-288.453) (-289.433) (-287.870) [-292.644] * (-295.706) (-292.038) (-291.187) [-290.233] -- 0:00:29
483500 -- (-289.670) [-287.773] (-290.630) (-290.376) * (-288.059) (-287.884) [-294.637] (-290.140) -- 0:00:29
484000 -- [-289.496] (-290.348) (-290.895) (-290.744) * (-291.087) (-289.321) [-294.946] (-287.561) -- 0:00:29
484500 -- (-290.465) (-288.985) [-291.172] (-290.442) * (-288.834) (-290.383) [-291.155] (-290.482) -- 0:00:29
485000 -- (-289.998) [-288.197] (-288.260) (-288.741) * (-287.658) (-289.615) [-287.667] (-295.296) -- 0:00:29
Average standard deviation of split frequencies: 0.011033
485500 -- (-290.245) [-292.628] (-288.947) (-293.498) * (-289.149) (-288.142) (-292.374) [-288.883] -- 0:00:29
486000 -- (-288.757) (-288.124) (-288.674) [-289.083] * (-291.788) (-288.595) [-291.117] (-288.536) -- 0:00:29
486500 -- [-289.310] (-290.738) (-287.518) (-289.521) * [-287.603] (-290.384) (-290.184) (-291.460) -- 0:00:29
487000 -- (-287.763) (-288.313) (-288.897) [-287.678] * (-288.166) (-288.703) (-293.831) [-287.585] -- 0:00:29
487500 -- (-288.216) [-287.769] (-290.216) (-288.499) * (-288.628) (-290.412) [-289.777] (-291.502) -- 0:00:29
488000 -- (-289.263) (-289.154) [-287.979] (-289.990) * [-289.644] (-288.229) (-290.515) (-290.034) -- 0:00:30
488500 -- (-289.958) (-288.976) [-290.275] (-292.351) * (-290.775) [-288.510] (-288.969) (-290.180) -- 0:00:30
489000 -- (-291.480) (-288.867) [-290.709] (-288.840) * (-289.048) (-289.095) [-288.624] (-298.467) -- 0:00:30
489500 -- (-288.839) [-288.495] (-288.766) (-294.888) * (-289.325) [-287.781] (-287.986) (-289.964) -- 0:00:30
490000 -- [-289.951] (-291.019) (-291.643) (-288.683) * [-288.879] (-292.333) (-289.195) (-290.383) -- 0:00:30
Average standard deviation of split frequencies: 0.010268
490500 -- (-290.202) (-289.498) [-287.857] (-292.226) * (-289.974) (-289.633) (-287.859) [-287.416] -- 0:00:30
491000 -- (-291.172) [-293.706] (-289.160) (-289.176) * [-288.169] (-289.509) (-289.597) (-288.733) -- 0:00:30
491500 -- (-290.782) [-292.850] (-289.321) (-289.832) * [-289.728] (-290.246) (-295.422) (-288.927) -- 0:00:30
492000 -- (-288.487) (-290.161) (-297.759) [-289.404] * (-287.603) [-288.547] (-289.465) (-287.941) -- 0:00:29
492500 -- [-292.028] (-292.669) (-293.718) (-287.926) * (-289.259) (-289.044) (-287.551) [-288.004] -- 0:00:29
493000 -- (-287.937) (-288.843) [-291.792] (-289.278) * (-290.160) (-288.922) [-292.444] (-293.946) -- 0:00:29
493500 -- [-287.886] (-291.964) (-287.406) (-289.332) * (-298.746) [-291.457] (-290.287) (-287.710) -- 0:00:29
494000 -- (-288.111) (-291.641) [-288.492] (-288.196) * (-292.652) (-289.888) (-288.500) [-288.494] -- 0:00:29
494500 -- [-289.727] (-291.713) (-291.965) (-287.871) * [-288.599] (-290.390) (-288.917) (-290.551) -- 0:00:29
495000 -- (-288.573) [-292.370] (-295.177) (-288.499) * [-291.847] (-289.918) (-289.048) (-289.017) -- 0:00:29
Average standard deviation of split frequencies: 0.010395
495500 -- (-288.105) (-291.479) (-291.333) [-290.718] * (-292.702) (-290.468) [-287.756] (-289.179) -- 0:00:29
496000 -- (-291.089) [-288.602] (-289.725) (-287.594) * (-292.364) (-296.895) (-292.120) [-288.021] -- 0:00:29
496500 -- [-292.856] (-289.313) (-289.083) (-289.691) * (-290.877) [-290.624] (-291.737) (-290.596) -- 0:00:29
497000 -- [-288.460] (-289.409) (-289.787) (-295.710) * (-288.287) [-288.127] (-289.951) (-287.332) -- 0:00:29
497500 -- (-289.409) (-289.943) [-289.010] (-290.407) * [-288.147] (-288.870) (-290.465) (-288.366) -- 0:00:29
498000 -- [-291.858] (-289.472) (-288.054) (-289.680) * (-288.313) [-291.623] (-293.466) (-292.548) -- 0:00:29
498500 -- (-289.408) (-288.700) [-288.487] (-287.384) * (-289.181) (-289.439) (-288.946) [-291.418] -- 0:00:29
499000 -- [-290.165] (-291.333) (-289.515) (-288.223) * (-288.233) (-288.968) [-290.327] (-288.309) -- 0:00:29
499500 -- (-288.789) [-292.952] (-291.400) (-291.447) * [-288.744] (-289.857) (-290.799) (-288.382) -- 0:00:29
500000 -- [-291.043] (-290.061) (-291.252) (-292.976) * (-290.208) [-291.703] (-289.444) (-292.705) -- 0:00:29
Average standard deviation of split frequencies: 0.009827
500500 -- (-291.050) (-289.544) [-288.092] (-289.185) * (-292.696) (-289.757) [-290.793] (-292.641) -- 0:00:28
501000 -- (-287.812) (-290.538) (-290.724) [-288.282] * (-289.880) [-288.436] (-288.180) (-290.003) -- 0:00:28
501500 -- (-293.638) (-289.822) [-296.247] (-291.168) * [-287.570] (-288.503) (-290.994) (-289.697) -- 0:00:28
502000 -- [-287.847] (-289.143) (-289.910) (-288.636) * (-287.586) [-288.015] (-290.737) (-289.863) -- 0:00:28
502500 -- (-293.174) [-289.862] (-292.893) (-290.227) * (-291.118) [-288.146] (-292.064) (-288.154) -- 0:00:28
503000 -- [-291.480] (-293.773) (-287.610) (-296.869) * (-290.845) (-290.736) (-289.261) [-290.130] -- 0:00:28
503500 -- (-293.260) (-290.760) (-290.828) [-290.207] * (-291.107) [-289.863] (-289.752) (-288.709) -- 0:00:28
504000 -- (-289.063) (-293.117) (-291.366) [-288.948] * (-289.541) (-291.020) [-288.958] (-290.026) -- 0:00:28
504500 -- (-288.255) (-290.202) [-288.167] (-288.329) * (-287.810) [-288.774] (-288.439) (-288.038) -- 0:00:28
505000 -- [-289.086] (-290.245) (-292.636) (-289.431) * [-289.706] (-290.558) (-289.499) (-287.727) -- 0:00:29
Average standard deviation of split frequencies: 0.010073
505500 -- (-289.577) [-291.260] (-295.553) (-288.713) * (-295.605) [-290.036] (-289.451) (-288.971) -- 0:00:29
506000 -- (-290.408) (-292.148) [-293.830] (-289.603) * (-293.271) (-291.676) (-288.426) [-290.007] -- 0:00:29
506500 -- (-290.306) (-292.028) (-287.642) [-288.547] * (-295.674) (-289.069) [-288.406] (-288.024) -- 0:00:29
507000 -- (-287.557) [-288.056] (-287.655) (-290.361) * (-296.975) (-292.030) [-289.503] (-288.048) -- 0:00:29
507500 -- [-290.701] (-288.415) (-289.634) (-293.665) * (-293.676) (-288.412) [-289.846] (-289.640) -- 0:00:29
508000 -- (-290.939) [-287.752] (-288.904) (-293.318) * (-290.843) (-293.111) [-287.603] (-288.252) -- 0:00:29
508500 -- (-298.200) (-288.084) [-287.275] (-290.788) * (-288.032) (-288.903) [-290.023] (-288.816) -- 0:00:28
509000 -- (-295.462) (-288.295) [-288.921] (-288.312) * (-288.554) (-289.087) [-289.162] (-287.717) -- 0:00:28
509500 -- (-290.191) (-292.699) (-292.513) [-290.402] * (-289.702) (-288.537) (-291.493) [-289.427] -- 0:00:28
510000 -- [-289.820] (-288.862) (-291.527) (-296.827) * (-289.201) [-288.419] (-288.454) (-294.685) -- 0:00:28
Average standard deviation of split frequencies: 0.009866
510500 -- (-291.075) (-290.652) (-287.766) [-291.920] * (-291.939) [-292.821] (-290.637) (-290.985) -- 0:00:28
511000 -- [-291.097] (-288.338) (-288.810) (-289.095) * (-289.232) (-289.204) [-292.582] (-290.123) -- 0:00:28
511500 -- (-288.635) (-289.282) (-290.547) [-288.621] * (-289.198) [-288.817] (-291.696) (-288.508) -- 0:00:28
512000 -- (-287.922) [-289.127] (-290.196) (-289.444) * (-290.416) [-293.164] (-289.245) (-287.646) -- 0:00:28
512500 -- (-289.185) (-290.118) (-290.613) [-290.461] * (-289.228) [-290.576] (-289.361) (-288.028) -- 0:00:28
513000 -- [-287.746] (-288.547) (-288.782) (-288.543) * (-288.894) (-288.973) [-287.249] (-289.939) -- 0:00:28
513500 -- (-291.565) [-289.526] (-289.049) (-289.885) * (-289.383) (-289.319) [-291.673] (-292.007) -- 0:00:28
514000 -- (-290.608) (-289.255) [-288.580] (-287.836) * [-290.571] (-289.144) (-291.900) (-289.764) -- 0:00:28
514500 -- [-289.525] (-290.062) (-290.228) (-287.731) * [-290.221] (-289.687) (-288.253) (-290.634) -- 0:00:28
515000 -- (-289.880) (-290.684) (-289.251) [-289.319] * (-288.698) [-291.061] (-293.718) (-289.137) -- 0:00:28
Average standard deviation of split frequencies: 0.009707
515500 -- (-294.255) (-296.391) [-288.394] (-292.304) * (-289.967) (-288.912) [-287.668] (-290.810) -- 0:00:28
516000 -- [-288.419] (-290.808) (-288.503) (-288.545) * (-293.602) [-289.002] (-288.338) (-289.229) -- 0:00:28
516500 -- [-288.436] (-289.932) (-288.292) (-288.100) * (-290.116) (-289.531) [-290.304] (-288.630) -- 0:00:28
517000 -- (-292.158) (-291.025) (-291.366) [-287.653] * [-287.859] (-289.175) (-291.353) (-293.203) -- 0:00:28
517500 -- (-295.158) [-288.048] (-289.919) (-288.833) * (-289.213) (-289.907) [-290.390] (-290.900) -- 0:00:27
518000 -- (-288.394) [-288.495] (-288.203) (-290.230) * (-290.332) (-290.857) [-291.425] (-291.870) -- 0:00:27
518500 -- (-291.653) [-287.665] (-289.425) (-291.910) * (-288.173) (-288.634) [-287.822] (-288.479) -- 0:00:27
519000 -- (-291.322) (-288.310) (-289.673) [-289.047] * (-288.532) (-290.223) (-293.348) [-289.011] -- 0:00:27
519500 -- (-289.306) (-288.778) [-289.454] (-291.938) * [-290.698] (-290.155) (-290.879) (-289.926) -- 0:00:27
520000 -- (-288.436) (-291.687) [-290.190] (-289.358) * (-288.920) (-288.033) [-288.151] (-289.072) -- 0:00:27
Average standard deviation of split frequencies: 0.009789
520500 -- (-287.348) (-288.973) [-288.239] (-289.718) * (-290.026) (-287.904) (-289.513) [-289.228] -- 0:00:27
521000 -- (-290.370) (-288.481) [-288.893] (-291.882) * (-288.621) (-291.147) [-290.203] (-287.708) -- 0:00:27
521500 -- (-290.097) (-288.668) [-288.490] (-292.908) * (-289.414) (-287.659) (-289.628) [-290.196] -- 0:00:27
522000 -- (-288.178) (-288.142) [-288.725] (-290.703) * (-291.809) (-287.788) (-291.260) [-288.374] -- 0:00:27
522500 -- (-288.392) (-288.483) [-289.666] (-290.908) * (-293.674) (-291.609) (-292.603) [-288.453] -- 0:00:28
523000 -- (-289.010) (-289.055) (-288.605) [-288.984] * [-290.548] (-292.932) (-294.780) (-289.708) -- 0:00:28
523500 -- (-289.410) (-290.660) (-289.370) [-290.465] * [-289.377] (-288.739) (-288.142) (-288.826) -- 0:00:28
524000 -- (-293.096) (-292.532) [-288.904] (-288.454) * (-287.349) [-291.807] (-292.177) (-289.507) -- 0:00:28
524500 -- (-293.139) [-290.513] (-288.194) (-292.690) * (-289.085) [-289.761] (-289.931) (-289.780) -- 0:00:28
525000 -- (-291.061) [-289.102] (-289.885) (-290.857) * (-287.934) (-287.916) (-288.735) [-289.554] -- 0:00:28
Average standard deviation of split frequencies: 0.009970
525500 -- (-295.358) [-289.437] (-288.273) (-289.795) * (-290.592) (-287.769) (-295.132) [-289.804] -- 0:00:27
526000 -- (-290.739) (-290.378) (-288.026) [-289.073] * (-288.212) (-289.303) (-290.704) [-288.231] -- 0:00:27
526500 -- (-291.003) [-290.735] (-291.809) (-289.073) * (-289.258) (-288.296) [-289.722] (-291.058) -- 0:00:27
527000 -- (-288.420) (-291.237) (-291.538) [-287.425] * (-290.637) [-290.757] (-290.278) (-289.150) -- 0:00:27
527500 -- (-289.339) (-288.626) (-289.667) [-288.411] * (-288.439) [-288.176] (-290.310) (-288.520) -- 0:00:27
528000 -- (-289.150) [-289.139] (-292.182) (-288.852) * (-291.947) [-288.617] (-295.777) (-288.661) -- 0:00:27
528500 -- (-289.712) (-288.910) [-288.134] (-288.511) * [-290.142] (-289.497) (-290.076) (-289.252) -- 0:00:27
529000 -- (-293.620) (-288.818) (-292.679) [-289.554] * (-287.635) (-291.646) (-290.087) [-288.419] -- 0:00:27
529500 -- (-291.574) (-288.032) [-291.386] (-294.587) * (-289.457) (-287.682) (-290.903) [-288.369] -- 0:00:27
530000 -- [-288.614] (-290.527) (-290.038) (-292.019) * (-291.320) (-289.258) [-291.149] (-290.528) -- 0:00:27
Average standard deviation of split frequencies: 0.010160
530500 -- [-293.897] (-288.793) (-288.125) (-290.498) * (-289.293) (-287.999) (-291.234) [-288.816] -- 0:00:27
531000 -- (-289.418) [-289.556] (-291.148) (-291.062) * (-288.303) (-289.297) (-287.665) [-288.348] -- 0:00:27
531500 -- [-288.545] (-289.422) (-288.387) (-292.167) * (-289.183) (-290.466) (-287.965) [-288.230] -- 0:00:27
532000 -- (-291.094) [-287.863] (-294.206) (-287.961) * (-288.688) [-287.373] (-287.947) (-288.301) -- 0:00:27
532500 -- (-291.015) [-289.036] (-291.091) (-290.790) * (-288.836) (-289.745) (-289.461) [-289.183] -- 0:00:27
533000 -- (-297.501) [-288.949] (-289.019) (-290.086) * (-290.343) (-288.087) (-289.637) [-288.742] -- 0:00:27
533500 -- (-293.308) [-288.184] (-289.494) (-289.352) * (-290.906) (-290.472) (-287.474) [-288.460] -- 0:00:27
534000 -- (-287.827) (-293.150) (-289.225) [-288.830] * (-290.985) (-291.679) (-289.126) [-288.551] -- 0:00:27
534500 -- (-290.063) [-288.227] (-288.111) (-289.717) * [-287.816] (-289.290) (-291.815) (-291.169) -- 0:00:26
535000 -- (-290.073) [-289.049] (-288.854) (-290.283) * [-289.998] (-287.712) (-289.242) (-288.348) -- 0:00:26
Average standard deviation of split frequencies: 0.009949
535500 -- (-289.511) [-288.137] (-289.226) (-288.687) * (-287.983) (-304.650) (-288.485) [-289.343] -- 0:00:26
536000 -- [-287.556] (-288.674) (-288.047) (-287.557) * [-290.393] (-290.636) (-289.614) (-289.618) -- 0:00:26
536500 -- [-288.277] (-289.923) (-289.517) (-290.230) * [-288.854] (-288.785) (-294.166) (-291.185) -- 0:00:26
537000 -- (-293.902) (-290.019) [-291.862] (-287.836) * (-288.244) [-292.191] (-290.140) (-288.361) -- 0:00:26
537500 -- (-289.919) [-288.866] (-292.377) (-287.712) * (-289.219) (-290.772) [-290.033] (-290.069) -- 0:00:26
538000 -- (-291.158) [-290.101] (-289.542) (-288.836) * (-290.151) [-287.573] (-288.220) (-289.886) -- 0:00:26
538500 -- (-289.153) (-289.516) (-294.240) [-289.990] * (-289.359) (-289.101) (-288.258) [-289.520] -- 0:00:26
539000 -- (-290.667) (-293.423) (-289.968) [-289.510] * (-288.784) (-288.636) (-288.426) [-293.804] -- 0:00:26
539500 -- (-291.840) (-290.157) [-288.277] (-288.219) * (-288.554) (-289.037) (-289.246) [-289.983] -- 0:00:27
540000 -- (-289.272) (-291.964) (-289.691) [-289.657] * [-288.583] (-294.989) (-288.916) (-289.199) -- 0:00:27
Average standard deviation of split frequencies: 0.009536
540500 -- (-292.798) [-290.237] (-288.796) (-289.051) * (-291.005) (-289.917) (-290.029) [-289.013] -- 0:00:27
541000 -- (-292.117) [-290.135] (-290.027) (-287.852) * (-290.625) (-288.430) [-288.729] (-290.438) -- 0:00:27
541500 -- (-287.916) (-289.106) [-289.740] (-287.707) * (-290.219) (-288.067) [-290.385] (-289.090) -- 0:00:27
542000 -- (-289.114) (-293.175) [-291.938] (-290.152) * (-291.825) (-287.688) [-290.433] (-290.508) -- 0:00:27
542500 -- (-288.057) [-288.831] (-291.848) (-290.084) * (-292.485) [-289.061] (-289.989) (-289.065) -- 0:00:26
543000 -- (-288.540) (-288.378) [-292.301] (-290.176) * (-287.919) (-287.643) (-288.491) [-288.154] -- 0:00:26
543500 -- (-287.416) (-289.256) (-287.784) [-287.746] * (-290.629) (-290.680) [-288.205] (-293.330) -- 0:00:26
544000 -- (-287.870) [-288.244] (-289.052) (-290.107) * (-291.088) (-291.051) [-292.147] (-287.327) -- 0:00:26
544500 -- (-287.756) [-289.071] (-288.756) (-291.462) * [-289.089] (-290.733) (-293.391) (-289.332) -- 0:00:26
545000 -- (-291.893) (-288.735) [-289.166] (-291.751) * (-291.454) (-288.982) (-293.351) [-293.806] -- 0:00:26
Average standard deviation of split frequencies: 0.009281
545500 -- (-289.874) (-295.247) [-292.176] (-288.600) * [-288.813] (-289.660) (-295.367) (-295.458) -- 0:00:26
546000 -- (-291.269) [-287.744] (-289.482) (-289.072) * [-287.277] (-290.815) (-289.007) (-288.024) -- 0:00:26
546500 -- (-288.834) (-297.800) (-287.727) [-288.100] * (-289.475) (-287.598) [-290.566] (-288.011) -- 0:00:26
547000 -- (-289.142) (-290.018) (-291.939) [-289.130] * (-289.033) (-289.510) [-289.807] (-290.760) -- 0:00:26
547500 -- [-290.253] (-287.740) (-289.110) (-290.737) * (-291.852) (-289.746) [-292.298] (-292.485) -- 0:00:26
548000 -- (-296.151) (-292.649) (-290.198) [-288.719] * (-291.004) [-288.167] (-289.841) (-290.609) -- 0:00:26
548500 -- (-289.611) [-289.944] (-288.325) (-290.165) * (-294.931) (-290.302) (-294.928) [-288.220] -- 0:00:26
549000 -- (-291.430) (-289.633) [-288.886] (-288.743) * (-291.393) (-289.383) [-291.393] (-287.930) -- 0:00:26
549500 -- (-288.542) (-293.407) (-293.833) [-289.595] * (-294.981) (-289.092) (-291.232) [-290.158] -- 0:00:26
550000 -- (-287.866) (-289.541) [-288.293] (-287.929) * (-288.498) [-287.514] (-290.499) (-292.057) -- 0:00:26
Average standard deviation of split frequencies: 0.009470
550500 -- (-289.288) [-290.493] (-289.157) (-287.992) * (-291.773) [-287.544] (-292.082) (-290.756) -- 0:00:26
551000 -- (-291.015) (-291.948) [-291.058] (-289.372) * (-295.431) [-289.188] (-287.591) (-291.051) -- 0:00:26
551500 -- (-291.554) (-287.388) [-291.649] (-292.513) * (-287.287) (-288.241) (-289.680) [-292.323] -- 0:00:26
552000 -- [-288.200] (-287.598) (-291.189) (-289.919) * (-290.460) (-288.191) [-291.882] (-288.865) -- 0:00:25
552500 -- [-289.092] (-287.713) (-288.133) (-288.478) * (-288.641) (-288.170) (-288.603) [-288.970] -- 0:00:25
553000 -- (-288.143) (-291.589) (-290.263) [-287.851] * [-287.694] (-290.646) (-289.570) (-293.706) -- 0:00:25
553500 -- [-288.663] (-290.132) (-291.923) (-290.072) * (-289.723) (-289.773) [-290.695] (-289.923) -- 0:00:25
554000 -- [-288.979] (-292.207) (-290.565) (-288.477) * (-288.578) (-294.376) [-287.833] (-291.276) -- 0:00:25
554500 -- [-289.099] (-293.035) (-287.439) (-289.176) * [-289.981] (-292.997) (-288.802) (-289.514) -- 0:00:25
555000 -- (-292.324) (-288.504) (-288.093) [-287.987] * (-287.590) (-289.265) [-287.909] (-289.703) -- 0:00:25
Average standard deviation of split frequencies: 0.009485
555500 -- (-290.378) (-288.218) [-288.494] (-290.128) * (-289.246) [-288.556] (-289.119) (-293.277) -- 0:00:25
556000 -- (-289.334) [-289.637] (-290.941) (-289.170) * (-292.235) (-289.582) (-289.052) [-288.597] -- 0:00:25
556500 -- (-290.984) [-288.537] (-292.391) (-290.984) * (-290.962) (-291.983) [-288.458] (-293.065) -- 0:00:25
557000 -- (-290.304) [-290.005] (-295.382) (-289.015) * (-291.103) (-292.586) [-288.454] (-287.839) -- 0:00:26
557500 -- [-291.609] (-289.061) (-293.668) (-289.497) * (-289.692) [-287.756] (-289.374) (-289.664) -- 0:00:26
558000 -- [-290.982] (-291.966) (-288.042) (-290.331) * (-289.335) (-287.752) (-288.322) [-288.773] -- 0:00:26
558500 -- [-289.333] (-293.225) (-288.366) (-294.191) * [-291.702] (-292.993) (-292.297) (-289.142) -- 0:00:26
559000 -- [-294.324] (-289.396) (-288.390) (-290.074) * (-287.963) [-288.391] (-290.458) (-289.597) -- 0:00:26
559500 -- (-292.027) (-289.834) [-290.260] (-288.883) * (-289.030) [-291.561] (-288.737) (-290.701) -- 0:00:25
560000 -- [-288.968] (-288.969) (-290.028) (-293.560) * [-290.731] (-295.824) (-287.940) (-289.514) -- 0:00:25
Average standard deviation of split frequencies: 0.009301
560500 -- (-290.528) [-292.588] (-291.503) (-290.177) * (-288.649) (-294.297) (-288.408) [-290.159] -- 0:00:25
561000 -- (-292.446) (-287.841) [-289.622] (-289.330) * (-289.419) (-293.243) (-287.775) [-289.908] -- 0:00:25
561500 -- (-289.935) (-288.059) [-289.117] (-288.645) * (-291.020) (-289.719) [-289.004] (-288.387) -- 0:00:25
562000 -- (-288.559) (-288.624) [-294.489] (-291.699) * (-290.310) (-289.564) (-287.961) [-287.989] -- 0:00:25
562500 -- [-289.338] (-289.510) (-290.220) (-291.095) * (-293.857) (-292.236) [-287.736] (-290.459) -- 0:00:25
563000 -- (-291.374) (-289.886) (-288.724) [-290.827] * [-293.122] (-290.154) (-287.919) (-292.476) -- 0:00:25
563500 -- (-289.202) (-288.874) [-288.080] (-292.181) * (-290.096) (-289.576) (-288.883) [-290.342] -- 0:00:25
564000 -- [-291.450] (-293.623) (-292.379) (-291.735) * [-290.347] (-288.637) (-288.351) (-293.795) -- 0:00:25
564500 -- (-288.839) [-289.372] (-291.929) (-287.489) * [-287.759] (-291.691) (-289.286) (-287.800) -- 0:00:25
565000 -- (-288.872) (-287.705) [-289.279] (-287.723) * (-288.812) (-291.090) (-288.461) [-288.626] -- 0:00:25
Average standard deviation of split frequencies: 0.009682
565500 -- (-288.185) (-288.189) [-290.700] (-289.254) * [-287.710] (-291.159) (-290.229) (-291.376) -- 0:00:25
566000 -- (-297.480) [-291.073] (-290.767) (-289.866) * (-288.728) [-288.099] (-289.436) (-288.423) -- 0:00:25
566500 -- [-290.285] (-289.752) (-290.626) (-289.264) * [-291.072] (-287.569) (-289.160) (-290.407) -- 0:00:25
567000 -- (-292.028) (-291.693) (-291.292) [-288.314] * (-293.871) [-287.371] (-292.366) (-290.478) -- 0:00:25
567500 -- (-289.553) (-288.887) [-288.447] (-288.910) * (-288.746) (-290.296) [-291.133] (-292.171) -- 0:00:25
568000 -- [-289.622] (-289.005) (-287.192) (-291.496) * (-293.520) (-288.436) (-288.697) [-289.174] -- 0:00:25
568500 -- (-291.578) [-291.016] (-290.555) (-288.117) * (-291.277) (-291.436) (-288.159) [-288.963] -- 0:00:25
569000 -- (-290.862) (-288.411) [-290.112] (-287.863) * (-298.870) (-290.198) [-288.269] (-289.179) -- 0:00:24
569500 -- [-290.281] (-288.472) (-290.366) (-291.278) * [-289.451] (-291.432) (-288.381) (-290.541) -- 0:00:24
570000 -- (-289.489) (-289.167) (-289.966) [-290.129] * [-288.093] (-289.295) (-290.805) (-290.115) -- 0:00:24
Average standard deviation of split frequencies: 0.009655
570500 -- (-288.381) [-288.440] (-288.474) (-290.953) * (-291.782) (-289.687) [-287.625] (-290.027) -- 0:00:24
571000 -- [-289.092] (-288.828) (-289.527) (-296.452) * (-288.563) (-289.516) [-288.967] (-288.636) -- 0:00:24
571500 -- (-289.233) (-290.773) [-288.671] (-288.034) * (-289.916) (-289.438) (-291.346) [-288.454] -- 0:00:24
572000 -- (-290.971) [-290.485] (-291.679) (-288.080) * (-293.476) [-289.537] (-290.753) (-288.368) -- 0:00:24
572500 -- (-290.788) (-289.286) [-287.465] (-291.887) * (-287.735) (-287.382) [-290.554] (-290.369) -- 0:00:24
573000 -- (-293.000) (-290.055) [-288.583] (-291.577) * (-288.617) [-290.366] (-289.675) (-289.655) -- 0:00:24
573500 -- (-291.969) [-288.691] (-290.327) (-289.879) * (-288.853) [-288.973] (-288.632) (-290.383) -- 0:00:24
574000 -- (-288.179) (-290.527) (-287.189) [-288.719] * (-287.703) (-290.768) [-289.431] (-290.799) -- 0:00:24
574500 -- (-288.832) (-288.553) [-288.301] (-290.207) * (-291.838) (-288.816) [-290.649] (-288.314) -- 0:00:25
575000 -- (-292.513) (-288.973) (-288.675) [-294.287] * (-291.288) (-288.100) (-289.589) [-288.606] -- 0:00:25
Average standard deviation of split frequencies: 0.009616
575500 -- (-291.974) [-292.123] (-288.685) (-288.864) * (-289.551) (-287.942) (-288.477) [-288.196] -- 0:00:25
576000 -- (-291.649) [-291.538] (-287.590) (-294.344) * (-288.218) (-287.977) (-288.782) [-289.055] -- 0:00:25
576500 -- (-288.949) (-291.508) (-288.629) [-289.285] * (-291.346) (-288.712) (-295.355) [-289.867] -- 0:00:24
577000 -- [-290.229] (-288.800) (-291.917) (-287.968) * (-290.226) [-288.062] (-291.002) (-287.844) -- 0:00:24
577500 -- (-288.623) [-289.205] (-288.351) (-289.410) * (-289.539) [-292.054] (-288.723) (-289.056) -- 0:00:24
578000 -- [-287.659] (-287.620) (-292.439) (-294.118) * (-288.467) (-292.453) (-290.400) [-291.772] -- 0:00:24
578500 -- [-291.365] (-290.160) (-289.350) (-292.580) * [-289.080] (-288.372) (-291.174) (-287.774) -- 0:00:24
579000 -- (-291.141) (-287.857) [-289.714] (-291.364) * (-289.796) (-294.717) [-288.111] (-288.009) -- 0:00:24
579500 -- [-290.073] (-289.827) (-288.061) (-290.527) * [-288.946] (-291.167) (-287.995) (-288.275) -- 0:00:24
580000 -- (-289.556) (-290.870) (-289.776) [-292.111] * (-289.449) (-287.936) (-287.813) [-289.513] -- 0:00:24
Average standard deviation of split frequencies: 0.009793
580500 -- (-289.536) (-288.098) [-289.487] (-289.549) * (-287.800) (-287.458) (-290.833) [-291.204] -- 0:00:24
581000 -- [-288.641] (-292.580) (-288.991) (-290.289) * (-289.035) [-288.272] (-288.522) (-287.688) -- 0:00:24
581500 -- (-291.015) [-290.481] (-288.603) (-296.338) * (-293.558) [-288.320] (-288.482) (-287.329) -- 0:00:24
582000 -- (-291.963) [-288.795] (-288.806) (-288.268) * [-288.514] (-288.541) (-289.194) (-289.450) -- 0:00:24
582500 -- (-290.319) [-290.240] (-294.094) (-293.159) * (-288.110) (-292.451) [-289.640] (-288.202) -- 0:00:24
583000 -- (-293.139) (-289.890) (-291.866) [-290.801] * [-290.652] (-290.716) (-292.740) (-288.420) -- 0:00:24
583500 -- (-293.707) (-287.759) (-289.233) [-287.676] * [-289.740] (-291.946) (-291.171) (-287.841) -- 0:00:24
584000 -- [-289.852] (-290.424) (-294.082) (-288.170) * (-291.585) [-288.531] (-289.968) (-289.581) -- 0:00:24
584500 -- (-289.593) [-288.295] (-295.497) (-288.547) * [-288.777] (-294.034) (-287.994) (-293.163) -- 0:00:24
585000 -- (-290.651) [-292.933] (-290.819) (-289.082) * (-290.934) (-292.861) [-287.781] (-292.939) -- 0:00:24
Average standard deviation of split frequencies: 0.009452
585500 -- (-289.064) (-289.781) [-288.873] (-289.798) * (-292.548) (-291.766) [-287.801] (-292.114) -- 0:00:24
586000 -- (-288.828) (-289.781) (-288.014) [-289.578] * (-292.593) (-287.766) (-288.045) [-288.862] -- 0:00:24
586500 -- [-288.794] (-288.571) (-288.461) (-289.077) * (-288.641) [-290.956] (-287.697) (-290.237) -- 0:00:23
587000 -- [-289.310] (-288.997) (-293.362) (-292.788) * [-288.393] (-289.968) (-287.934) (-289.806) -- 0:00:23
587500 -- (-289.057) (-289.015) (-293.011) [-293.602] * [-294.932] (-290.262) (-292.321) (-287.267) -- 0:00:23
588000 -- (-288.129) [-289.422] (-290.065) (-291.176) * (-290.521) (-288.266) [-290.685] (-287.237) -- 0:00:23
588500 -- (-288.696) (-292.220) [-291.343] (-289.303) * (-292.040) (-290.132) (-290.947) [-288.503] -- 0:00:23
589000 -- (-289.089) [-288.670] (-291.356) (-288.005) * (-291.022) [-294.510] (-291.557) (-289.397) -- 0:00:23
589500 -- [-287.417] (-289.402) (-288.251) (-289.416) * (-290.972) (-291.508) (-289.489) [-289.538] -- 0:00:23
590000 -- (-289.534) (-288.513) (-288.509) [-291.759] * (-289.014) (-290.035) [-289.852] (-291.492) -- 0:00:23
Average standard deviation of split frequencies: 0.009577
590500 -- (-290.494) (-287.490) (-291.858) [-291.355] * (-290.231) (-288.510) (-288.662) [-288.862] -- 0:00:23
591000 -- (-289.588) [-290.436] (-288.137) (-290.446) * [-290.124] (-291.185) (-291.738) (-288.993) -- 0:00:23
591500 -- (-290.533) [-289.626] (-288.479) (-288.332) * (-288.646) (-289.215) (-290.836) [-288.357] -- 0:00:24
592000 -- (-291.042) [-289.651] (-290.930) (-290.069) * (-291.586) (-290.342) (-290.151) [-288.359] -- 0:00:24
592500 -- [-287.731] (-290.680) (-288.695) (-289.344) * (-292.549) (-293.349) [-289.925] (-290.469) -- 0:00:24
593000 -- (-291.923) (-289.094) (-289.531) [-289.890] * (-289.755) [-293.704] (-293.594) (-288.798) -- 0:00:24
593500 -- (-288.111) (-289.563) [-289.995] (-289.264) * [-292.349] (-291.913) (-289.653) (-290.697) -- 0:00:23
594000 -- (-290.397) [-288.375] (-290.104) (-288.424) * (-290.701) (-288.016) [-288.075] (-293.296) -- 0:00:23
594500 -- (-292.023) [-288.984] (-294.152) (-293.839) * (-289.652) (-291.645) [-291.007] (-292.834) -- 0:00:23
595000 -- [-292.284] (-289.274) (-289.473) (-294.424) * [-290.416] (-290.075) (-290.677) (-290.877) -- 0:00:23
Average standard deviation of split frequencies: 0.010085
595500 -- (-294.176) [-291.205] (-288.263) (-289.689) * (-292.105) [-287.746] (-289.381) (-290.691) -- 0:00:23
596000 -- [-290.406] (-289.959) (-288.808) (-290.267) * (-288.490) (-290.363) (-290.684) [-288.439] -- 0:00:23
596500 -- (-288.148) [-292.038] (-290.175) (-291.188) * (-289.160) [-291.142] (-288.789) (-289.787) -- 0:00:23
597000 -- (-290.130) [-293.776] (-288.855) (-292.798) * (-287.753) [-288.408] (-289.421) (-293.510) -- 0:00:23
597500 -- (-290.419) (-288.439) [-290.112] (-289.313) * (-289.584) (-293.333) [-290.088] (-288.528) -- 0:00:23
598000 -- (-288.990) [-288.991] (-288.270) (-289.718) * (-293.747) (-289.917) [-290.618] (-291.665) -- 0:00:23
598500 -- (-290.833) (-289.100) [-289.973] (-289.213) * (-290.716) [-290.408] (-288.772) (-289.749) -- 0:00:23
599000 -- [-290.626] (-299.742) (-291.482) (-289.069) * (-289.189) (-287.351) (-288.975) [-289.982] -- 0:00:23
599500 -- [-291.374] (-294.074) (-290.838) (-290.325) * (-288.801) [-289.438] (-288.679) (-289.950) -- 0:00:23
600000 -- (-289.810) (-291.410) (-288.452) [-289.946] * (-290.731) (-292.396) [-287.959] (-289.702) -- 0:00:23
Average standard deviation of split frequencies: 0.010153
600500 -- (-291.688) [-291.528] (-289.556) (-289.458) * [-288.858] (-292.149) (-289.133) (-291.580) -- 0:00:23
601000 -- [-290.780] (-289.606) (-289.432) (-288.548) * (-290.143) (-288.813) [-290.792] (-291.852) -- 0:00:23
601500 -- [-289.870] (-288.273) (-290.532) (-288.799) * (-290.681) [-289.250] (-291.795) (-290.672) -- 0:00:23
602000 -- [-290.447] (-289.336) (-289.817) (-289.338) * (-288.324) (-287.580) (-289.300) [-289.250] -- 0:00:23
602500 -- (-292.580) (-289.093) (-288.411) [-288.197] * (-291.808) [-288.640] (-288.535) (-288.094) -- 0:00:23
603000 -- (-291.084) (-288.568) [-287.701] (-287.686) * (-288.650) (-290.472) [-287.388] (-288.549) -- 0:00:23
603500 -- (-287.904) (-290.983) (-287.435) [-288.447] * (-291.424) (-289.034) (-291.909) [-288.165] -- 0:00:22
604000 -- (-290.537) [-288.219] (-288.121) (-291.739) * (-288.834) (-289.825) (-291.532) [-289.478] -- 0:00:22
604500 -- [-288.871] (-287.351) (-287.895) (-289.158) * (-288.050) [-291.619] (-288.174) (-287.769) -- 0:00:22
605000 -- (-290.952) (-289.516) [-288.990] (-289.228) * (-291.802) (-290.257) [-289.881] (-294.737) -- 0:00:22
Average standard deviation of split frequencies: 0.010307
605500 -- [-290.990] (-290.217) (-289.670) (-288.454) * (-288.357) (-288.208) (-288.206) [-290.497] -- 0:00:22
606000 -- (-289.966) (-295.062) (-289.910) [-289.049] * (-287.628) (-287.999) [-289.045] (-288.652) -- 0:00:22
606500 -- (-289.072) (-290.267) (-289.668) [-289.292] * (-289.122) [-287.555] (-290.741) (-292.064) -- 0:00:22
607000 -- (-291.706) (-293.300) (-290.110) [-288.605] * (-288.845) [-287.712] (-292.139) (-293.877) -- 0:00:22
607500 -- (-290.456) (-287.553) [-289.061] (-290.852) * [-288.860] (-289.001) (-295.432) (-290.638) -- 0:00:22
608000 -- (-293.489) (-291.581) [-289.685] (-291.010) * (-290.421) [-287.951] (-289.149) (-290.861) -- 0:00:22
608500 -- (-289.810) [-289.969] (-289.181) (-292.034) * (-290.727) (-292.216) [-290.327] (-291.737) -- 0:00:22
609000 -- (-292.742) [-290.631] (-288.607) (-290.673) * [-290.742] (-289.080) (-290.318) (-287.949) -- 0:00:23
609500 -- [-292.644] (-294.483) (-290.383) (-289.936) * (-290.620) (-289.710) [-289.509] (-292.632) -- 0:00:23
610000 -- (-293.090) (-292.266) [-287.671] (-289.821) * (-290.094) (-289.731) (-289.163) [-288.533] -- 0:00:23
Average standard deviation of split frequencies: 0.010325
610500 -- (-289.560) (-293.392) (-292.476) [-289.266] * (-292.526) (-292.655) [-288.637] (-291.534) -- 0:00:22
611000 -- [-291.519] (-290.481) (-290.110) (-290.634) * [-290.213] (-292.127) (-289.450) (-288.798) -- 0:00:22
611500 -- [-288.617] (-289.101) (-297.274) (-291.705) * (-287.620) [-288.825] (-288.812) (-289.969) -- 0:00:22
612000 -- (-289.179) (-289.670) (-289.602) [-288.669] * [-293.904] (-290.678) (-288.735) (-291.228) -- 0:00:22
612500 -- (-290.506) (-289.157) [-288.741] (-290.179) * (-289.941) [-292.605] (-289.321) (-292.016) -- 0:00:22
613000 -- (-289.603) (-287.908) (-292.493) [-288.168] * (-290.719) (-288.521) [-288.931] (-289.455) -- 0:00:22
613500 -- (-289.133) [-287.697] (-287.241) (-290.064) * (-288.607) (-288.048) [-292.165] (-287.620) -- 0:00:22
614000 -- (-290.112) (-291.316) [-290.498] (-289.139) * (-288.530) [-288.703] (-290.712) (-292.288) -- 0:00:22
614500 -- (-289.915) (-289.285) (-289.095) [-288.501] * (-288.244) (-288.454) (-291.532) [-290.894] -- 0:00:22
615000 -- [-290.194] (-290.719) (-291.831) (-289.992) * (-290.609) (-289.564) (-288.603) [-288.916] -- 0:00:22
Average standard deviation of split frequencies: 0.010570
615500 -- [-289.136] (-292.036) (-287.916) (-293.973) * (-289.360) (-290.476) (-289.151) [-292.581] -- 0:00:22
616000 -- (-291.530) [-288.117] (-290.253) (-290.343) * [-291.742] (-290.496) (-292.760) (-293.001) -- 0:00:22
616500 -- (-292.649) (-296.901) (-294.465) [-292.065] * [-289.936] (-289.757) (-289.866) (-293.121) -- 0:00:22
617000 -- (-294.827) (-292.226) (-293.212) [-293.015] * [-288.522] (-287.363) (-287.954) (-290.310) -- 0:00:22
617500 -- [-287.894] (-293.949) (-289.855) (-289.709) * (-287.656) [-289.865] (-289.529) (-292.896) -- 0:00:22
618000 -- (-295.425) (-294.519) (-290.701) [-289.028] * (-297.825) (-292.104) (-288.343) [-289.502] -- 0:00:22
618500 -- (-290.224) (-293.479) (-288.735) [-292.058] * (-291.237) [-292.602] (-287.901) (-292.595) -- 0:00:22
619000 -- (-287.338) (-288.428) (-290.178) [-288.539] * (-290.652) (-289.933) (-287.770) [-288.503] -- 0:00:22
619500 -- (-295.443) (-288.963) [-292.005] (-289.433) * (-289.448) (-289.118) (-287.796) [-288.949] -- 0:00:22
620000 -- (-291.900) (-290.418) [-289.603] (-293.196) * (-289.413) [-294.104] (-287.237) (-287.830) -- 0:00:22
Average standard deviation of split frequencies: 0.010396
620500 -- (-288.993) [-288.917] (-290.381) (-289.290) * [-288.166] (-289.271) (-287.770) (-289.338) -- 0:00:22
621000 -- (-288.455) [-288.170] (-290.789) (-292.344) * (-293.126) [-288.938] (-291.783) (-288.932) -- 0:00:21
621500 -- (-288.879) (-287.582) (-290.039) [-289.455] * (-290.437) (-289.044) (-289.285) [-289.856] -- 0:00:21
622000 -- (-288.818) [-288.304] (-289.298) (-289.520) * (-291.467) [-289.868] (-288.461) (-292.405) -- 0:00:21
622500 -- (-290.529) (-287.960) (-290.124) [-290.528] * (-290.022) (-289.831) (-288.172) [-288.289] -- 0:00:21
623000 -- (-290.806) [-290.319] (-290.744) (-288.776) * (-288.103) [-289.141] (-288.513) (-288.451) -- 0:00:21
623500 -- (-287.690) [-288.223] (-288.970) (-288.462) * (-296.222) (-288.361) [-287.312] (-289.533) -- 0:00:21
624000 -- (-288.628) (-289.262) (-289.335) [-290.277] * (-296.719) (-288.083) [-289.224] (-290.353) -- 0:00:21
624500 -- (-288.247) (-291.025) (-290.846) [-288.677] * (-288.497) (-292.385) (-288.101) [-288.644] -- 0:00:21
625000 -- [-290.207] (-288.303) (-288.091) (-289.197) * (-291.139) (-290.280) (-297.258) [-289.091] -- 0:00:21
Average standard deviation of split frequencies: 0.009931
625500 -- (-290.934) [-288.486] (-289.214) (-290.030) * (-292.099) [-289.479] (-288.195) (-288.886) -- 0:00:21
626000 -- (-290.171) [-289.807] (-289.398) (-290.313) * (-291.501) [-292.548] (-292.342) (-291.198) -- 0:00:21
626500 -- (-291.050) (-287.795) (-289.364) [-288.759] * (-291.511) [-289.925] (-289.885) (-292.975) -- 0:00:22
627000 -- (-288.168) [-288.188] (-290.903) (-289.197) * (-290.294) [-293.378] (-288.357) (-291.488) -- 0:00:22
627500 -- (-291.067) (-288.078) (-288.289) [-288.728] * (-289.373) (-292.643) (-288.581) [-288.878] -- 0:00:21
628000 -- (-291.087) (-290.328) (-288.022) [-289.116] * (-289.675) [-288.362] (-290.640) (-289.479) -- 0:00:21
628500 -- (-289.030) (-288.460) (-288.137) [-288.630] * (-289.952) [-289.030] (-288.902) (-290.328) -- 0:00:21
629000 -- (-290.273) [-287.262] (-289.043) (-288.336) * (-292.461) (-289.902) (-288.781) [-287.736] -- 0:00:21
629500 -- (-295.972) (-291.228) [-289.947] (-288.361) * [-291.964] (-290.076) (-288.230) (-287.964) -- 0:00:21
630000 -- (-290.000) (-288.832) [-289.543] (-287.844) * (-293.804) (-289.489) [-287.948] (-289.689) -- 0:00:21
Average standard deviation of split frequencies: 0.010324
630500 -- (-287.850) (-288.885) [-288.954] (-293.148) * [-290.356] (-288.931) (-288.687) (-291.053) -- 0:00:21
631000 -- [-289.044] (-288.438) (-299.569) (-290.119) * [-289.742] (-288.916) (-290.663) (-288.389) -- 0:00:21
631500 -- (-288.144) (-288.286) (-294.048) [-288.544] * [-291.673] (-287.946) (-289.971) (-290.960) -- 0:00:21
632000 -- (-291.685) [-288.690] (-289.191) (-288.077) * (-291.335) (-287.751) [-290.040] (-290.073) -- 0:00:21
632500 -- [-289.238] (-288.633) (-289.208) (-289.631) * (-290.854) (-287.781) [-290.175] (-288.910) -- 0:00:21
633000 -- (-290.929) [-288.633] (-288.481) (-289.017) * (-291.435) [-290.148] (-291.604) (-288.481) -- 0:00:21
633500 -- [-289.252] (-291.964) (-288.684) (-289.922) * [-287.950] (-295.254) (-288.553) (-292.030) -- 0:00:21
634000 -- (-288.422) [-293.054] (-288.508) (-293.240) * (-289.905) [-292.243] (-289.266) (-290.019) -- 0:00:21
634500 -- [-288.719] (-295.609) (-290.116) (-294.056) * (-289.986) [-288.798] (-290.766) (-289.141) -- 0:00:21
635000 -- (-289.691) [-288.970] (-288.385) (-291.785) * [-288.891] (-287.627) (-288.320) (-288.107) -- 0:00:21
Average standard deviation of split frequencies: 0.010099
635500 -- (-289.602) (-289.430) (-289.762) [-289.901] * [-289.018] (-287.863) (-288.856) (-291.922) -- 0:00:21
636000 -- (-287.930) (-290.096) [-289.527] (-289.339) * [-291.479] (-289.943) (-290.787) (-292.322) -- 0:00:21
636500 -- [-291.191] (-288.339) (-289.027) (-289.586) * [-290.950] (-289.048) (-288.775) (-290.730) -- 0:00:21
637000 -- (-290.246) (-289.967) (-290.367) [-291.281] * (-289.798) (-289.292) (-291.595) [-290.115] -- 0:00:21
637500 -- [-289.166] (-289.104) (-289.375) (-290.567) * (-291.429) [-289.775] (-292.350) (-287.878) -- 0:00:21
638000 -- [-289.788] (-287.591) (-291.596) (-290.901) * [-291.736] (-288.578) (-288.223) (-287.967) -- 0:00:20
638500 -- (-296.864) [-289.267] (-288.274) (-290.052) * (-290.252) [-289.882] (-290.654) (-294.464) -- 0:00:20
639000 -- (-288.784) [-290.682] (-288.875) (-290.544) * (-292.632) [-289.085] (-291.089) (-290.684) -- 0:00:20
639500 -- [-289.643] (-289.980) (-289.776) (-291.546) * [-291.475] (-288.755) (-295.474) (-291.767) -- 0:00:20
640000 -- [-289.370] (-290.106) (-291.844) (-290.126) * (-290.982) (-289.461) [-289.568] (-289.844) -- 0:00:20
Average standard deviation of split frequencies: 0.010163
640500 -- (-289.906) (-292.190) (-290.791) [-289.918] * (-288.814) [-289.510] (-289.250) (-289.088) -- 0:00:20
641000 -- [-288.293] (-290.776) (-291.431) (-289.046) * (-288.863) [-292.109] (-288.634) (-292.325) -- 0:00:20
641500 -- (-289.039) (-289.558) (-291.905) [-289.110] * (-292.875) [-290.691] (-288.166) (-291.005) -- 0:00:20
642000 -- (-289.224) (-289.879) [-288.512] (-291.356) * (-292.795) (-293.241) (-287.483) [-290.327] -- 0:00:20
642500 -- (-294.702) (-289.482) (-288.932) [-289.588] * (-289.420) [-287.601] (-288.330) (-288.773) -- 0:00:20
643000 -- [-288.022] (-288.757) (-290.080) (-289.686) * [-287.938] (-288.812) (-289.735) (-288.480) -- 0:00:20
643500 -- (-288.642) [-290.414] (-293.051) (-290.450) * [-289.208] (-289.299) (-292.393) (-288.404) -- 0:00:21
644000 -- (-294.906) (-289.593) (-288.967) [-288.418] * [-288.313] (-289.383) (-294.937) (-288.648) -- 0:00:21
644500 -- (-290.484) [-289.412] (-289.055) (-287.889) * (-287.595) [-289.455] (-293.750) (-288.629) -- 0:00:20
645000 -- (-287.942) (-294.158) (-288.026) [-288.985] * (-288.142) (-291.718) (-291.891) [-288.247] -- 0:00:20
Average standard deviation of split frequencies: 0.009578
645500 -- (-288.583) (-291.394) [-288.802] (-288.958) * (-289.539) [-289.434] (-289.346) (-289.955) -- 0:00:20
646000 -- (-291.111) (-291.255) (-287.985) [-289.850] * (-290.168) [-287.776] (-288.373) (-289.499) -- 0:00:20
646500 -- (-290.528) [-287.966] (-287.821) (-290.136) * (-290.902) (-288.110) [-289.545] (-288.577) -- 0:00:20
647000 -- (-287.808) [-288.412] (-287.195) (-289.633) * (-289.036) [-287.461] (-289.510) (-289.610) -- 0:00:20
647500 -- [-288.075] (-294.329) (-289.976) (-289.449) * [-291.433] (-289.212) (-288.990) (-291.901) -- 0:00:20
648000 -- (-287.156) (-289.482) (-289.377) [-288.350] * (-294.269) [-293.179] (-290.026) (-290.160) -- 0:00:20
648500 -- [-288.884] (-288.953) (-290.847) (-289.520) * [-293.865] (-290.227) (-292.004) (-289.603) -- 0:00:20
649000 -- (-287.820) (-288.450) [-291.807] (-291.864) * [-292.091] (-292.872) (-288.191) (-290.726) -- 0:00:20
649500 -- [-292.467] (-290.141) (-294.465) (-292.952) * (-290.229) (-294.215) (-289.549) [-289.790] -- 0:00:20
650000 -- (-296.400) (-289.501) [-295.294] (-293.820) * (-289.108) [-288.201] (-290.039) (-288.974) -- 0:00:20
Average standard deviation of split frequencies: 0.008739
650500 -- [-294.139] (-290.635) (-289.726) (-293.110) * (-287.731) (-289.710) [-292.081] (-290.129) -- 0:00:20
651000 -- (-289.861) (-289.259) [-289.102] (-288.536) * [-287.546] (-293.492) (-289.321) (-290.933) -- 0:00:20
651500 -- (-291.104) (-293.818) (-289.160) [-288.724] * (-287.759) [-291.510] (-289.110) (-287.867) -- 0:00:20
652000 -- (-288.841) [-288.638] (-289.624) (-288.294) * (-290.775) (-288.075) (-287.902) [-289.693] -- 0:00:20
652500 -- (-289.952) (-289.226) (-288.354) [-290.662] * (-289.831) (-291.007) (-288.475) [-289.272] -- 0:00:20
653000 -- (-287.852) (-289.316) (-290.589) [-292.348] * (-287.410) [-289.056] (-290.370) (-291.253) -- 0:00:20
653500 -- (-288.589) (-289.765) [-292.442] (-293.003) * [-289.181] (-290.795) (-295.593) (-288.369) -- 0:00:20
654000 -- (-289.678) (-289.917) (-289.344) [-289.299] * [-287.865] (-290.844) (-289.089) (-289.276) -- 0:00:20
654500 -- (-287.753) (-298.102) [-288.294] (-290.170) * [-292.078] (-290.780) (-290.156) (-288.824) -- 0:00:20
655000 -- (-289.622) [-293.221] (-289.711) (-288.903) * [-288.720] (-288.016) (-289.887) (-287.436) -- 0:00:20
Average standard deviation of split frequencies: 0.008309
655500 -- (-290.578) (-291.565) [-289.133] (-289.432) * (-290.079) (-288.661) [-287.584] (-296.103) -- 0:00:19
656000 -- [-293.300] (-292.249) (-288.160) (-290.116) * (-289.419) (-288.426) [-291.822] (-291.294) -- 0:00:19
656500 -- (-288.457) (-288.582) (-288.410) [-287.683] * [-289.710] (-288.972) (-293.009) (-289.806) -- 0:00:19
657000 -- (-289.584) [-289.572] (-290.151) (-287.594) * [-287.508] (-295.880) (-292.056) (-291.104) -- 0:00:19
657500 -- (-291.527) [-291.280] (-289.703) (-289.004) * (-287.857) [-291.388] (-288.743) (-288.989) -- 0:00:19
658000 -- (-297.073) (-289.216) [-290.211] (-294.343) * (-288.936) (-289.618) (-289.763) [-288.788] -- 0:00:19
658500 -- (-291.145) (-289.833) [-287.324] (-290.396) * (-294.732) [-288.408] (-289.035) (-290.877) -- 0:00:19
659000 -- (-288.788) (-288.561) [-289.628] (-292.177) * (-291.548) [-289.069] (-292.926) (-290.002) -- 0:00:19
659500 -- (-287.414) [-289.243] (-289.588) (-289.145) * (-289.526) (-289.871) [-289.213] (-290.641) -- 0:00:19
660000 -- [-287.842] (-291.000) (-290.142) (-294.262) * (-291.429) [-288.726] (-288.650) (-289.357) -- 0:00:19
Average standard deviation of split frequencies: 0.008206
660500 -- (-287.714) (-290.443) (-292.567) [-289.861] * (-288.420) [-288.708] (-288.427) (-289.011) -- 0:00:19
661000 -- (-288.671) [-288.090] (-293.292) (-288.569) * (-288.551) (-288.001) [-288.293] (-289.174) -- 0:00:20
661500 -- (-289.115) (-288.640) (-291.840) [-288.514] * (-288.423) (-289.431) [-288.726] (-291.176) -- 0:00:19
662000 -- (-290.155) [-289.011] (-292.250) (-289.412) * (-291.639) (-293.033) [-287.616] (-288.660) -- 0:00:19
662500 -- (-291.435) (-290.206) [-289.608] (-288.830) * (-288.793) (-291.163) (-289.221) [-290.192] -- 0:00:19
663000 -- [-291.418] (-289.015) (-287.521) (-290.041) * (-292.968) (-297.772) (-292.030) [-288.832] -- 0:00:19
663500 -- (-288.786) (-289.025) (-289.406) [-288.914] * (-288.176) [-291.473] (-294.874) (-289.459) -- 0:00:19
664000 -- (-288.733) [-289.583] (-290.844) (-290.001) * (-288.009) [-290.903] (-291.632) (-290.125) -- 0:00:19
664500 -- (-290.534) (-290.246) [-289.684] (-289.846) * (-291.293) (-296.210) [-288.837] (-288.771) -- 0:00:19
665000 -- (-287.512) [-291.210] (-289.690) (-290.604) * (-289.133) [-291.096] (-291.176) (-289.191) -- 0:00:19
Average standard deviation of split frequencies: 0.008140
665500 -- (-288.349) (-289.238) (-288.364) [-288.126] * (-288.236) (-290.207) (-288.413) [-288.132] -- 0:00:19
666000 -- (-288.817) (-290.197) [-288.907] (-289.552) * (-293.518) (-292.419) (-289.403) [-288.258] -- 0:00:19
666500 -- (-288.094) [-291.656] (-291.743) (-287.405) * (-290.542) [-293.863] (-288.065) (-287.994) -- 0:00:19
667000 -- [-287.875] (-289.520) (-291.452) (-288.794) * [-290.321] (-292.964) (-289.353) (-294.803) -- 0:00:19
667500 -- (-290.206) [-289.803] (-287.947) (-291.526) * (-289.263) (-290.448) (-290.437) [-291.856] -- 0:00:19
668000 -- [-287.289] (-289.746) (-290.115) (-292.581) * (-290.530) [-291.891] (-290.756) (-294.261) -- 0:00:19
668500 -- (-288.686) (-287.634) [-290.646] (-288.380) * (-291.041) (-296.501) (-289.048) [-289.771] -- 0:00:19
669000 -- (-290.956) (-287.486) (-288.737) [-288.041] * (-290.172) (-288.048) [-289.131] (-291.679) -- 0:00:19
669500 -- (-288.210) (-289.106) (-289.588) [-291.200] * [-288.060] (-289.536) (-290.313) (-291.364) -- 0:00:19
670000 -- (-287.796) [-287.632] (-289.306) (-292.513) * (-288.147) (-291.302) [-289.039] (-288.550) -- 0:00:19
Average standard deviation of split frequencies: 0.008215
670500 -- (-288.163) [-287.689] (-288.301) (-287.760) * [-292.652] (-289.629) (-287.863) (-287.822) -- 0:00:19
671000 -- [-288.279] (-290.456) (-290.802) (-288.215) * (-288.854) (-288.877) [-288.565] (-289.021) -- 0:00:19
671500 -- [-288.987] (-290.404) (-290.691) (-290.001) * (-289.884) (-289.605) [-289.473] (-289.188) -- 0:00:19
672000 -- (-289.576) [-288.182] (-288.627) (-287.754) * (-288.449) (-289.166) [-288.804] (-291.647) -- 0:00:19
672500 -- (-290.526) (-290.493) [-287.649] (-288.164) * (-290.959) (-289.289) [-288.256] (-288.383) -- 0:00:18
673000 -- [-288.121] (-287.634) (-289.029) (-290.694) * [-287.503] (-288.784) (-289.135) (-288.339) -- 0:00:18
673500 -- (-290.330) (-293.965) [-287.500] (-290.390) * (-292.692) [-287.460] (-289.530) (-292.450) -- 0:00:18
674000 -- (-289.715) (-291.633) (-292.020) [-292.652] * [-289.588] (-290.756) (-289.162) (-288.071) -- 0:00:18
674500 -- (-289.204) (-287.542) [-287.871] (-290.648) * (-288.475) (-288.661) [-289.001] (-288.443) -- 0:00:18
675000 -- (-290.873) (-287.341) [-287.365] (-290.169) * (-289.909) [-287.396] (-291.291) (-289.172) -- 0:00:18
Average standard deviation of split frequencies: 0.008063
675500 -- [-290.397] (-290.791) (-287.985) (-295.681) * [-289.655] (-288.310) (-290.756) (-288.869) -- 0:00:18
676000 -- (-291.552) (-292.559) (-288.278) [-287.708] * [-291.062] (-289.974) (-298.841) (-290.756) -- 0:00:18
676500 -- [-290.019] (-289.619) (-287.650) (-291.434) * (-291.054) (-291.582) (-287.577) [-290.269] -- 0:00:18
677000 -- [-291.466] (-288.268) (-287.482) (-290.091) * (-288.542) (-291.704) (-288.272) [-288.311] -- 0:00:18
677500 -- (-289.766) [-288.318] (-291.490) (-288.055) * (-289.249) [-288.631] (-289.451) (-287.719) -- 0:00:18
678000 -- (-287.672) (-289.555) (-288.361) [-291.855] * (-288.445) [-287.465] (-289.732) (-292.868) -- 0:00:18
678500 -- (-287.549) [-289.388] (-289.305) (-289.570) * (-290.692) [-290.376] (-288.394) (-287.804) -- 0:00:18
679000 -- (-288.719) (-288.357) [-290.738] (-288.461) * (-288.591) (-290.045) [-288.837] (-289.721) -- 0:00:18
679500 -- [-288.818] (-289.840) (-290.911) (-288.885) * [-288.281] (-291.200) (-289.313) (-289.157) -- 0:00:18
680000 -- (-287.822) (-288.744) (-290.149) [-288.372] * [-288.009] (-288.706) (-288.922) (-289.743) -- 0:00:18
Average standard deviation of split frequencies: 0.008138
680500 -- [-289.685] (-289.640) (-293.531) (-292.376) * (-291.609) (-287.477) (-290.778) [-290.450] -- 0:00:18
681000 -- (-288.418) (-288.704) (-290.773) [-294.630] * (-292.243) (-287.875) [-289.560] (-290.295) -- 0:00:18
681500 -- (-291.085) [-291.588] (-290.346) (-295.180) * (-290.622) (-288.783) [-289.472] (-293.899) -- 0:00:18
682000 -- (-287.801) [-289.814] (-289.492) (-291.311) * [-292.467] (-294.167) (-289.795) (-296.343) -- 0:00:18
682500 -- (-288.082) [-288.360] (-289.946) (-289.224) * (-287.349) (-293.894) [-289.265] (-294.217) -- 0:00:18
683000 -- (-289.755) (-290.164) [-295.535] (-292.164) * [-287.291] (-289.938) (-290.241) (-288.394) -- 0:00:18
683500 -- (-288.819) (-288.287) (-292.310) [-291.089] * [-293.573] (-289.927) (-291.115) (-289.754) -- 0:00:18
684000 -- (-289.821) [-289.372] (-297.054) (-293.367) * (-290.900) (-289.817) (-289.406) [-291.995] -- 0:00:18
684500 -- [-293.883] (-289.410) (-289.300) (-288.080) * (-289.102) (-292.217) [-290.119] (-289.744) -- 0:00:18
685000 -- (-288.845) (-290.462) [-288.632] (-288.779) * [-288.611] (-291.098) (-289.763) (-290.553) -- 0:00:18
Average standard deviation of split frequencies: 0.007988
685500 -- [-289.785] (-288.689) (-290.652) (-291.161) * (-289.079) (-289.165) (-290.314) [-292.197] -- 0:00:18
686000 -- (-291.873) [-289.830] (-290.607) (-292.564) * (-290.143) [-289.288] (-297.628) (-291.881) -- 0:00:18
686500 -- [-288.113] (-292.372) (-289.891) (-289.022) * [-288.726] (-291.931) (-299.426) (-293.106) -- 0:00:18
687000 -- [-288.602] (-288.001) (-288.577) (-288.630) * [-288.155] (-290.193) (-291.147) (-290.038) -- 0:00:18
687500 -- [-289.490] (-287.741) (-288.773) (-287.726) * (-292.623) (-290.137) [-289.043] (-290.099) -- 0:00:18
688000 -- (-290.037) (-292.037) [-289.076] (-288.321) * [-289.782] (-289.666) (-288.293) (-292.253) -- 0:00:18
688500 -- (-289.675) (-290.979) (-290.399) [-288.858] * [-290.023] (-287.328) (-287.958) (-295.813) -- 0:00:18
689000 -- (-291.729) (-289.380) [-289.313] (-288.750) * [-291.894] (-290.565) (-290.958) (-295.574) -- 0:00:18
689500 -- (-290.837) (-289.076) [-290.889] (-288.860) * [-290.792] (-288.095) (-294.212) (-293.272) -- 0:00:18
690000 -- (-291.599) [-289.537] (-289.979) (-288.476) * (-288.283) (-288.354) (-289.009) [-290.804] -- 0:00:17
Average standard deviation of split frequencies: 0.008233
690500 -- [-289.310] (-288.414) (-292.504) (-290.947) * (-288.602) [-289.984] (-289.276) (-291.524) -- 0:00:17
691000 -- (-289.231) (-287.645) (-291.842) [-287.730] * (-289.013) [-288.385] (-288.410) (-290.743) -- 0:00:17
691500 -- [-293.779] (-294.530) (-288.637) (-290.667) * (-293.277) (-291.012) (-290.263) [-289.743] -- 0:00:17
692000 -- (-289.534) [-291.435] (-288.228) (-289.663) * (-290.921) (-289.456) (-288.492) [-294.005] -- 0:00:17
692500 -- (-294.145) (-290.010) (-289.607) [-289.099] * (-292.998) [-290.980] (-290.002) (-294.278) -- 0:00:17
693000 -- (-292.407) (-289.187) [-292.088] (-289.251) * (-292.762) [-287.945] (-291.470) (-289.387) -- 0:00:17
693500 -- (-289.966) (-289.470) (-289.006) [-294.155] * (-291.378) (-289.213) (-289.590) [-288.197] -- 0:00:17
694000 -- [-288.280] (-287.631) (-288.584) (-289.271) * (-291.094) [-289.387] (-288.799) (-287.715) -- 0:00:17
694500 -- (-295.051) (-289.046) [-287.540] (-291.365) * [-290.844] (-290.099) (-288.468) (-289.078) -- 0:00:17
695000 -- (-288.608) [-288.041] (-288.490) (-291.447) * (-291.614) [-290.127] (-288.960) (-289.779) -- 0:00:17
Average standard deviation of split frequencies: 0.008845
695500 -- (-289.730) [-288.565] (-290.245) (-287.609) * [-287.967] (-290.518) (-288.212) (-289.380) -- 0:00:17
696000 -- [-289.070] (-287.896) (-296.651) (-287.404) * [-288.194] (-288.881) (-288.832) (-290.706) -- 0:00:17
696500 -- [-288.182] (-288.811) (-294.947) (-288.684) * [-287.867] (-289.113) (-289.687) (-288.522) -- 0:00:17
697000 -- (-292.062) [-290.408] (-288.966) (-290.469) * (-287.202) (-288.593) [-292.030] (-290.054) -- 0:00:17
697500 -- (-288.919) [-288.580] (-289.727) (-290.210) * (-290.551) (-287.622) [-291.816] (-287.641) -- 0:00:17
698000 -- (-288.285) [-288.200] (-289.270) (-293.195) * [-289.213] (-288.826) (-291.224) (-290.639) -- 0:00:17
698500 -- (-288.798) (-290.601) [-288.290] (-294.206) * [-288.002] (-291.552) (-290.955) (-291.291) -- 0:00:17
699000 -- (-290.001) [-288.809] (-292.389) (-287.741) * (-287.747) [-294.129] (-290.397) (-288.805) -- 0:00:17
699500 -- (-292.601) [-288.886] (-290.081) (-290.100) * [-290.240] (-291.748) (-290.931) (-294.111) -- 0:00:17
700000 -- (-292.919) (-287.994) (-289.246) [-288.808] * [-288.009] (-289.440) (-291.907) (-288.564) -- 0:00:17
Average standard deviation of split frequencies: 0.008984
700500 -- (-290.293) (-289.313) [-287.776] (-287.810) * (-288.203) (-290.150) [-295.198] (-289.252) -- 0:00:17
701000 -- (-291.220) (-288.576) (-288.463) [-288.748] * (-288.003) [-288.693] (-292.207) (-289.676) -- 0:00:17
701500 -- (-287.832) (-289.135) [-288.630] (-290.033) * (-291.471) (-288.869) [-288.281] (-289.123) -- 0:00:17
702000 -- (-291.646) (-294.899) (-287.953) [-289.291] * (-290.730) (-289.328) (-288.302) [-288.348] -- 0:00:17
702500 -- [-288.412] (-295.110) (-289.307) (-288.246) * (-290.920) (-291.022) (-288.097) [-287.820] -- 0:00:17
703000 -- [-288.583] (-296.595) (-288.976) (-289.282) * (-288.930) [-289.889] (-289.924) (-288.828) -- 0:00:17
703500 -- [-288.785] (-291.054) (-289.812) (-293.895) * (-288.950) [-289.656] (-287.442) (-292.186) -- 0:00:17
704000 -- (-288.374) (-289.796) [-293.330] (-291.049) * [-288.492] (-288.117) (-290.843) (-289.380) -- 0:00:17
704500 -- (-289.407) (-292.788) (-290.638) [-288.289] * [-288.055] (-288.906) (-288.032) (-290.711) -- 0:00:17
705000 -- (-289.809) (-290.267) (-291.170) [-290.746] * [-288.454] (-290.727) (-287.606) (-288.495) -- 0:00:17
Average standard deviation of split frequencies: 0.009544
705500 -- (-289.077) [-289.750] (-291.259) (-291.350) * (-288.620) (-293.869) (-289.036) [-288.496] -- 0:00:17
706000 -- (-289.684) (-287.923) [-290.406] (-289.481) * (-289.722) (-287.909) (-289.176) [-288.186] -- 0:00:17
706500 -- [-290.724] (-288.290) (-288.716) (-287.547) * (-294.547) [-287.377] (-289.794) (-289.031) -- 0:00:17
707000 -- [-288.459] (-288.783) (-289.175) (-288.000) * (-290.668) [-290.741] (-294.019) (-289.864) -- 0:00:16
707500 -- (-289.029) (-289.423) (-287.534) [-291.331] * (-289.190) (-289.520) [-289.281] (-289.556) -- 0:00:16
708000 -- [-288.311] (-289.021) (-288.307) (-290.073) * (-287.940) (-289.721) (-290.061) [-287.172] -- 0:00:16
708500 -- (-288.485) (-291.610) (-289.983) [-288.834] * [-289.314] (-290.697) (-290.098) (-289.355) -- 0:00:16
709000 -- (-296.483) [-287.424] (-292.481) (-294.293) * [-291.097] (-289.685) (-287.929) (-288.519) -- 0:00:16
709500 -- (-290.251) [-289.131] (-290.282) (-289.979) * (-290.845) [-288.816] (-289.032) (-288.690) -- 0:00:16
710000 -- (-289.553) [-287.284] (-288.607) (-287.320) * (-289.530) (-287.680) (-288.938) [-290.471] -- 0:00:16
Average standard deviation of split frequencies: 0.009287
710500 -- (-296.093) (-288.199) [-291.792] (-288.500) * (-293.139) (-287.966) (-290.679) [-292.785] -- 0:00:16
711000 -- (-294.779) (-290.723) (-292.504) [-290.866] * (-290.208) (-290.576) [-287.129] (-292.851) -- 0:00:16
711500 -- (-291.075) (-288.743) [-288.780] (-287.862) * [-289.111] (-291.083) (-290.845) (-289.379) -- 0:00:16
712000 -- (-288.487) [-291.337] (-289.155) (-288.202) * (-290.915) (-288.537) [-292.191] (-291.951) -- 0:00:16
712500 -- (-292.202) [-290.052] (-287.943) (-290.042) * (-290.925) [-292.143] (-289.369) (-292.486) -- 0:00:16
713000 -- (-289.653) (-290.489) [-292.858] (-291.749) * (-290.264) [-289.970] (-290.231) (-290.796) -- 0:00:16
713500 -- [-288.860] (-289.681) (-288.460) (-287.536) * [-288.691] (-291.863) (-291.870) (-287.841) -- 0:00:16
714000 -- (-291.074) (-291.249) (-292.513) [-288.303] * [-289.354] (-288.954) (-290.383) (-288.926) -- 0:00:16
714500 -- (-288.917) (-292.343) [-291.710] (-289.026) * [-287.871] (-288.530) (-288.273) (-290.548) -- 0:00:16
715000 -- (-289.616) (-289.825) [-288.171] (-292.471) * (-287.917) [-288.742] (-288.495) (-288.534) -- 0:00:16
Average standard deviation of split frequencies: 0.008946
715500 -- [-290.499] (-291.270) (-289.303) (-289.103) * (-289.584) (-289.204) [-287.663] (-291.942) -- 0:00:16
716000 -- [-287.997] (-288.004) (-289.284) (-289.285) * [-287.882] (-288.563) (-289.295) (-288.661) -- 0:00:16
716500 -- [-291.416] (-293.148) (-287.386) (-289.677) * (-288.056) (-290.263) [-288.896] (-297.516) -- 0:00:16
717000 -- (-288.483) [-288.355] (-289.246) (-291.211) * (-289.548) (-288.857) [-290.082] (-296.996) -- 0:00:16
717500 -- (-293.093) [-289.347] (-288.822) (-293.766) * [-291.374] (-289.071) (-288.507) (-291.252) -- 0:00:16
718000 -- (-294.516) (-287.210) (-289.202) [-292.756] * (-293.485) (-290.568) (-288.783) [-288.732] -- 0:00:16
718500 -- (-296.339) (-287.403) [-290.546] (-287.540) * (-291.234) [-288.260] (-287.801) (-292.954) -- 0:00:16
719000 -- (-289.680) [-290.384] (-290.450) (-291.933) * (-293.156) (-288.988) [-287.531] (-290.157) -- 0:00:16
719500 -- (-293.552) [-289.572] (-292.405) (-290.070) * (-292.599) (-289.515) [-287.447] (-296.070) -- 0:00:16
720000 -- (-293.433) (-290.452) (-288.838) [-287.919] * (-289.460) (-288.158) (-293.992) [-289.105] -- 0:00:16
Average standard deviation of split frequencies: 0.008427
720500 -- (-290.159) (-288.825) [-287.571] (-288.402) * (-288.435) (-290.410) [-291.575] (-291.466) -- 0:00:16
721000 -- (-289.096) (-289.721) [-287.792] (-289.848) * [-288.481] (-291.975) (-293.973) (-289.204) -- 0:00:16
721500 -- (-287.575) [-290.583] (-290.195) (-288.527) * [-288.653] (-288.121) (-289.129) (-290.244) -- 0:00:16
722000 -- [-291.761] (-290.829) (-289.298) (-289.677) * [-289.175] (-291.738) (-287.648) (-290.677) -- 0:00:16
722500 -- [-289.359] (-288.971) (-288.078) (-287.515) * [-288.611] (-289.242) (-289.571) (-288.323) -- 0:00:16
723000 -- (-287.795) (-288.887) (-290.431) [-290.571] * (-291.977) (-289.464) [-289.180] (-292.034) -- 0:00:16
723500 -- [-288.099] (-287.764) (-288.726) (-290.475) * [-296.772] (-288.364) (-289.604) (-287.917) -- 0:00:16
724000 -- (-291.792) (-292.715) (-288.131) [-288.583] * (-288.598) (-290.836) [-291.790] (-287.899) -- 0:00:16
724500 -- [-290.447] (-289.182) (-289.828) (-290.398) * (-290.744) (-288.896) (-290.471) [-287.806] -- 0:00:15
725000 -- (-290.041) [-288.302] (-289.512) (-289.838) * (-289.475) (-288.979) [-293.956] (-288.935) -- 0:00:15
Average standard deviation of split frequencies: 0.008403
725500 -- (-289.610) (-290.691) [-289.994] (-289.692) * (-290.367) (-289.298) [-289.481] (-289.316) -- 0:00:15
726000 -- [-288.926] (-289.612) (-288.736) (-288.587) * [-290.362] (-287.556) (-291.387) (-292.568) -- 0:00:15
726500 -- (-288.411) (-293.154) (-289.613) [-291.253] * (-290.617) (-288.017) [-292.324] (-289.825) -- 0:00:15
727000 -- (-289.902) [-289.694] (-287.773) (-288.237) * (-291.103) (-288.598) (-288.276) [-289.118] -- 0:00:15
727500 -- (-289.932) (-290.508) [-289.307] (-289.449) * (-287.789) (-288.478) (-289.441) [-287.998] -- 0:00:15
728000 -- (-288.795) [-292.207] (-288.831) (-288.868) * [-287.667] (-287.641) (-291.503) (-288.826) -- 0:00:15
728500 -- [-289.204] (-289.747) (-292.119) (-289.070) * (-288.552) (-288.553) [-289.841] (-294.203) -- 0:00:15
729000 -- [-292.702] (-288.106) (-291.082) (-290.236) * (-288.247) [-287.861] (-291.659) (-293.550) -- 0:00:15
729500 -- (-289.570) [-287.983] (-289.623) (-288.999) * (-291.904) (-290.746) (-289.072) [-287.460] -- 0:00:15
730000 -- (-287.348) (-289.158) [-291.413] (-291.704) * (-287.719) [-287.565] (-293.280) (-287.914) -- 0:00:15
Average standard deviation of split frequencies: 0.008425
730500 -- (-288.636) [-288.447] (-295.166) (-291.556) * (-290.816) [-290.042] (-287.287) (-293.062) -- 0:00:15
731000 -- (-288.921) (-287.469) [-290.554] (-290.403) * (-287.683) (-291.311) [-288.462] (-289.756) -- 0:00:15
731500 -- (-288.022) [-287.799] (-289.168) (-291.009) * (-288.897) (-288.255) [-288.923] (-288.763) -- 0:00:15
732000 -- (-288.858) (-289.720) [-291.627] (-288.884) * [-288.825] (-291.022) (-289.848) (-289.431) -- 0:00:15
732500 -- (-289.241) [-289.184] (-294.453) (-287.619) * (-288.154) (-292.253) (-291.453) [-288.478] -- 0:00:15
733000 -- (-290.020) (-292.016) [-288.466] (-294.872) * (-290.730) (-289.940) (-289.463) [-287.533] -- 0:00:15
733500 -- (-292.465) (-289.576) [-288.308] (-287.738) * (-288.649) (-288.074) (-290.266) [-288.241] -- 0:00:15
734000 -- (-288.354) [-289.244] (-292.096) (-288.672) * (-288.259) (-290.150) (-288.693) [-291.817] -- 0:00:15
734500 -- (-289.080) [-287.643] (-288.461) (-289.145) * (-287.939) [-287.838] (-289.881) (-292.619) -- 0:00:15
735000 -- [-288.331] (-290.574) (-290.402) (-288.369) * (-288.715) (-287.512) (-290.105) [-288.444] -- 0:00:15
Average standard deviation of split frequencies: 0.008326
735500 -- [-289.043] (-290.099) (-290.321) (-290.323) * (-291.927) (-289.794) (-292.111) [-288.932] -- 0:00:15
736000 -- (-287.781) (-292.886) (-288.104) [-288.318] * (-287.904) (-289.410) [-288.139] (-290.797) -- 0:00:15
736500 -- (-288.838) (-291.709) [-290.499] (-287.807) * [-287.904] (-288.105) (-292.147) (-290.481) -- 0:00:15
737000 -- (-289.179) (-289.790) [-289.490] (-291.366) * (-288.102) (-288.921) [-288.382] (-291.364) -- 0:00:15
737500 -- (-288.416) (-294.245) (-290.481) [-292.130] * [-288.587] (-289.785) (-288.329) (-288.393) -- 0:00:15
738000 -- (-289.665) [-289.125] (-289.260) (-289.567) * (-291.525) (-289.751) (-289.600) [-293.186] -- 0:00:15
738500 -- (-288.261) (-293.877) [-290.382] (-288.571) * (-288.375) [-288.125] (-291.219) (-291.969) -- 0:00:15
739000 -- (-287.963) (-290.804) [-293.435] (-288.590) * (-287.689) [-290.686] (-290.730) (-290.849) -- 0:00:15
739500 -- [-290.632] (-289.703) (-289.732) (-290.494) * (-291.594) (-288.512) [-288.369] (-294.302) -- 0:00:15
740000 -- (-289.637) [-289.352] (-290.281) (-291.929) * (-289.044) (-287.584) [-296.312] (-290.106) -- 0:00:15
Average standard deviation of split frequencies: 0.008012
740500 -- (-288.192) (-289.602) (-288.424) [-292.023] * (-288.821) (-288.269) (-287.375) [-287.610] -- 0:00:15
741000 -- (-290.375) [-288.014] (-289.561) (-291.402) * (-288.302) (-292.417) [-288.397] (-290.252) -- 0:00:15
741500 -- (-289.849) (-289.938) [-288.627] (-294.449) * (-291.636) (-291.627) (-291.324) [-289.443] -- 0:00:14
742000 -- (-289.752) [-289.865] (-289.991) (-289.944) * (-289.504) (-291.136) [-288.560] (-288.425) -- 0:00:14
742500 -- (-289.475) (-289.916) [-291.848] (-289.019) * (-290.095) (-289.942) (-290.268) [-287.833] -- 0:00:14
743000 -- (-291.034) (-289.175) (-289.044) [-288.720] * (-290.582) (-292.492) (-287.768) [-289.111] -- 0:00:14
743500 -- (-289.038) (-293.493) (-289.528) [-288.938] * (-293.402) (-291.426) (-289.459) [-288.343] -- 0:00:14
744000 -- [-291.169] (-290.832) (-289.307) (-288.098) * (-289.609) [-291.952] (-294.340) (-289.631) -- 0:00:14
744500 -- [-288.189] (-293.368) (-290.618) (-287.275) * (-290.868) [-290.335] (-287.458) (-288.970) -- 0:00:14
745000 -- (-287.997) [-287.689] (-290.281) (-291.656) * [-288.546] (-288.276) (-290.058) (-291.563) -- 0:00:14
Average standard deviation of split frequencies: 0.008178
745500 -- [-287.775] (-287.524) (-290.111) (-289.415) * (-287.649) (-288.753) (-289.657) [-293.643] -- 0:00:14
746000 -- (-288.543) (-290.396) [-291.783] (-287.789) * [-289.999] (-289.072) (-289.341) (-289.846) -- 0:00:14
746500 -- [-290.075] (-291.729) (-289.470) (-288.316) * (-291.064) (-288.140) (-290.646) [-291.373] -- 0:00:14
747000 -- (-288.996) (-292.623) [-289.916] (-290.334) * (-291.017) (-292.819) (-292.270) [-291.501] -- 0:00:14
747500 -- (-288.374) [-288.999] (-294.665) (-288.508) * (-290.437) (-288.956) [-288.134] (-291.692) -- 0:00:14
748000 -- (-288.826) (-289.485) [-287.761] (-288.782) * [-289.639] (-290.206) (-290.517) (-287.696) -- 0:00:14
748500 -- (-288.787) (-289.617) [-289.086] (-289.209) * (-287.571) [-287.709] (-288.600) (-288.914) -- 0:00:14
749000 -- (-288.085) (-288.364) (-288.932) [-288.564] * [-287.558] (-291.221) (-288.347) (-292.388) -- 0:00:14
749500 -- [-290.520] (-292.323) (-287.628) (-287.666) * [-292.777] (-290.397) (-288.484) (-291.218) -- 0:00:14
750000 -- (-290.547) (-290.581) [-290.839] (-288.152) * (-289.231) (-290.404) [-290.317] (-291.226) -- 0:00:14
Average standard deviation of split frequencies: 0.008496
750500 -- [-289.441] (-292.745) (-288.811) (-288.934) * (-289.747) (-288.398) [-288.471] (-292.687) -- 0:00:14
751000 -- (-288.233) [-291.017] (-289.976) (-288.129) * [-290.012] (-288.542) (-293.567) (-288.903) -- 0:00:14
751500 -- (-289.192) (-291.698) [-288.931] (-288.890) * (-289.463) (-290.095) (-288.121) [-288.473] -- 0:00:14
752000 -- (-289.502) (-289.851) [-290.214] (-290.177) * [-292.028] (-288.351) (-288.946) (-288.171) -- 0:00:14
752500 -- (-290.255) (-294.529) (-296.187) [-289.327] * (-290.374) [-289.562] (-290.232) (-291.043) -- 0:00:14
753000 -- (-290.296) [-291.378] (-289.312) (-289.815) * (-288.024) [-291.282] (-291.636) (-289.396) -- 0:00:14
753500 -- (-287.701) (-292.183) [-288.914] (-287.893) * (-288.333) [-288.309] (-289.257) (-288.063) -- 0:00:14
754000 -- (-289.123) [-288.036] (-288.159) (-290.123) * (-287.742) [-291.652] (-289.299) (-290.510) -- 0:00:14
754500 -- (-290.854) (-294.462) (-288.532) [-287.947] * (-293.258) [-289.410] (-289.143) (-289.193) -- 0:00:14
755000 -- (-289.617) (-287.920) [-289.766] (-289.467) * (-289.542) (-289.423) (-294.177) [-289.833] -- 0:00:14
Average standard deviation of split frequencies: 0.007405
755500 -- (-292.677) (-290.874) [-288.695] (-290.296) * [-289.217] (-292.778) (-295.410) (-288.952) -- 0:00:14
756000 -- (-292.430) (-288.120) [-288.716] (-288.902) * (-293.979) [-291.481] (-290.838) (-290.669) -- 0:00:14
756500 -- (-289.830) (-289.208) [-287.917] (-289.548) * (-291.079) [-288.706] (-289.625) (-289.688) -- 0:00:14
757000 -- [-288.460] (-288.648) (-287.682) (-289.302) * (-292.043) (-288.870) [-288.394] (-290.811) -- 0:00:14
757500 -- (-288.585) [-293.355] (-288.048) (-289.816) * (-291.273) (-287.806) [-291.033] (-293.710) -- 0:00:14
758000 -- (-290.202) (-288.437) (-290.939) [-288.604] * (-287.702) (-287.714) (-296.060) [-291.082] -- 0:00:14
758500 -- [-290.895] (-291.136) (-289.279) (-289.156) * [-290.050] (-289.944) (-296.543) (-289.137) -- 0:00:14
759000 -- [-289.608] (-291.906) (-288.654) (-288.205) * (-293.253) (-288.583) (-294.362) [-288.844] -- 0:00:13
759500 -- (-289.058) (-290.925) (-290.330) [-287.930] * (-290.769) (-290.066) (-288.675) [-288.043] -- 0:00:13
760000 -- (-290.171) [-289.667] (-291.182) (-289.205) * (-290.446) (-287.461) [-291.727] (-290.990) -- 0:00:13
Average standard deviation of split frequencies: 0.006972
760500 -- (-290.232) [-288.983] (-293.442) (-291.145) * [-289.991] (-289.612) (-287.691) (-288.856) -- 0:00:13
761000 -- (-290.905) [-289.863] (-288.822) (-290.320) * [-289.294] (-290.558) (-290.466) (-292.511) -- 0:00:13
761500 -- [-290.390] (-288.826) (-287.567) (-289.161) * (-287.793) [-288.752] (-291.207) (-288.245) -- 0:00:13
762000 -- (-289.063) [-291.525] (-289.074) (-292.309) * [-287.866] (-289.355) (-290.450) (-287.758) -- 0:00:13
762500 -- [-288.866] (-291.222) (-287.924) (-290.436) * (-288.246) [-288.675] (-290.499) (-289.058) -- 0:00:13
763000 -- (-290.663) (-288.399) [-290.334] (-293.559) * (-291.931) [-288.352] (-292.303) (-292.502) -- 0:00:13
763500 -- (-292.990) (-288.455) (-288.364) [-291.290] * (-288.708) (-289.301) [-289.967] (-293.144) -- 0:00:13
764000 -- (-289.457) (-288.807) [-290.956] (-288.928) * (-289.050) [-288.015] (-288.727) (-292.109) -- 0:00:13
764500 -- (-291.005) [-290.601] (-291.038) (-289.656) * [-289.217] (-288.246) (-287.596) (-292.501) -- 0:00:13
765000 -- (-287.550) (-289.054) (-290.877) [-288.845] * [-289.298] (-292.366) (-289.293) (-291.916) -- 0:00:13
Average standard deviation of split frequencies: 0.007500
765500 -- (-291.657) (-292.388) (-291.884) [-287.345] * (-288.853) [-290.251] (-288.552) (-289.124) -- 0:00:13
766000 -- (-288.923) [-288.619] (-291.991) (-290.912) * (-290.339) [-288.318] (-291.771) (-292.231) -- 0:00:13
766500 -- (-289.360) (-288.616) [-288.012] (-287.964) * (-289.731) (-288.412) [-292.089] (-290.540) -- 0:00:13
767000 -- (-289.915) [-288.541] (-290.518) (-288.704) * [-289.064] (-287.962) (-291.871) (-290.155) -- 0:00:13
767500 -- (-288.501) [-289.603] (-289.108) (-289.990) * (-288.061) (-293.607) [-288.019] (-291.281) -- 0:00:13
768000 -- (-290.086) (-290.873) [-290.347] (-293.139) * [-288.638] (-295.225) (-287.782) (-291.056) -- 0:00:13
768500 -- (-288.510) (-291.973) [-290.328] (-289.440) * (-288.000) (-287.734) [-291.028] (-289.692) -- 0:00:13
769000 -- [-292.230] (-293.007) (-291.929) (-289.732) * [-287.926] (-293.436) (-292.155) (-287.666) -- 0:00:13
769500 -- [-288.499] (-287.788) (-288.115) (-290.434) * (-289.356) (-292.912) (-291.575) [-288.820] -- 0:00:13
770000 -- (-289.121) (-287.926) (-288.590) [-287.310] * [-289.521] (-288.379) (-287.442) (-292.925) -- 0:00:13
Average standard deviation of split frequencies: 0.007264
770500 -- (-290.852) (-288.670) [-288.729] (-287.559) * (-292.399) [-289.062] (-289.769) (-287.345) -- 0:00:13
771000 -- (-289.593) (-289.076) (-289.557) [-287.790] * [-289.772] (-287.385) (-288.703) (-292.823) -- 0:00:13
771500 -- (-294.599) (-289.876) [-288.434] (-288.824) * [-288.197] (-290.132) (-288.628) (-290.171) -- 0:00:13
772000 -- (-288.629) (-288.469) (-292.861) [-291.960] * (-289.354) (-288.231) [-288.466] (-294.485) -- 0:00:13
772500 -- (-297.286) [-289.701] (-293.962) (-289.426) * (-287.834) (-288.314) [-289.308] (-291.787) -- 0:00:13
773000 -- [-290.239] (-287.895) (-293.916) (-290.057) * (-287.780) [-294.196] (-290.226) (-288.810) -- 0:00:13
773500 -- [-288.434] (-287.913) (-294.534) (-291.096) * (-289.913) (-289.673) (-287.913) [-287.503] -- 0:00:13
774000 -- (-289.776) (-292.544) (-289.393) [-291.415] * [-288.711] (-288.917) (-291.493) (-292.921) -- 0:00:13
774500 -- [-288.249] (-288.934) (-290.156) (-291.380) * (-289.406) (-294.508) [-290.381] (-290.468) -- 0:00:13
775000 -- [-289.586] (-289.398) (-288.073) (-289.868) * [-291.485] (-293.706) (-290.307) (-290.873) -- 0:00:13
Average standard deviation of split frequencies: 0.007290
775500 -- (-291.719) [-289.961] (-288.648) (-298.806) * (-289.322) (-288.851) [-289.213] (-298.282) -- 0:00:13
776000 -- [-289.622] (-287.582) (-296.714) (-288.370) * (-287.994) [-290.540] (-288.781) (-288.844) -- 0:00:12
776500 -- (-290.736) [-288.879] (-291.267) (-290.924) * [-288.917] (-288.242) (-289.237) (-290.778) -- 0:00:12
777000 -- (-291.691) [-290.419] (-289.109) (-289.114) * (-289.845) [-289.958] (-288.447) (-288.416) -- 0:00:12
777500 -- (-289.453) [-289.366] (-291.522) (-287.607) * (-291.425) (-288.260) [-290.005] (-289.408) -- 0:00:12
778000 -- (-289.553) (-289.403) [-287.733] (-288.142) * (-288.486) [-288.877] (-296.641) (-288.083) -- 0:00:12
778500 -- (-292.478) (-289.083) (-290.551) [-290.481] * (-289.652) [-288.285] (-289.789) (-289.558) -- 0:00:12
779000 -- (-291.019) (-291.324) [-289.180] (-293.296) * (-290.317) (-291.462) (-289.824) [-288.417] -- 0:00:12
779500 -- [-287.811] (-290.713) (-288.742) (-290.353) * [-289.709] (-290.302) (-289.854) (-289.898) -- 0:00:12
780000 -- [-288.183] (-292.719) (-288.838) (-293.690) * [-289.178] (-288.120) (-292.217) (-292.023) -- 0:00:12
Average standard deviation of split frequencies: 0.008276
780500 -- [-289.390] (-287.236) (-289.579) (-288.640) * [-292.937] (-289.965) (-295.449) (-288.950) -- 0:00:12
781000 -- (-291.127) (-289.947) [-290.325] (-292.252) * [-289.436] (-288.865) (-288.688) (-288.924) -- 0:00:12
781500 -- (-289.840) [-291.722] (-287.784) (-292.746) * (-295.756) (-291.972) (-288.543) [-288.263] -- 0:00:12
782000 -- (-289.414) (-290.221) [-289.494] (-292.115) * (-290.104) (-292.965) [-287.614] (-290.309) -- 0:00:12
782500 -- (-290.987) [-287.762] (-289.653) (-289.741) * (-288.425) (-289.376) [-288.504] (-296.751) -- 0:00:12
783000 -- (-290.803) (-290.686) (-293.096) [-288.217] * (-287.457) [-288.573] (-288.626) (-290.647) -- 0:00:12
783500 -- (-292.948) (-289.327) [-289.117] (-290.437) * (-289.659) (-288.258) [-288.571] (-291.006) -- 0:00:12
784000 -- [-292.181] (-288.157) (-289.581) (-289.745) * (-288.917) (-288.442) [-287.906] (-288.211) -- 0:00:12
784500 -- (-288.542) (-287.793) (-287.358) [-290.001] * (-288.729) (-287.738) [-288.322] (-289.747) -- 0:00:12
785000 -- (-290.764) (-287.697) (-287.623) [-288.473] * (-291.779) (-290.787) [-288.374] (-287.637) -- 0:00:12
Average standard deviation of split frequencies: 0.008467
785500 -- (-288.706) [-287.365] (-292.563) (-288.387) * (-291.819) (-292.056) [-289.296] (-292.081) -- 0:00:12
786000 -- (-289.151) (-288.085) (-290.923) [-288.938] * (-290.085) [-291.381] (-289.324) (-290.183) -- 0:00:12
786500 -- [-289.659] (-288.238) (-293.203) (-289.018) * (-291.548) [-289.932] (-288.716) (-293.107) -- 0:00:12
787000 -- (-287.726) (-290.535) [-288.690] (-290.486) * [-290.284] (-287.568) (-289.938) (-292.205) -- 0:00:12
787500 -- (-288.691) (-291.786) (-291.076) [-291.024] * (-288.135) (-292.258) [-292.301] (-288.103) -- 0:00:12
788000 -- (-287.805) [-289.850] (-289.701) (-289.810) * (-290.589) (-290.184) [-296.456] (-291.038) -- 0:00:12
788500 -- (-290.709) (-287.869) (-290.586) [-290.930] * (-288.541) [-290.763] (-290.452) (-291.480) -- 0:00:12
789000 -- (-289.768) [-289.513] (-289.414) (-291.387) * [-291.579] (-291.374) (-290.021) (-288.048) -- 0:00:12
789500 -- (-291.906) [-289.868] (-287.332) (-291.054) * (-292.147) [-292.339] (-291.577) (-289.724) -- 0:00:12
790000 -- (-290.388) [-288.934] (-289.261) (-288.778) * (-288.109) (-289.548) (-291.297) [-289.205] -- 0:00:12
Average standard deviation of split frequencies: 0.007996
790500 -- [-290.194] (-291.101) (-293.065) (-287.797) * [-289.650] (-290.216) (-294.640) (-287.663) -- 0:00:12
791000 -- (-292.353) [-289.890] (-289.944) (-290.303) * [-289.116] (-289.518) (-300.029) (-287.684) -- 0:00:12
791500 -- (-288.135) (-290.476) (-288.716) [-290.538] * (-289.461) (-288.240) [-292.947] (-289.975) -- 0:00:12
792000 -- (-287.705) (-289.482) [-290.945] (-289.782) * (-289.978) (-290.268) (-295.379) [-289.654] -- 0:00:12
792500 -- (-292.901) (-288.698) (-288.434) [-291.644] * [-287.942] (-294.088) (-288.804) (-292.640) -- 0:00:12
793000 -- [-287.945] (-292.476) (-288.327) (-292.306) * (-288.005) [-291.797] (-290.268) (-289.669) -- 0:00:12
793500 -- (-289.597) [-289.432] (-293.478) (-288.000) * (-288.226) (-288.230) (-288.911) [-289.827] -- 0:00:11
794000 -- (-287.851) (-288.308) [-289.881] (-287.931) * (-288.382) (-288.782) [-288.147] (-288.969) -- 0:00:11
794500 -- (-290.840) (-290.222) (-290.836) [-288.110] * (-289.817) (-289.413) [-291.101] (-290.675) -- 0:00:11
795000 -- (-291.314) [-290.560] (-288.874) (-290.404) * (-289.070) (-289.679) [-288.725] (-289.035) -- 0:00:11
Average standard deviation of split frequencies: 0.007403
795500 -- [-289.981] (-290.358) (-288.352) (-289.320) * (-288.254) (-294.029) [-290.181] (-291.167) -- 0:00:11
796000 -- (-291.715) [-288.202] (-288.879) (-288.801) * (-291.342) (-291.794) [-288.992] (-291.862) -- 0:00:11
796500 -- [-291.715] (-288.275) (-289.732) (-287.963) * (-288.336) [-291.829] (-292.278) (-290.360) -- 0:00:11
797000 -- [-288.754] (-288.610) (-288.317) (-289.079) * (-287.304) [-292.791] (-291.926) (-291.799) -- 0:00:11
797500 -- (-290.449) (-290.744) (-290.147) [-288.756] * (-288.203) (-288.688) (-289.732) [-288.166] -- 0:00:11
798000 -- (-288.508) (-287.998) [-288.287] (-289.879) * [-291.267] (-291.381) (-291.147) (-288.663) -- 0:00:11
798500 -- [-290.004] (-290.234) (-288.946) (-290.972) * [-291.248] (-289.392) (-292.759) (-287.970) -- 0:00:11
799000 -- (-291.542) (-288.666) [-289.117] (-289.939) * [-290.646] (-288.321) (-294.912) (-289.335) -- 0:00:11
799500 -- (-288.048) (-287.869) [-290.233] (-288.181) * (-291.474) (-289.660) [-298.079] (-289.517) -- 0:00:11
800000 -- [-291.975] (-290.208) (-287.702) (-290.292) * (-292.321) [-288.565] (-294.140) (-288.221) -- 0:00:11
Average standard deviation of split frequencies: 0.007065
800500 -- (-289.495) [-290.570] (-289.382) (-290.291) * (-292.615) (-289.920) [-291.898] (-288.897) -- 0:00:11
801000 -- (-291.861) [-289.457] (-289.656) (-287.853) * (-289.917) (-288.955) [-288.941] (-289.776) -- 0:00:11
801500 -- (-296.112) (-291.709) (-290.515) [-288.856] * [-293.277] (-291.218) (-292.356) (-288.633) -- 0:00:11
802000 -- [-287.666] (-291.210) (-292.577) (-289.138) * (-288.734) (-289.624) (-289.007) [-289.665] -- 0:00:11
802500 -- (-294.283) (-293.433) [-293.759] (-287.857) * (-289.180) [-291.669] (-289.237) (-292.831) -- 0:00:11
803000 -- [-289.422] (-292.220) (-289.006) (-289.794) * (-288.559) [-288.629] (-293.211) (-292.489) -- 0:00:11
803500 -- (-288.661) [-292.180] (-288.736) (-289.539) * (-289.972) [-287.919] (-289.786) (-291.320) -- 0:00:11
804000 -- (-288.766) [-290.826] (-291.621) (-290.685) * [-290.136] (-289.513) (-294.340) (-288.686) -- 0:00:11
804500 -- (-289.349) (-293.671) (-290.571) [-291.419] * (-292.060) (-296.479) (-290.335) [-289.546] -- 0:00:11
805000 -- (-289.119) (-292.985) [-294.131] (-288.726) * (-288.595) (-287.404) [-289.357] (-291.276) -- 0:00:11
Average standard deviation of split frequencies: 0.007879
805500 -- (-288.277) (-287.660) [-288.914] (-290.827) * (-295.662) [-288.642] (-289.048) (-290.925) -- 0:00:11
806000 -- (-290.805) (-289.236) [-295.060] (-289.192) * [-288.751] (-290.285) (-293.176) (-291.363) -- 0:00:11
806500 -- (-291.108) [-293.793] (-291.569) (-289.352) * (-290.378) (-291.201) [-290.987] (-292.910) -- 0:00:11
807000 -- (-291.178) (-288.935) (-289.199) [-289.985] * [-289.928] (-287.667) (-292.667) (-289.461) -- 0:00:11
807500 -- [-290.274] (-295.194) (-289.753) (-300.003) * (-289.786) [-288.825] (-294.236) (-289.363) -- 0:00:11
808000 -- (-288.637) (-289.155) (-295.515) [-287.294] * (-288.630) (-288.160) (-288.117) [-288.045] -- 0:00:11
808500 -- (-290.567) (-290.330) [-291.815] (-290.724) * [-287.393] (-292.060) (-293.165) (-289.520) -- 0:00:11
809000 -- (-287.402) [-287.906] (-292.864) (-292.214) * [-287.351] (-288.168) (-293.061) (-291.996) -- 0:00:11
809500 -- (-288.890) (-288.733) (-292.017) [-291.449] * (-287.719) [-291.633] (-287.776) (-288.752) -- 0:00:11
810000 -- [-290.625] (-288.465) (-291.250) (-296.399) * (-292.126) (-287.602) (-287.503) [-290.514] -- 0:00:11
Average standard deviation of split frequencies: 0.007731
810500 -- (-293.091) (-288.455) [-289.415] (-289.364) * (-289.233) (-290.630) [-289.863] (-289.426) -- 0:00:10
811000 -- (-293.548) (-289.845) (-288.017) [-287.935] * (-288.718) (-288.170) (-288.029) [-293.893] -- 0:00:10
811500 -- [-288.346] (-288.231) (-291.322) (-289.917) * (-288.390) (-287.932) (-289.992) [-288.265] -- 0:00:10
812000 -- (-289.151) [-288.258] (-288.737) (-288.648) * (-287.624) [-288.835] (-288.551) (-288.311) -- 0:00:10
812500 -- (-288.802) [-287.885] (-290.046) (-287.622) * (-288.575) (-288.603) [-288.910] (-288.685) -- 0:00:10
813000 -- (-294.189) (-288.087) (-289.080) [-292.065] * [-290.766] (-288.827) (-288.565) (-289.986) -- 0:00:10
813500 -- [-288.663] (-289.610) (-288.919) (-287.977) * (-290.017) (-290.065) (-289.663) [-289.192] -- 0:00:10
814000 -- (-289.084) [-294.065] (-289.727) (-289.071) * (-292.293) (-291.734) [-289.515] (-287.764) -- 0:00:10
814500 -- [-288.288] (-289.316) (-294.001) (-293.766) * (-291.055) (-290.532) (-293.067) [-287.710] -- 0:00:10
815000 -- [-287.830] (-289.463) (-291.702) (-291.846) * [-289.920] (-288.870) (-290.733) (-290.610) -- 0:00:10
Average standard deviation of split frequencies: 0.006932
815500 -- [-288.120] (-288.778) (-293.012) (-289.341) * (-289.920) (-288.718) [-291.022] (-288.968) -- 0:00:10
816000 -- (-289.233) [-289.176] (-291.640) (-291.897) * (-290.798) (-290.192) (-287.999) [-288.302] -- 0:00:10
816500 -- (-287.822) (-290.573) [-293.365] (-287.904) * [-290.836] (-290.429) (-288.720) (-293.546) -- 0:00:10
817000 -- (-289.022) [-289.909] (-289.857) (-289.776) * (-290.339) (-290.113) [-289.276] (-292.420) -- 0:00:10
817500 -- [-288.233] (-290.762) (-287.988) (-289.598) * (-291.266) (-287.768) (-287.876) [-289.536] -- 0:00:10
818000 -- [-288.342] (-288.277) (-288.725) (-288.849) * (-288.637) (-291.454) [-290.122] (-288.856) -- 0:00:10
818500 -- (-290.046) (-288.941) (-289.081) [-291.067] * (-289.606) (-292.303) (-291.144) [-291.438] -- 0:00:10
819000 -- (-290.111) (-292.505) [-288.751] (-289.363) * (-288.364) (-291.239) (-289.674) [-287.749] -- 0:00:10
819500 -- (-290.519) (-287.424) [-289.667] (-288.481) * [-290.471] (-288.162) (-290.181) (-287.756) -- 0:00:10
820000 -- (-287.622) [-291.140] (-293.717) (-288.301) * (-288.840) (-290.042) (-288.471) [-287.368] -- 0:00:10
Average standard deviation of split frequencies: 0.006678
820500 -- [-289.577] (-287.585) (-292.583) (-294.688) * (-292.532) (-293.419) (-289.567) [-289.426] -- 0:00:10
821000 -- (-289.816) (-288.068) [-288.761] (-289.627) * [-291.258] (-287.746) (-292.532) (-289.723) -- 0:00:10
821500 -- [-288.143] (-291.890) (-288.876) (-288.166) * (-289.749) (-290.030) [-290.911] (-290.464) -- 0:00:10
822000 -- (-289.206) (-289.749) [-288.415] (-288.188) * (-291.210) [-292.126] (-288.787) (-288.402) -- 0:00:10
822500 -- (-289.355) (-288.015) [-288.060] (-292.077) * (-290.382) (-288.406) [-287.525] (-289.334) -- 0:00:10
823000 -- (-290.647) (-287.842) [-288.644] (-289.949) * (-288.744) (-294.695) [-288.546] (-287.540) -- 0:00:10
823500 -- (-289.181) (-289.129) [-289.055] (-291.448) * (-290.915) (-288.526) [-288.348] (-289.863) -- 0:00:10
824000 -- [-289.074] (-290.044) (-289.267) (-290.554) * (-293.906) (-289.651) [-287.191] (-293.000) -- 0:00:10
824500 -- [-292.086] (-291.071) (-289.456) (-290.304) * (-288.419) [-287.806] (-289.653) (-293.457) -- 0:00:10
825000 -- (-292.734) (-293.989) [-293.262] (-289.236) * (-287.896) (-290.855) [-290.226] (-296.007) -- 0:00:10
Average standard deviation of split frequencies: 0.006741
825500 -- (-288.408) [-289.384] (-289.257) (-290.304) * [-289.179] (-290.735) (-291.819) (-287.779) -- 0:00:10
826000 -- [-292.387] (-289.919) (-289.909) (-289.167) * [-289.824] (-290.696) (-288.692) (-287.809) -- 0:00:10
826500 -- [-291.934] (-290.248) (-289.370) (-293.673) * (-291.112) (-289.650) [-289.028] (-289.134) -- 0:00:10
827000 -- (-288.541) (-290.790) (-289.260) [-289.262] * [-288.129] (-288.578) (-288.340) (-288.695) -- 0:00:10
827500 -- (-293.145) [-289.151] (-289.905) (-289.445) * (-289.124) (-291.415) (-289.278) [-289.003] -- 0:00:10
828000 -- (-291.949) (-293.029) [-288.447] (-289.857) * [-290.098] (-291.298) (-287.904) (-287.947) -- 0:00:09
828500 -- (-289.637) [-287.827] (-289.213) (-290.332) * [-288.169] (-289.206) (-289.003) (-289.491) -- 0:00:09
829000 -- (-290.575) (-288.429) [-291.207] (-289.977) * (-289.618) [-288.515] (-288.272) (-290.362) -- 0:00:09
829500 -- [-287.469] (-289.412) (-291.301) (-291.610) * [-288.968] (-289.433) (-290.957) (-293.219) -- 0:00:09
830000 -- [-289.346] (-289.006) (-289.100) (-288.514) * (-293.002) [-288.765] (-292.782) (-290.716) -- 0:00:09
Average standard deviation of split frequencies: 0.006562
830500 -- (-289.478) (-292.285) [-294.343] (-289.866) * (-290.364) (-288.384) (-289.122) [-288.734] -- 0:00:09
831000 -- (-293.461) [-287.879] (-290.753) (-292.535) * [-288.512] (-293.140) (-292.637) (-290.131) -- 0:00:09
831500 -- (-290.849) (-289.492) [-288.169] (-289.391) * (-288.884) (-288.776) (-301.072) [-291.405] -- 0:00:09
832000 -- (-288.278) [-292.533] (-288.410) (-290.251) * (-291.724) [-290.592] (-294.594) (-292.560) -- 0:00:09
832500 -- (-295.371) (-290.720) [-288.516] (-289.658) * (-290.622) [-287.792] (-288.389) (-290.713) -- 0:00:09
833000 -- (-291.423) [-291.548] (-290.077) (-287.197) * [-289.696] (-288.512) (-288.322) (-289.652) -- 0:00:09
833500 -- (-288.105) (-289.519) [-289.302] (-287.508) * (-289.040) (-289.658) [-288.078] (-287.851) -- 0:00:09
834000 -- (-290.877) [-293.278] (-288.522) (-288.552) * (-288.481) (-287.943) [-290.205] (-288.136) -- 0:00:09
834500 -- [-289.115] (-288.569) (-290.986) (-288.688) * (-288.852) (-288.761) (-287.731) [-288.664] -- 0:00:09
835000 -- (-291.200) (-288.884) (-289.871) [-287.902] * (-288.567) (-287.718) (-288.062) [-287.723] -- 0:00:09
Average standard deviation of split frequencies: 0.006520
835500 -- (-288.294) (-288.275) (-288.860) [-290.317] * (-290.589) (-288.678) [-287.664] (-288.365) -- 0:00:09
836000 -- (-289.364) (-288.142) (-294.982) [-288.659] * (-290.472) [-294.698] (-288.711) (-290.497) -- 0:00:09
836500 -- [-288.178] (-288.450) (-290.044) (-298.254) * (-289.227) (-289.997) [-288.581] (-289.893) -- 0:00:09
837000 -- (-290.279) (-290.118) (-289.108) [-289.972] * (-288.908) [-290.257] (-289.205) (-290.485) -- 0:00:09
837500 -- (-288.463) (-288.924) (-289.746) [-289.211] * (-288.054) (-289.288) (-292.216) [-290.579] -- 0:00:09
838000 -- (-289.188) (-289.132) (-288.042) [-288.064] * [-288.981] (-289.200) (-290.745) (-288.748) -- 0:00:09
838500 -- (-287.613) (-288.988) [-289.406] (-289.844) * (-291.005) (-290.463) [-288.811] (-288.598) -- 0:00:09
839000 -- [-292.891] (-287.964) (-292.441) (-290.709) * (-291.399) (-291.215) [-288.241] (-290.009) -- 0:00:09
839500 -- (-288.958) [-287.847] (-289.240) (-291.924) * [-287.695] (-289.967) (-291.307) (-290.835) -- 0:00:09
840000 -- (-289.372) (-291.272) (-289.437) [-287.840] * (-290.571) [-288.473] (-289.959) (-293.619) -- 0:00:09
Average standard deviation of split frequencies: 0.006063
840500 -- (-287.622) [-287.636] (-288.698) (-289.643) * (-295.048) [-288.196] (-291.229) (-289.808) -- 0:00:09
841000 -- (-291.529) (-291.566) (-290.295) [-291.299] * (-291.011) (-289.844) [-291.158] (-289.753) -- 0:00:09
841500 -- (-290.597) (-290.074) [-287.820] (-290.807) * [-291.807] (-292.126) (-290.998) (-294.999) -- 0:00:09
842000 -- (-288.555) (-287.759) [-289.754] (-290.589) * [-290.301] (-289.489) (-288.129) (-290.815) -- 0:00:09
842500 -- [-288.870] (-288.112) (-289.249) (-292.328) * (-290.871) (-289.763) [-290.413] (-291.825) -- 0:00:09
843000 -- (-287.924) [-290.524] (-287.941) (-289.389) * (-290.753) [-288.851] (-297.453) (-291.653) -- 0:00:09
843500 -- (-288.535) (-292.511) (-288.321) [-288.831] * [-289.321] (-287.669) (-289.343) (-288.767) -- 0:00:09
844000 -- (-289.217) [-289.366] (-288.506) (-288.013) * (-290.937) (-291.298) (-288.471) [-292.234] -- 0:00:09
844500 -- (-288.260) (-289.040) (-292.344) [-287.749] * (-287.754) (-288.922) (-287.631) [-289.110] -- 0:00:09
845000 -- (-290.905) (-290.401) (-287.794) [-289.749] * [-287.988] (-291.795) (-289.947) (-289.187) -- 0:00:08
Average standard deviation of split frequencies: 0.006949
845500 -- (-289.155) (-288.684) [-288.536] (-288.851) * [-287.988] (-293.534) (-290.624) (-290.567) -- 0:00:08
846000 -- [-287.503] (-288.094) (-288.487) (-289.382) * (-289.434) (-291.954) (-289.542) [-289.802] -- 0:00:08
846500 -- (-289.673) (-291.146) [-288.254] (-290.202) * (-289.462) [-290.238] (-287.817) (-294.630) -- 0:00:08
847000 -- (-293.589) (-289.397) (-289.330) [-290.228] * (-287.947) (-289.939) (-288.468) [-290.246] -- 0:00:08
847500 -- (-293.061) (-288.421) (-290.211) [-288.406] * [-288.014] (-290.258) (-292.838) (-293.041) -- 0:00:08
848000 -- (-288.893) [-287.440] (-288.280) (-289.447) * (-288.677) (-289.889) [-287.490] (-290.849) -- 0:00:08
848500 -- (-287.736) (-288.120) (-290.908) [-287.908] * (-290.518) (-288.417) [-288.900] (-289.039) -- 0:00:08
849000 -- (-291.224) [-288.949] (-288.448) (-287.656) * [-289.749] (-287.300) (-289.541) (-291.090) -- 0:00:08
849500 -- (-293.745) [-291.678] (-291.435) (-289.367) * (-288.780) (-288.672) [-288.947] (-292.484) -- 0:00:08
850000 -- [-290.488] (-290.778) (-292.308) (-289.377) * [-290.522] (-289.172) (-288.282) (-287.785) -- 0:00:08
Average standard deviation of split frequencies: 0.007008
850500 -- (-291.252) (-290.679) (-291.340) [-288.874] * (-287.792) (-290.031) [-288.681] (-288.276) -- 0:00:08
851000 -- (-293.960) (-288.993) (-291.557) [-289.439] * (-290.121) (-291.966) [-290.529] (-287.730) -- 0:00:08
851500 -- (-290.467) (-289.585) (-292.285) [-287.896] * (-290.105) [-289.585] (-288.058) (-289.888) -- 0:00:08
852000 -- [-289.875] (-288.475) (-292.407) (-288.892) * (-290.415) (-288.136) (-292.916) [-287.309] -- 0:00:08
852500 -- (-294.013) (-290.740) (-292.120) [-290.125] * [-288.985] (-287.972) (-293.163) (-287.538) -- 0:00:08
853000 -- (-287.575) (-293.997) (-287.940) [-288.789] * (-291.565) (-291.164) (-292.641) [-289.237] -- 0:00:08
853500 -- (-291.163) [-289.217] (-289.358) (-287.664) * (-294.303) (-289.626) (-291.607) [-289.406] -- 0:00:08
854000 -- (-290.171) [-287.634] (-288.835) (-288.845) * (-291.216) [-287.878] (-288.305) (-290.122) -- 0:00:08
854500 -- (-290.012) (-287.435) (-291.276) [-289.084] * (-289.821) (-288.847) [-287.629] (-292.472) -- 0:00:08
855000 -- (-290.555) (-287.511) [-288.822] (-290.610) * [-290.539] (-293.279) (-287.657) (-289.785) -- 0:00:08
Average standard deviation of split frequencies: 0.006264
855500 -- (-289.613) (-289.813) [-289.823] (-289.219) * (-290.267) [-288.699] (-289.029) (-288.615) -- 0:00:08
856000 -- (-287.914) (-289.513) (-298.976) [-290.461] * (-289.464) (-290.363) (-289.081) [-288.900] -- 0:00:08
856500 -- [-288.071] (-287.972) (-287.697) (-288.701) * (-290.367) (-289.040) (-288.939) [-287.881] -- 0:00:08
857000 -- (-289.752) [-290.366] (-294.161) (-287.550) * (-289.183) (-288.647) [-288.568] (-291.720) -- 0:00:08
857500 -- [-287.641] (-290.229) (-287.783) (-291.081) * [-288.675] (-291.514) (-289.739) (-289.627) -- 0:00:08
858000 -- [-288.797] (-290.619) (-297.374) (-291.817) * (-291.684) [-289.835] (-289.448) (-287.624) -- 0:00:08
858500 -- [-288.213] (-294.978) (-291.287) (-291.974) * (-288.837) [-290.290] (-288.431) (-287.284) -- 0:00:08
859000 -- (-290.869) [-290.112] (-291.253) (-293.131) * (-293.440) (-295.691) [-288.315] (-291.101) -- 0:00:08
859500 -- (-289.146) (-292.352) (-288.549) [-292.046] * (-290.025) (-287.408) [-289.299] (-290.834) -- 0:00:08
860000 -- (-288.176) (-291.870) (-291.334) [-288.196] * (-291.664) (-293.057) (-294.064) [-290.179] -- 0:00:08
Average standard deviation of split frequencies: 0.006573
860500 -- (-289.174) [-287.534] (-291.624) (-288.763) * (-289.424) (-292.709) [-297.019] (-289.592) -- 0:00:08
861000 -- [-287.823] (-287.797) (-291.381) (-288.663) * (-288.743) (-289.434) (-290.700) [-287.725] -- 0:00:08
861500 -- (-291.047) (-288.553) [-287.437] (-287.792) * (-289.618) [-288.954] (-289.333) (-289.247) -- 0:00:08
862000 -- [-290.158] (-289.186) (-289.014) (-289.688) * (-288.692) (-288.622) (-287.719) [-290.215] -- 0:00:08
862500 -- (-290.340) [-289.712] (-294.082) (-291.531) * (-290.523) [-288.841] (-289.122) (-290.581) -- 0:00:07
863000 -- (-295.223) (-290.844) [-289.430] (-288.027) * (-291.033) (-288.497) (-293.242) [-287.682] -- 0:00:07
863500 -- (-290.765) (-289.008) (-287.687) [-287.840] * (-295.012) (-293.510) (-290.507) [-293.384] -- 0:00:07
864000 -- [-290.835] (-287.715) (-290.815) (-289.171) * [-290.714] (-288.106) (-291.400) (-292.067) -- 0:00:07
864500 -- (-289.849) (-290.639) (-289.668) [-289.507] * (-291.746) [-293.746] (-294.225) (-290.052) -- 0:00:07
865000 -- (-288.248) (-289.353) [-291.446] (-289.708) * (-291.792) (-292.790) (-293.479) [-288.826] -- 0:00:07
Average standard deviation of split frequencies: 0.006702
865500 -- (-288.099) (-295.508) (-288.282) [-289.148] * (-291.743) (-290.381) (-288.755) [-288.119] -- 0:00:07
866000 -- [-287.906] (-294.161) (-289.032) (-287.960) * (-288.636) [-287.839] (-289.934) (-289.076) -- 0:00:07
866500 -- (-291.130) (-290.371) [-298.285] (-289.641) * (-291.753) [-290.734] (-288.671) (-288.503) -- 0:00:07
867000 -- (-290.646) (-288.858) (-290.863) [-288.347] * [-288.293] (-291.844) (-289.247) (-291.026) -- 0:00:07
867500 -- (-292.809) (-288.703) [-287.882] (-287.665) * (-288.645) (-290.540) [-288.523] (-287.868) -- 0:00:07
868000 -- (-287.950) (-289.906) (-290.048) [-287.855] * (-290.343) (-289.230) [-287.295] (-289.892) -- 0:00:07
868500 -- [-288.493] (-294.369) (-292.374) (-289.599) * (-293.411) [-288.231] (-289.891) (-289.244) -- 0:00:07
869000 -- (-288.271) (-289.097) [-288.812] (-288.530) * (-292.894) [-289.280] (-287.736) (-293.760) -- 0:00:07
869500 -- (-290.084) (-289.300) [-287.951] (-289.119) * (-291.235) [-292.251] (-290.698) (-289.786) -- 0:00:07
870000 -- (-293.221) (-291.026) [-290.584] (-290.357) * (-289.442) (-291.133) (-288.938) [-288.563] -- 0:00:07
Average standard deviation of split frequencies: 0.006836
870500 -- (-289.429) [-289.811] (-288.423) (-289.316) * (-291.914) (-296.732) (-292.478) [-292.046] -- 0:00:07
871000 -- (-290.277) (-289.659) (-287.922) [-287.396] * (-289.054) (-291.205) [-290.050] (-289.312) -- 0:00:07
871500 -- (-288.725) (-289.310) (-289.817) [-289.933] * (-289.870) (-288.549) (-289.479) [-287.571] -- 0:00:07
872000 -- (-287.817) (-289.828) (-289.095) [-288.987] * (-289.424) [-288.028] (-289.918) (-291.011) -- 0:00:07
872500 -- (-287.207) (-287.909) [-289.613] (-288.218) * (-289.888) (-289.877) [-287.971] (-287.906) -- 0:00:07
873000 -- [-288.791] (-290.014) (-290.390) (-289.969) * [-289.503] (-290.101) (-291.074) (-289.611) -- 0:00:07
873500 -- (-290.296) (-293.216) (-289.448) [-292.208] * (-288.427) [-289.810] (-289.361) (-291.486) -- 0:00:07
874000 -- [-288.642] (-289.834) (-287.772) (-290.394) * (-289.770) [-288.860] (-289.595) (-288.487) -- 0:00:07
874500 -- [-289.829] (-292.724) (-289.415) (-297.618) * (-288.928) (-289.487) (-290.500) [-289.349] -- 0:00:07
875000 -- (-288.289) (-295.022) [-287.807] (-299.637) * (-291.949) [-288.820] (-289.323) (-289.803) -- 0:00:07
Average standard deviation of split frequencies: 0.006861
875500 -- (-287.853) (-295.974) (-289.646) [-290.042] * (-291.623) (-294.463) [-291.751] (-291.652) -- 0:00:07
876000 -- [-287.387] (-289.864) (-291.327) (-289.018) * [-288.715] (-289.194) (-292.110) (-290.170) -- 0:00:07
876500 -- [-287.542] (-290.718) (-287.669) (-293.108) * (-291.644) (-290.127) [-289.191] (-290.797) -- 0:00:07
877000 -- (-288.764) (-289.585) (-287.535) [-290.594] * [-290.698] (-288.879) (-287.709) (-288.995) -- 0:00:07
877500 -- (-287.473) [-287.504] (-288.214) (-289.410) * (-291.036) (-289.532) (-294.143) [-289.852] -- 0:00:07
878000 -- [-289.208] (-287.380) (-288.479) (-288.602) * (-288.710) (-290.166) [-290.475] (-288.943) -- 0:00:07
878500 -- (-290.979) (-289.036) [-292.019] (-289.327) * [-288.432] (-290.172) (-292.357) (-290.681) -- 0:00:07
879000 -- (-288.947) [-288.949] (-290.663) (-288.310) * (-289.587) (-290.271) [-289.114] (-295.475) -- 0:00:07
879500 -- [-288.474] (-287.394) (-288.010) (-288.306) * [-287.970] (-290.004) (-288.193) (-292.364) -- 0:00:06
880000 -- (-288.925) (-290.675) [-287.285] (-292.401) * (-289.561) (-288.273) [-288.618] (-292.856) -- 0:00:06
Average standard deviation of split frequencies: 0.006825
880500 -- (-291.438) [-292.174] (-290.323) (-292.419) * [-290.028] (-288.724) (-289.011) (-287.840) -- 0:00:06
881000 -- (-288.924) [-290.693] (-289.819) (-288.623) * [-289.485] (-290.800) (-291.556) (-289.343) -- 0:00:06
881500 -- [-291.222] (-294.086) (-289.290) (-291.781) * (-288.807) (-289.597) [-289.808] (-292.635) -- 0:00:06
882000 -- [-291.418] (-290.947) (-293.263) (-288.940) * [-288.305] (-289.052) (-288.028) (-287.524) -- 0:00:06
882500 -- (-289.104) (-291.711) (-296.814) [-290.530] * [-288.952] (-289.416) (-287.797) (-287.823) -- 0:00:06
883000 -- (-290.686) (-291.816) (-294.926) [-293.216] * (-288.959) (-288.978) (-292.551) [-287.823] -- 0:00:06
883500 -- (-289.795) (-290.910) [-292.440] (-290.716) * (-291.476) [-288.104] (-292.218) (-287.839) -- 0:00:06
884000 -- [-289.142] (-289.939) (-287.911) (-290.177) * (-289.383) (-288.104) (-288.484) [-287.765] -- 0:00:06
884500 -- [-288.236] (-288.385) (-288.791) (-289.368) * [-290.330] (-292.720) (-289.565) (-288.891) -- 0:00:06
885000 -- (-290.086) (-290.464) (-289.274) [-289.930] * (-289.753) (-290.176) (-288.338) [-288.032] -- 0:00:06
Average standard deviation of split frequencies: 0.007083
885500 -- [-290.404] (-290.929) (-287.978) (-290.513) * (-289.368) (-291.069) [-288.450] (-287.671) -- 0:00:06
886000 -- (-291.192) [-289.473] (-290.487) (-289.181) * (-289.968) [-293.214] (-287.339) (-288.174) -- 0:00:06
886500 -- (-289.571) (-288.568) (-290.737) [-290.618] * (-288.315) (-290.707) (-290.007) [-287.667] -- 0:00:06
887000 -- [-291.551] (-288.157) (-287.985) (-288.374) * (-292.066) [-288.863] (-290.347) (-290.371) -- 0:00:06
887500 -- [-288.192] (-287.727) (-294.953) (-289.106) * [-287.859] (-293.886) (-293.822) (-288.304) -- 0:00:06
888000 -- (-288.382) (-287.899) [-289.605] (-289.818) * (-288.972) (-293.931) (-290.213) [-290.731] -- 0:00:06
888500 -- (-292.725) [-288.174] (-288.837) (-287.848) * [-287.966] (-287.813) (-288.100) (-291.315) -- 0:00:06
889000 -- (-291.848) (-287.268) [-287.852] (-288.922) * (-288.870) [-287.932] (-290.685) (-290.275) -- 0:00:06
889500 -- (-292.810) [-287.943] (-288.214) (-291.015) * (-290.197) (-288.822) [-289.492] (-291.082) -- 0:00:06
890000 -- (-291.641) (-289.040) [-288.564] (-291.547) * [-287.624] (-288.099) (-300.322) (-291.095) -- 0:00:06
Average standard deviation of split frequencies: 0.007277
890500 -- (-289.048) (-289.753) [-292.242] (-287.772) * (-289.655) (-288.087) (-291.958) [-288.584] -- 0:00:06
891000 -- (-289.876) [-291.964] (-292.238) (-291.043) * [-287.923] (-288.838) (-291.036) (-288.955) -- 0:00:06
891500 -- (-291.736) [-291.686] (-288.595) (-289.286) * [-288.150] (-288.911) (-289.501) (-290.262) -- 0:00:06
892000 -- (-288.552) (-289.687) (-288.616) [-290.625] * (-290.739) (-288.435) (-288.570) [-287.788] -- 0:00:06
892500 -- (-288.306) [-288.656] (-288.820) (-288.177) * [-288.589] (-292.155) (-289.740) (-288.006) -- 0:00:06
893000 -- (-288.041) (-289.023) (-294.008) [-288.209] * [-287.569] (-291.395) (-292.368) (-288.881) -- 0:00:06
893500 -- [-289.442] (-289.656) (-288.347) (-289.443) * (-289.702) (-288.755) (-290.437) [-289.320] -- 0:00:06
894000 -- [-290.209] (-288.862) (-289.319) (-290.987) * (-289.611) [-289.381] (-288.318) (-292.102) -- 0:00:06
894500 -- [-287.854] (-288.685) (-288.803) (-292.136) * (-289.838) [-289.026] (-289.581) (-287.450) -- 0:00:06
895000 -- (-288.427) [-290.088] (-291.729) (-297.851) * (-289.866) [-290.563] (-288.094) (-288.780) -- 0:00:06
Average standard deviation of split frequencies: 0.007431
895500 -- (-293.772) (-290.393) [-289.764] (-292.307) * (-290.019) (-289.650) (-290.354) [-290.634] -- 0:00:06
896000 -- (-290.834) (-288.813) (-294.354) [-290.636] * (-288.684) [-288.668] (-294.159) (-287.863) -- 0:00:06
896500 -- (-291.330) (-288.931) [-293.108] (-290.556) * (-289.728) (-288.515) [-290.684] (-291.896) -- 0:00:06
897000 -- (-290.048) (-291.736) (-290.702) [-289.106] * (-293.309) (-289.268) [-290.450] (-294.535) -- 0:00:05
897500 -- (-288.337) (-289.159) [-287.961] (-289.117) * [-289.850] (-288.823) (-288.430) (-290.683) -- 0:00:05
898000 -- [-290.416] (-287.792) (-290.010) (-293.094) * (-288.192) (-289.169) (-289.658) [-288.562] -- 0:00:05
898500 -- [-290.742] (-289.287) (-290.015) (-289.663) * (-290.081) [-288.615] (-290.045) (-288.560) -- 0:00:05
899000 -- [-288.282] (-288.747) (-293.840) (-290.839) * (-290.189) (-287.833) [-288.745] (-290.278) -- 0:00:05
899500 -- (-292.828) (-288.634) (-290.442) [-289.435] * (-291.164) (-291.870) [-288.035] (-291.663) -- 0:00:05
900000 -- (-290.153) (-290.162) [-288.968] (-289.887) * (-292.784) (-289.826) (-289.376) [-289.389] -- 0:00:05
Average standard deviation of split frequencies: 0.007524
900500 -- [-290.514] (-290.463) (-290.352) (-288.211) * (-290.066) (-288.698) (-291.520) [-287.633] -- 0:00:05
901000 -- (-289.901) [-290.790] (-288.493) (-290.416) * (-291.188) (-291.889) [-290.758] (-290.993) -- 0:00:05
901500 -- (-289.095) [-291.751] (-292.665) (-290.549) * (-291.879) [-287.852] (-288.623) (-290.773) -- 0:00:05
902000 -- (-288.708) (-289.163) [-290.745] (-290.669) * (-287.800) [-289.616] (-287.245) (-290.621) -- 0:00:05
902500 -- (-287.586) (-290.405) (-291.493) [-293.867] * (-287.754) (-290.280) [-289.829] (-291.385) -- 0:00:05
903000 -- (-288.898) (-290.817) [-290.360] (-288.971) * (-287.662) [-287.851] (-288.787) (-288.734) -- 0:00:05
903500 -- (-288.445) (-287.912) [-292.358] (-292.882) * (-288.382) (-290.683) (-290.821) [-287.897] -- 0:00:05
904000 -- (-293.929) [-290.110] (-293.249) (-288.567) * (-288.073) [-292.520] (-292.639) (-288.731) -- 0:00:05
904500 -- (-289.173) (-290.482) [-292.436] (-288.061) * (-288.272) [-290.757] (-289.014) (-289.584) -- 0:00:05
905000 -- (-292.878) (-289.707) [-289.393] (-289.616) * [-292.248] (-289.381) (-293.615) (-289.181) -- 0:00:05
Average standard deviation of split frequencies: 0.007740
905500 -- (-294.200) (-288.204) (-288.589) [-288.546] * [-290.688] (-296.489) (-287.707) (-290.324) -- 0:00:05
906000 -- [-288.394] (-288.179) (-287.841) (-287.745) * (-289.841) (-292.168) [-290.370] (-288.700) -- 0:00:05
906500 -- (-287.348) (-288.922) (-287.851) [-288.399] * (-288.541) (-289.407) (-288.194) [-289.949] -- 0:00:05
907000 -- (-289.403) (-290.153) [-288.535] (-289.004) * (-290.357) [-290.609] (-288.230) (-288.632) -- 0:00:05
907500 -- [-289.559] (-290.017) (-288.148) (-289.856) * [-290.716] (-288.392) (-290.183) (-290.198) -- 0:00:05
908000 -- (-293.190) (-288.634) (-287.907) [-288.820] * (-292.066) [-287.309] (-289.747) (-288.970) -- 0:00:05
908500 -- (-293.698) [-287.861] (-289.052) (-287.386) * (-292.759) (-288.252) [-288.039] (-288.800) -- 0:00:05
909000 -- (-293.118) (-289.617) (-288.157) [-289.095] * [-289.101] (-290.554) (-288.419) (-288.885) -- 0:00:05
909500 -- (-290.332) (-296.382) (-288.643) [-289.797] * (-288.454) (-288.478) [-288.626] (-288.914) -- 0:00:05
910000 -- (-288.875) [-293.392] (-292.186) (-290.307) * (-288.611) (-290.301) (-288.725) [-288.125] -- 0:00:05
Average standard deviation of split frequencies: 0.007797
910500 -- (-291.960) (-291.131) (-290.666) [-288.301] * (-290.666) [-291.249] (-288.204) (-288.618) -- 0:00:05
911000 -- (-289.507) [-289.700] (-288.817) (-289.165) * (-290.849) (-288.941) [-290.916] (-289.851) -- 0:00:05
911500 -- (-289.034) (-288.324) (-290.958) [-289.603] * (-290.138) (-291.504) (-292.683) [-291.333] -- 0:00:05
912000 -- (-292.331) (-289.067) (-288.371) [-289.762] * (-289.541) [-288.109] (-288.793) (-291.264) -- 0:00:05
912500 -- (-291.045) (-290.631) [-288.768] (-288.855) * (-290.176) (-290.569) (-294.751) [-289.825] -- 0:00:05
913000 -- (-291.995) (-291.598) (-291.606) [-287.655] * (-288.754) (-290.694) [-289.263] (-289.269) -- 0:00:05
913500 -- (-296.802) (-288.429) (-288.032) [-292.530] * (-287.547) (-290.316) [-287.692] (-288.968) -- 0:00:05
914000 -- (-288.728) (-288.829) (-291.524) [-293.661] * (-289.178) [-287.923] (-288.358) (-288.637) -- 0:00:04
914500 -- [-288.560] (-288.837) (-289.168) (-287.521) * (-289.458) (-290.056) [-288.896] (-288.575) -- 0:00:04
915000 -- [-289.639] (-289.243) (-287.788) (-291.303) * (-290.580) [-289.307] (-289.022) (-288.630) -- 0:00:04
Average standard deviation of split frequencies: 0.007591
915500 -- (-288.537) (-291.111) [-287.510] (-291.733) * (-290.430) (-287.911) (-289.978) [-290.487] -- 0:00:04
916000 -- [-290.269] (-288.231) (-289.469) (-289.739) * (-289.686) [-291.882] (-290.370) (-293.231) -- 0:00:04
916500 -- [-287.825] (-288.822) (-289.371) (-288.398) * (-287.759) (-288.687) (-288.646) [-291.340] -- 0:00:04
917000 -- (-288.654) (-289.556) (-292.132) [-288.710] * (-288.254) [-288.659] (-289.460) (-290.019) -- 0:00:04
917500 -- (-288.998) [-288.485] (-287.989) (-287.701) * (-289.450) (-293.655) (-287.768) [-292.177] -- 0:00:04
918000 -- (-288.645) (-288.590) (-291.286) [-288.599] * (-291.491) [-287.919] (-290.713) (-291.253) -- 0:00:04
918500 -- (-287.572) (-289.364) (-289.145) [-293.921] * (-289.408) (-291.083) (-291.019) [-291.142] -- 0:00:04
919000 -- (-291.749) (-290.381) (-289.374) [-288.930] * (-289.698) (-292.107) (-289.487) [-292.338] -- 0:00:04
919500 -- [-288.473] (-289.211) (-288.412) (-292.874) * (-288.927) [-291.210] (-289.018) (-289.789) -- 0:00:04
920000 -- [-289.071] (-288.323) (-288.828) (-292.311) * (-287.708) [-288.507] (-292.371) (-291.312) -- 0:00:04
Average standard deviation of split frequencies: 0.007232
920500 -- (-290.541) (-287.387) (-289.317) [-288.959] * (-289.715) (-289.243) [-292.169] (-289.548) -- 0:00:04
921000 -- (-294.377) (-289.975) [-289.432] (-288.867) * (-287.918) (-289.707) [-289.115] (-290.352) -- 0:00:04
921500 -- (-291.772) (-289.591) [-293.105] (-288.627) * (-290.000) (-288.341) [-291.881] (-287.946) -- 0:00:04
922000 -- [-289.026] (-289.372) (-289.900) (-288.774) * (-294.496) (-290.491) (-287.981) [-291.795] -- 0:00:04
922500 -- (-288.281) (-290.113) (-288.171) [-289.254] * (-289.294) [-291.880] (-290.297) (-302.993) -- 0:00:04
923000 -- [-288.499] (-290.193) (-290.420) (-291.207) * [-290.516] (-291.576) (-289.261) (-291.143) -- 0:00:04
923500 -- [-288.841] (-290.047) (-287.937) (-289.701) * (-288.483) [-287.690] (-289.235) (-289.906) -- 0:00:04
924000 -- (-288.198) (-291.633) (-290.466) [-288.986] * (-288.253) (-287.899) [-291.433] (-287.826) -- 0:00:04
924500 -- (-290.011) (-291.496) (-291.377) [-287.366] * (-289.688) [-287.829] (-289.279) (-290.066) -- 0:00:04
925000 -- (-291.541) (-291.614) (-289.060) [-287.884] * (-293.546) (-287.749) (-290.125) [-290.956] -- 0:00:04
Average standard deviation of split frequencies: 0.006904
925500 -- (-289.780) (-291.403) (-290.579) [-289.752] * [-290.312] (-288.405) (-290.338) (-289.990) -- 0:00:04
926000 -- (-289.643) [-288.771] (-290.598) (-289.771) * (-292.280) (-289.171) [-287.557] (-287.601) -- 0:00:04
926500 -- (-291.010) [-287.472] (-291.961) (-287.826) * (-291.818) [-288.245] (-288.538) (-289.192) -- 0:00:04
927000 -- (-288.430) (-290.388) (-287.905) [-287.603] * (-288.705) (-288.672) [-289.443] (-289.072) -- 0:00:04
927500 -- (-289.039) (-290.765) (-288.368) [-288.797] * (-289.002) [-288.507] (-291.263) (-293.135) -- 0:00:04
928000 -- (-296.738) (-288.958) (-289.482) [-288.541] * [-289.279] (-290.042) (-290.624) (-288.295) -- 0:00:04
928500 -- (-293.864) (-288.150) (-290.513) [-289.341] * (-289.842) (-287.791) (-289.046) [-289.623] -- 0:00:04
929000 -- (-291.283) (-288.758) (-289.564) [-289.869] * (-290.862) (-288.342) (-289.756) [-289.326] -- 0:00:04
929500 -- (-289.617) (-290.269) (-288.045) [-288.583] * (-291.829) (-291.318) (-288.586) [-289.882] -- 0:00:04
930000 -- (-294.041) [-288.748] (-288.962) (-290.277) * (-288.392) [-291.127] (-292.814) (-288.142) -- 0:00:04
Average standard deviation of split frequencies: 0.007471
930500 -- [-289.301] (-290.730) (-290.427) (-288.805) * (-287.647) [-288.781] (-288.326) (-288.379) -- 0:00:04
931000 -- (-288.050) (-288.981) [-288.096] (-288.671) * [-288.395] (-289.458) (-290.563) (-289.361) -- 0:00:04
931500 -- [-289.063] (-289.124) (-289.093) (-288.213) * (-288.343) (-294.781) [-289.135] (-289.394) -- 0:00:03
932000 -- (-291.753) [-288.979] (-288.503) (-292.300) * [-290.312] (-288.159) (-289.089) (-297.176) -- 0:00:03
932500 -- (-289.865) (-289.357) (-289.040) [-288.078] * (-290.522) (-289.251) [-291.630] (-295.048) -- 0:00:03
933000 -- (-289.947) (-291.191) [-289.710] (-287.444) * [-290.536] (-294.652) (-289.006) (-295.616) -- 0:00:03
933500 -- (-292.182) (-291.827) [-288.335] (-288.385) * (-296.279) (-294.126) [-287.352] (-288.848) -- 0:00:03
934000 -- (-292.155) (-291.177) (-289.028) [-292.620] * [-290.060] (-289.678) (-288.312) (-291.633) -- 0:00:03
934500 -- (-293.904) (-294.841) (-290.672) [-289.405] * (-288.855) (-287.923) (-292.015) [-288.748] -- 0:00:03
935000 -- (-288.755) (-289.880) (-288.646) [-288.351] * (-288.311) [-288.083] (-289.743) (-290.501) -- 0:00:03
Average standard deviation of split frequencies: 0.007051
935500 -- [-289.787] (-288.996) (-289.581) (-289.175) * [-287.864] (-287.522) (-289.772) (-287.791) -- 0:00:03
936000 -- [-289.550] (-289.146) (-291.412) (-287.816) * (-289.096) (-288.642) [-287.651] (-287.849) -- 0:00:03
936500 -- [-289.783] (-288.144) (-289.654) (-288.184) * (-288.303) (-295.038) [-287.266] (-288.653) -- 0:00:03
937000 -- [-289.664] (-288.398) (-296.743) (-290.136) * [-287.976] (-290.176) (-289.359) (-290.586) -- 0:00:03
937500 -- [-289.729] (-290.787) (-291.073) (-291.465) * [-288.890] (-289.589) (-289.154) (-288.497) -- 0:00:03
938000 -- [-288.180] (-288.120) (-289.757) (-291.785) * [-288.931] (-293.514) (-288.040) (-289.584) -- 0:00:03
938500 -- (-288.838) (-290.316) (-290.522) [-291.218] * (-292.059) (-288.317) (-291.390) [-290.573] -- 0:00:03
939000 -- (-293.299) [-287.989] (-289.724) (-290.128) * [-288.844] (-287.347) (-289.598) (-288.678) -- 0:00:03
939500 -- (-289.514) (-289.290) (-288.104) [-289.493] * [-288.591] (-287.848) (-289.142) (-289.066) -- 0:00:03
940000 -- [-292.299] (-291.554) (-287.327) (-290.393) * (-290.293) [-291.985] (-288.522) (-288.606) -- 0:00:03
Average standard deviation of split frequencies: 0.007173
940500 -- (-288.720) (-290.037) [-287.722] (-290.826) * (-293.584) [-290.981] (-290.381) (-290.029) -- 0:00:03
941000 -- (-288.526) [-291.966] (-288.447) (-290.295) * [-290.444] (-293.800) (-293.218) (-287.999) -- 0:00:03
941500 -- (-288.432) (-289.766) [-290.643] (-290.773) * (-293.688) (-290.827) (-291.942) [-288.611] -- 0:00:03
942000 -- (-292.897) (-291.249) (-293.775) [-291.396] * (-290.582) (-289.580) [-289.248] (-290.836) -- 0:00:03
942500 -- [-287.985] (-288.650) (-291.923) (-289.779) * [-290.096] (-290.252) (-289.598) (-289.574) -- 0:00:03
943000 -- (-287.914) [-289.989] (-293.878) (-290.094) * [-288.131] (-288.660) (-291.589) (-288.904) -- 0:00:03
943500 -- [-287.304] (-290.375) (-288.342) (-289.315) * (-287.882) (-291.731) (-292.574) [-288.033] -- 0:00:03
944000 -- (-291.114) (-290.788) (-291.236) [-290.699] * (-287.976) (-293.154) [-288.090] (-289.775) -- 0:00:03
944500 -- (-288.793) (-289.479) [-289.249] (-289.294) * (-289.539) (-289.311) [-287.306] (-288.808) -- 0:00:03
945000 -- [-288.452] (-291.797) (-290.933) (-289.835) * (-288.149) (-289.176) [-288.753] (-290.382) -- 0:00:03
Average standard deviation of split frequencies: 0.006883
945500 -- (-288.861) (-290.785) [-288.835] (-287.109) * (-292.559) (-289.289) (-292.492) [-289.877] -- 0:00:03
946000 -- [-288.315] (-288.500) (-292.717) (-288.365) * (-289.803) (-288.303) (-290.865) [-290.007] -- 0:00:03
946500 -- (-288.968) [-287.888] (-288.290) (-288.028) * (-289.074) (-289.278) (-288.405) [-289.434] -- 0:00:03
947000 -- (-288.155) (-288.089) [-290.382] (-289.247) * (-288.362) [-289.767] (-290.292) (-288.317) -- 0:00:03
947500 -- (-287.945) (-290.291) [-289.286] (-289.385) * (-289.488) (-291.136) [-287.343] (-293.425) -- 0:00:03
948000 -- (-288.643) [-288.593] (-288.276) (-290.301) * (-289.754) [-290.707] (-289.070) (-295.473) -- 0:00:03
948500 -- (-288.187) [-290.076] (-289.390) (-288.519) * [-289.886] (-291.473) (-287.871) (-288.258) -- 0:00:02
949000 -- [-289.593] (-291.612) (-289.938) (-289.543) * (-289.358) (-293.594) (-289.414) [-291.124] -- 0:00:02
949500 -- (-290.561) (-288.702) [-291.981] (-293.401) * (-290.372) (-288.824) (-291.202) [-288.598] -- 0:00:02
950000 -- (-289.354) (-291.674) [-289.659] (-291.750) * (-288.634) (-294.326) (-287.613) [-290.659] -- 0:00:02
Average standard deviation of split frequencies: 0.006942
950500 -- (-288.251) [-290.615] (-289.240) (-292.020) * (-290.407) (-290.658) [-289.244] (-290.529) -- 0:00:02
951000 -- [-289.705] (-292.062) (-287.638) (-291.635) * (-290.036) [-290.963] (-288.365) (-289.761) -- 0:00:02
951500 -- (-293.076) (-287.391) (-288.323) [-288.793] * [-288.644] (-288.890) (-288.494) (-289.183) -- 0:00:02
952000 -- [-291.516] (-288.498) (-290.277) (-287.928) * (-288.174) (-289.811) (-287.631) [-289.720] -- 0:00:02
952500 -- [-291.048] (-287.890) (-291.125) (-290.179) * [-288.824] (-289.754) (-289.211) (-287.524) -- 0:00:02
953000 -- (-294.138) (-290.783) [-288.906] (-287.997) * (-288.757) (-289.548) [-288.474] (-288.888) -- 0:00:02
953500 -- (-289.586) [-288.765] (-288.892) (-292.672) * (-288.576) (-292.293) [-288.318] (-291.327) -- 0:00:02
954000 -- (-290.491) (-288.986) (-290.446) [-288.521] * (-288.034) [-288.414] (-294.422) (-291.218) -- 0:00:02
954500 -- (-291.406) (-293.369) (-289.436) [-289.863] * (-287.864) (-287.622) [-290.718] (-290.567) -- 0:00:02
955000 -- (-290.273) (-291.612) (-289.190) [-287.383] * [-290.817] (-289.255) (-295.660) (-291.952) -- 0:00:02
Average standard deviation of split frequencies: 0.006965
955500 -- (-287.319) [-289.547] (-288.220) (-288.215) * (-289.728) (-288.281) (-290.168) [-288.882] -- 0:00:02
956000 -- (-290.835) (-291.529) [-287.772] (-287.651) * (-292.310) (-291.449) [-293.158] (-291.967) -- 0:00:02
956500 -- (-291.498) (-292.924) (-288.368) [-287.238] * (-287.720) [-288.735] (-290.152) (-287.783) -- 0:00:02
957000 -- (-289.192) (-291.406) (-292.953) [-289.847] * (-288.094) (-289.986) (-290.237) [-289.195] -- 0:00:02
957500 -- (-293.736) (-289.439) (-289.993) [-294.239] * [-289.353] (-288.666) (-289.027) (-295.016) -- 0:00:02
958000 -- (-291.272) (-292.812) [-289.951] (-288.377) * (-288.559) (-291.760) (-288.484) [-288.050] -- 0:00:02
958500 -- (-290.612) (-288.071) [-288.415] (-287.316) * (-287.779) (-290.005) (-288.308) [-289.733] -- 0:00:02
959000 -- (-288.075) (-291.881) [-288.364] (-288.420) * (-289.533) [-289.906] (-288.973) (-290.384) -- 0:00:02
959500 -- (-288.823) (-292.392) (-293.694) [-287.546] * (-287.937) [-290.748] (-290.731) (-290.625) -- 0:00:02
960000 -- (-288.909) [-288.269] (-289.905) (-289.301) * (-289.001) [-289.293] (-288.656) (-290.050) -- 0:00:02
Average standard deviation of split frequencies: 0.006993
960500 -- (-287.980) (-288.047) (-290.775) [-288.823] * (-287.975) (-292.015) [-288.786] (-287.940) -- 0:00:02
961000 -- (-299.527) [-288.879] (-291.396) (-288.092) * (-291.875) [-291.543] (-292.342) (-290.073) -- 0:00:02
961500 -- (-291.853) (-288.757) [-290.207] (-289.066) * (-296.115) (-288.092) (-291.112) [-288.708] -- 0:00:02
962000 -- (-290.262) (-287.966) [-292.695] (-289.973) * (-288.306) (-296.363) [-293.631] (-288.970) -- 0:00:02
962500 -- (-291.226) (-287.338) [-288.927] (-291.462) * (-288.485) (-288.980) (-291.988) [-289.531] -- 0:00:02
963000 -- (-291.140) [-288.734] (-290.746) (-290.058) * [-289.004] (-292.589) (-290.619) (-288.639) -- 0:00:02
963500 -- (-295.113) [-289.207] (-288.161) (-291.533) * (-292.849) [-290.322] (-289.052) (-289.404) -- 0:00:02
964000 -- (-287.583) (-288.768) (-296.606) [-290.484] * [-291.317] (-289.919) (-288.701) (-288.375) -- 0:00:02
964500 -- (-288.052) (-293.250) (-291.696) [-288.971] * [-290.162] (-290.744) (-288.306) (-289.026) -- 0:00:02
965000 -- (-288.626) (-289.813) [-292.223] (-290.397) * (-289.302) (-290.359) (-288.113) [-289.342] -- 0:00:02
Average standard deviation of split frequencies: 0.006862
965500 -- (-294.626) [-292.499] (-289.590) (-290.024) * (-292.935) (-290.499) [-289.548] (-290.678) -- 0:00:02
966000 -- (-288.916) [-289.683] (-288.297) (-290.991) * (-293.470) (-289.998) (-289.210) [-289.926] -- 0:00:01
966500 -- (-290.224) [-291.626] (-288.387) (-294.654) * (-291.927) (-291.637) (-287.894) [-289.216] -- 0:00:01
967000 -- (-287.611) (-288.665) (-287.926) [-289.560] * (-288.998) [-288.384] (-292.295) (-290.250) -- 0:00:01
967500 -- (-291.212) (-289.815) [-288.770] (-289.489) * (-288.306) (-289.356) (-292.397) [-289.718] -- 0:00:01
968000 -- [-288.077] (-288.993) (-287.549) (-288.749) * (-289.517) [-293.310] (-291.688) (-293.154) -- 0:00:01
968500 -- (-288.475) (-290.271) [-287.841] (-288.432) * (-290.142) (-291.160) [-291.721] (-291.400) -- 0:00:01
969000 -- (-288.069) (-288.577) [-290.326] (-287.462) * (-290.875) [-288.871] (-293.067) (-291.753) -- 0:00:01
969500 -- (-292.348) (-288.619) [-288.861] (-288.298) * (-288.504) (-287.875) [-290.312] (-294.025) -- 0:00:01
970000 -- (-288.887) (-290.975) [-289.201] (-292.133) * (-296.257) [-288.359] (-289.508) (-290.825) -- 0:00:01
Average standard deviation of split frequencies: 0.006890
970500 -- (-288.585) [-288.192] (-288.004) (-288.247) * (-291.251) [-288.683] (-288.137) (-288.880) -- 0:00:01
971000 -- [-288.962] (-288.424) (-288.221) (-289.023) * (-290.813) (-290.025) [-288.995] (-291.562) -- 0:00:01
971500 -- (-289.169) [-288.098] (-292.319) (-290.080) * [-288.958] (-289.106) (-291.193) (-290.364) -- 0:00:01
972000 -- (-288.865) (-292.192) [-288.923] (-290.031) * (-289.642) (-288.829) (-291.133) [-291.173] -- 0:00:01
972500 -- (-287.748) (-295.136) (-287.778) [-287.354] * (-290.352) (-290.004) (-295.019) [-290.263] -- 0:00:01
973000 -- [-288.803] (-296.537) (-290.146) (-287.554) * [-288.665] (-289.080) (-290.432) (-289.281) -- 0:00:01
973500 -- (-287.108) (-292.141) (-289.416) [-288.479] * [-289.877] (-288.728) (-290.523) (-288.680) -- 0:00:01
974000 -- (-288.562) (-290.207) (-288.167) [-288.612] * (-290.696) [-289.692] (-292.056) (-290.222) -- 0:00:01
974500 -- (-289.111) [-288.814] (-291.833) (-288.681) * [-288.165] (-288.737) (-289.295) (-293.442) -- 0:00:01
975000 -- [-289.177] (-290.706) (-292.250) (-290.858) * [-288.697] (-289.117) (-287.963) (-288.906) -- 0:00:01
Average standard deviation of split frequencies: 0.006973
975500 -- (-289.245) (-290.517) [-289.243] (-291.350) * (-293.171) (-288.267) (-292.060) [-287.784] -- 0:00:01
976000 -- (-288.638) [-290.213] (-288.583) (-292.730) * (-289.762) [-288.629] (-290.129) (-289.076) -- 0:00:01
976500 -- (-287.757) (-289.947) [-289.633] (-291.582) * (-288.825) (-288.467) [-288.886] (-288.783) -- 0:00:01
977000 -- (-289.710) [-289.076] (-289.452) (-290.276) * (-290.278) [-292.132] (-291.623) (-289.770) -- 0:00:01
977500 -- [-287.990] (-293.703) (-289.661) (-289.066) * (-290.790) [-287.498] (-290.799) (-289.302) -- 0:00:01
978000 -- (-289.115) (-290.705) [-288.646] (-288.463) * (-287.738) [-289.970] (-292.486) (-290.518) -- 0:00:01
978500 -- [-290.394] (-292.418) (-294.032) (-289.577) * (-289.260) [-288.502] (-296.039) (-289.461) -- 0:00:01
979000 -- (-292.990) (-293.680) (-289.928) [-287.484] * (-289.224) (-293.950) (-290.974) [-292.000] -- 0:00:01
979500 -- (-290.045) (-292.553) (-291.109) [-289.771] * (-287.663) (-289.614) (-288.675) [-290.866] -- 0:00:01
980000 -- (-291.731) (-287.626) (-287.950) [-288.859] * (-289.233) (-289.008) (-291.046) [-289.465] -- 0:00:01
Average standard deviation of split frequencies: 0.006970
980500 -- (-287.524) (-291.410) (-288.135) [-288.518] * [-289.930] (-288.364) (-288.054) (-289.387) -- 0:00:01
981000 -- (-290.034) (-288.726) [-289.304] (-287.863) * (-289.057) (-289.056) [-289.751] (-288.732) -- 0:00:01
981500 -- (-290.748) [-290.448] (-289.069) (-288.339) * (-289.358) (-288.542) (-287.344) [-288.260] -- 0:00:01
982000 -- (-291.276) (-288.445) [-288.020] (-290.703) * (-288.923) (-288.021) [-290.028] (-287.592) -- 0:00:01
982500 -- (-288.934) (-287.421) [-288.239] (-287.172) * (-289.301) (-290.608) [-289.503] (-290.001) -- 0:00:01
983000 -- (-289.043) (-291.989) (-289.285) [-287.983] * (-288.432) (-288.690) [-289.035] (-289.919) -- 0:00:00
983500 -- (-288.541) (-293.332) (-288.126) [-290.675] * (-291.295) [-289.530] (-287.932) (-289.976) -- 0:00:00
984000 -- (-289.492) [-289.888] (-288.951) (-288.197) * [-287.912] (-293.132) (-288.113) (-292.914) -- 0:00:00
984500 -- [-288.655] (-288.871) (-287.764) (-290.562) * (-291.481) [-289.034] (-290.207) (-288.945) -- 0:00:00
985000 -- [-288.777] (-288.713) (-290.766) (-293.040) * [-289.664] (-291.973) (-290.315) (-291.111) -- 0:00:00
Average standard deviation of split frequencies: 0.007231
985500 -- [-288.408] (-289.866) (-287.962) (-292.272) * (-292.066) [-290.765] (-289.733) (-289.623) -- 0:00:00
986000 -- (-287.843) [-290.175] (-288.496) (-289.188) * (-288.114) (-288.708) (-288.765) [-289.870] -- 0:00:00
986500 -- (-289.238) (-290.492) (-288.717) [-290.204] * (-290.536) [-288.289] (-287.882) (-292.638) -- 0:00:00
987000 -- (-290.543) [-288.938] (-291.299) (-289.617) * [-290.858] (-290.709) (-289.994) (-288.183) -- 0:00:00
987500 -- (-289.019) (-290.088) (-291.589) [-292.712] * [-291.560] (-290.198) (-293.128) (-291.753) -- 0:00:00
988000 -- (-290.769) (-293.279) [-288.340] (-289.018) * (-290.101) [-290.289] (-292.374) (-288.805) -- 0:00:00
988500 -- (-291.911) (-290.190) (-293.826) [-288.659] * (-288.700) (-290.132) (-292.434) [-290.213] -- 0:00:00
989000 -- (-288.262) (-290.011) [-290.563] (-289.523) * (-293.890) [-292.547] (-291.095) (-288.527) -- 0:00:00
989500 -- (-287.274) (-288.530) [-291.063] (-289.786) * (-289.426) (-290.098) (-290.813) [-287.964] -- 0:00:00
990000 -- (-288.287) (-287.843) (-288.825) [-287.339] * (-289.682) (-291.945) [-290.900] (-288.838) -- 0:00:00
Average standard deviation of split frequencies: 0.006930
990500 -- (-289.572) [-289.252] (-287.343) (-290.296) * (-290.646) [-288.813] (-289.873) (-288.507) -- 0:00:00
991000 -- [-288.854] (-287.645) (-288.928) (-288.860) * [-290.736] (-288.604) (-290.550) (-288.270) -- 0:00:00
991500 -- (-288.330) (-290.725) (-288.435) [-291.451] * (-291.296) [-289.878] (-290.890) (-290.230) -- 0:00:00
992000 -- (-287.795) (-290.073) (-289.240) [-290.221] * (-287.403) (-290.863) (-290.286) [-291.447] -- 0:00:00
992500 -- (-290.335) (-288.310) [-288.048] (-288.424) * (-287.253) (-289.622) [-291.397] (-291.015) -- 0:00:00
993000 -- (-288.359) (-290.379) (-289.096) [-287.817] * (-290.129) [-293.389] (-290.050) (-290.571) -- 0:00:00
993500 -- [-291.945] (-287.783) (-290.322) (-288.188) * (-292.150) [-288.602] (-287.327) (-289.518) -- 0:00:00
994000 -- (-288.992) (-288.909) [-289.805] (-290.108) * (-288.385) [-294.067] (-293.298) (-288.228) -- 0:00:00
994500 -- (-290.016) (-293.766) [-291.831] (-290.490) * (-289.423) (-292.614) [-289.709] (-289.406) -- 0:00:00
995000 -- (-287.889) (-289.266) [-290.826] (-287.476) * (-288.166) (-289.833) (-291.917) [-289.985] -- 0:00:00
Average standard deviation of split frequencies: 0.006744
995500 -- [-290.087] (-292.053) (-291.051) (-292.328) * (-288.415) (-289.704) [-290.199] (-289.192) -- 0:00:00
996000 -- (-291.975) (-287.977) (-292.894) [-288.525] * (-288.545) (-291.007) [-291.957] (-289.962) -- 0:00:00
996500 -- (-290.781) (-289.791) [-288.450] (-288.903) * [-289.615] (-288.783) (-290.609) (-291.856) -- 0:00:00
997000 -- (-290.602) (-290.919) (-292.522) [-288.132] * [-287.359] (-288.964) (-288.300) (-288.524) -- 0:00:00
997500 -- [-289.166] (-289.735) (-293.638) (-288.519) * (-288.364) [-289.159] (-288.491) (-288.859) -- 0:00:00
998000 -- (-291.824) (-288.694) (-288.914) [-288.834] * (-288.595) (-289.176) [-288.120] (-292.754) -- 0:00:00
998500 -- (-289.808) (-291.669) (-290.011) [-287.931] * (-289.700) (-289.734) (-290.346) [-288.155] -- 0:00:00
999000 -- (-288.641) (-288.286) (-288.221) [-291.690] * [-290.671] (-291.641) (-291.525) (-289.968) -- 0:00:00
999500 -- [-288.947] (-288.440) (-288.884) (-288.250) * (-289.241) (-290.758) [-288.336] (-290.591) -- 0:00:00
1000000 -- (-288.408) [-289.310] (-288.792) (-288.373) * (-289.636) (-289.756) [-290.099] (-291.087) -- 0:00:00
Average standard deviation of split frequencies: 0.006654
Analysis completed in 58 seconds
Analysis used 56.89 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -287.06
Likelihood of best state for "cold" chain of run 2 was -287.06
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
46.3 % ( 45 %) Dirichlet(Pi{all})
43.6 % ( 26 %) Slider(Pi{all})
78.3 % ( 47 %) Multiplier(Alpha{1,2})
78.3 % ( 46 %) Multiplier(Alpha{3})
27.1 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 58 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
45.9 % ( 44 %) Dirichlet(Pi{all})
43.1 % ( 29 %) Slider(Pi{all})
78.8 % ( 45 %) Multiplier(Alpha{1,2})
77.6 % ( 60 %) Multiplier(Alpha{3})
28.5 % ( 15 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 79 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 87 %) ParsSPR(Tau{all},V{all})
28.0 % ( 30 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.4 % ( 19 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 166609 0.82 0.67
3 | 166515 166418 0.84
4 | 166511 166439 167508
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166717 0.82 0.67
3 | 166746 166438 0.84
4 | 166669 166840 166590
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -288.91
|1 * 1 1 2 1 2 1 |
| 1 1 * 1 1 2 1 |
| 21 2 2 222 2 2 21 2 2 1 |
|2 1 2 11 12 2 2 222 1 21 |
| 1 1 2 2 22 ** 1 1 11 21 1 1 1 1 1 2 |
| 22 1 1 * 12 1 22 2 1 1 2 12 2 1|
| 2 2 1 1 2 12 1 2 |
| 22 2 1 1 222 2 1 1 |
| 1 1 1 12 12 |
| 1 2 2|
| 1 |
| 1 |
| |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -290.99
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -288.80 -291.91
2 -288.79 -292.30
--------------------------------------
TOTAL -288.80 -292.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895882 0.095827 0.380378 1.526504 0.857581 1280.96 1390.98 1.000
r(A<->C){all} 0.170543 0.020742 0.000021 0.463445 0.132601 120.02 147.04 1.002
r(A<->G){all} 0.160298 0.018971 0.000030 0.429086 0.120020 239.22 288.40 1.000
r(A<->T){all} 0.174874 0.022368 0.000063 0.473358 0.135955 140.68 161.48 1.000
r(C<->G){all} 0.149526 0.017595 0.000093 0.422501 0.110395 220.90 235.56 1.000
r(C<->T){all} 0.171901 0.020091 0.000206 0.474434 0.137472 189.30 229.00 1.000
r(G<->T){all} 0.172857 0.020666 0.000098 0.465335 0.137672 191.66 217.90 1.002
pi(A){all} 0.174210 0.000681 0.122705 0.225415 0.173436 1120.58 1310.79 1.000
pi(C){all} 0.265446 0.000891 0.209849 0.325972 0.264334 1165.55 1250.76 1.000
pi(G){all} 0.298161 0.000991 0.238360 0.361513 0.297308 1171.02 1247.74 1.001
pi(T){all} 0.262183 0.000904 0.201532 0.317675 0.261163 1313.65 1407.33 1.001
alpha{1,2} 0.417385 0.230205 0.000237 1.397936 0.243918 800.00 1011.86 1.000
alpha{3} 0.440089 0.241295 0.000216 1.442665 0.280301 1457.63 1479.31 1.000
pinvar{all} 0.992042 0.000097 0.973463 0.999992 0.995156 1356.80 1362.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- .*...*
9 -- ..*.*.
10 -- ...*.*
11 -- .*.*..
12 -- ..**..
13 -- .**.**
14 -- .****.
15 -- ..****
16 -- .*.***
17 -- .*..*.
18 -- ....**
19 -- .**...
20 -- ..*..*
21 -- ...**.
22 -- .*.*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 472 0.157229 0.002827 0.155230 0.159227 2
8 460 0.153231 0.004711 0.149900 0.156562 2
9 460 0.153231 0.012248 0.144570 0.161892 2
10 452 0.150566 0.007537 0.145237 0.155896 2
11 439 0.146236 0.007066 0.141239 0.151233 2
12 436 0.145237 0.000942 0.144570 0.145903 2
13 426 0.141905 0.002827 0.139907 0.143904 2
14 425 0.141572 0.014604 0.131246 0.151899 2
15 423 0.140906 0.013662 0.131246 0.150566 2
16 409 0.136243 0.008951 0.129913 0.142572 2
17 408 0.135909 0.002827 0.133911 0.137908 2
18 404 0.134577 0.001884 0.133245 0.135909 2
19 403 0.134244 0.011777 0.125916 0.142572 2
20 403 0.134244 0.010835 0.126582 0.141905 2
21 400 0.133245 0.003769 0.130580 0.135909 2
22 306 0.101932 0.000000 0.101932 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100961 0.010128 0.000009 0.304109 0.070555 1.000 2
length{all}[2] 0.100407 0.010116 0.000001 0.301988 0.069499 1.000 2
length{all}[3] 0.099390 0.010062 0.000000 0.302305 0.067924 1.000 2
length{all}[4] 0.096639 0.009234 0.000016 0.283587 0.069133 1.000 2
length{all}[5] 0.098854 0.009983 0.000017 0.303460 0.066452 1.000 2
length{all}[6] 0.101435 0.009870 0.000175 0.302982 0.069083 1.000 2
length{all}[7] 0.099128 0.009653 0.000126 0.305605 0.068632 0.998 2
length{all}[8] 0.098596 0.009041 0.000143 0.296098 0.068956 0.998 2
length{all}[9] 0.101185 0.011638 0.000066 0.311708 0.066418 0.998 2
length{all}[10] 0.108144 0.012664 0.000143 0.331251 0.071475 0.998 2
length{all}[11] 0.096449 0.009465 0.000987 0.279410 0.063313 1.000 2
length{all}[12] 0.097981 0.012538 0.000090 0.317055 0.064585 0.998 2
length{all}[13] 0.095730 0.009416 0.000029 0.287185 0.065505 0.999 2
length{all}[14] 0.097442 0.008809 0.000064 0.289050 0.069314 0.998 2
length{all}[15] 0.096726 0.009644 0.000232 0.302823 0.066535 0.998 2
length{all}[16] 0.097216 0.010830 0.000007 0.332851 0.060719 0.999 2
length{all}[17] 0.101571 0.010007 0.000251 0.296542 0.069311 1.001 2
length{all}[18] 0.109144 0.012907 0.000002 0.336539 0.074636 0.998 2
length{all}[19] 0.100412 0.009094 0.000082 0.308071 0.070892 0.998 2
length{all}[20] 0.099816 0.010621 0.000026 0.303249 0.070156 1.000 2
length{all}[21] 0.099072 0.009551 0.000593 0.308123 0.066557 0.998 2
length{all}[22] 0.112533 0.012828 0.000278 0.322827 0.077935 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006654
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 210
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 33 patterns at 70 / 70 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 33 patterns at 70 / 70 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
32208 bytes for conP
2904 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.034106 0.075169 0.049772 0.012859 0.067278 0.029034 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -288.792115
Iterating by ming2
Initial: fx= 288.792115
x= 0.03411 0.07517 0.04977 0.01286 0.06728 0.02903 0.30000 1.30000
1 h-m-p 0.0000 0.0002 168.8533 +++ 283.500890 m 0.0002 14 | 1/8
2 h-m-p 0.0009 0.2466 30.3908 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 154.3292 +++ 277.920399 m 0.0002 46 | 2/8
4 h-m-p 0.0012 0.2884 27.0197 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 138.3146 ++ 276.514898 m 0.0001 77 | 3/8
6 h-m-p 0.0007 0.3550 22.5611 -----------.. | 3/8
7 h-m-p 0.0000 0.0002 119.7281 +++ 273.249130 m 0.0002 109 | 4/8
8 h-m-p 0.0013 0.4694 17.4405 -----------.. | 4/8
9 h-m-p 0.0000 0.0003 97.9153 +++ 270.799749 m 0.0003 141 | 5/8
10 h-m-p 0.0014 0.6833 12.4359 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 69.4153 ++ 270.244510 m 0.0001 172 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ---Y 270.244510 0 0.0063 186 | 6/8
13 h-m-p 0.1380 8.0000 0.0000 ------------C 270.244510 0 0.0000 211
Out..
lnL = -270.244510
212 lfun, 212 eigenQcodon, 1272 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.045677 0.100691 0.056837 0.090584 0.067601 0.019463 0.300141 0.511597 0.319658
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.393247
np = 9
lnL0 = -295.713255
Iterating by ming2
Initial: fx= 295.713255
x= 0.04568 0.10069 0.05684 0.09058 0.06760 0.01946 0.30014 0.51160 0.31966
1 h-m-p 0.0000 0.0003 158.4591 +++ 288.156151 m 0.0003 15 | 1/9
2 h-m-p 0.0003 0.0015 89.9821 ++ 279.299646 m 0.0015 27 | 2/9
3 h-m-p 0.0000 0.0001 611.5222 ++ 276.440820 m 0.0001 39 | 3/9
4 h-m-p 0.0001 0.0004 178.3800 ++ 274.106351 m 0.0004 51 | 4/9
5 h-m-p 0.0000 0.0001 2110.2820 ++ 270.943614 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0000 1424.6697 ++ 270.913656 m 0.0000 75 | 6/9
7 h-m-p 0.0009 0.4473 2.1766 -----------.. | 6/9
8 h-m-p 0.0000 0.0001 68.4883 ++ 270.244501 m 0.0001 108 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 270.244501 m 8.0000 120 | 7/9
10 h-m-p 0.0705 8.0000 0.0001 ---------Y 270.244501 0 0.0000 143
Out..
lnL = -270.244501
144 lfun, 432 eigenQcodon, 1728 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.023469 0.019519 0.049473 0.039103 0.054421 0.058449 0.279658 1.311356 0.535323 0.386991 1.397918
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.958530
np = 11
lnL0 = -286.757565
Iterating by ming2
Initial: fx= 286.757565
x= 0.02347 0.01952 0.04947 0.03910 0.05442 0.05845 0.27966 1.31136 0.53532 0.38699 1.39792
1 h-m-p 0.0000 0.0003 161.4715 +++ 278.984660 m 0.0003 17 | 1/11
2 h-m-p 0.0002 0.0009 43.3620 ++ 277.584185 m 0.0009 31 | 2/11
3 h-m-p 0.0001 0.0003 215.7657 ++ 273.539000 m 0.0003 45 | 3/11
4 h-m-p 0.0002 0.0010 129.4752 ++ 271.214347 m 0.0010 59 | 4/11
5 h-m-p 0.0000 0.0000 2193.0539 ++ 270.511531 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 2687.6636 ++ 270.282324 m 0.0000 87 | 6/11
7 h-m-p 0.0021 0.0558 9.9004 ------------.. | 6/11
8 h-m-p 0.0000 0.0000 69.1724 ++ 270.244503 m 0.0000 125 | 7/11
9 h-m-p 0.0160 8.0000 0.0000 Y 270.244503 0 0.0040 139 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 Y 270.244503 0 0.0040 157
Out..
lnL = -270.244503
158 lfun, 632 eigenQcodon, 2844 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -270.248766 S = -270.243577 -0.001983
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 33 patterns 0:01
did 20 / 33 patterns 0:01
did 30 / 33 patterns 0:02
did 33 / 33 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075790 0.084957 0.022876 0.027805 0.088176 0.072489 0.259696 0.785872 1.613147
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.509998
np = 9
lnL0 = -294.814244
Iterating by ming2
Initial: fx= 294.814244
x= 0.07579 0.08496 0.02288 0.02781 0.08818 0.07249 0.25970 0.78587 1.61315
1 h-m-p 0.0000 0.0004 155.3022 +++ 286.088748 m 0.0004 15 | 1/9
2 h-m-p 0.0029 0.0165 17.5211 ++ 285.025864 m 0.0165 27 | 2/9
3 h-m-p 0.0001 0.0007 271.8812 ++ 281.989915 m 0.0007 39 | 3/9
4 h-m-p 0.0000 0.0002 1077.0140 ++ 277.042550 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0001 1763.0890 ++ 275.638128 m 0.0001 63 | 5/9
6 h-m-p 0.0001 0.0003 26.9027 ++ 275.299057 m 0.0003 75 | 6/9
7 h-m-p 0.0001 0.0014 35.2735 ++ 272.945274 m 0.0014 87 | 7/9
8 h-m-p 0.0126 1.4340 1.3640 -------------.. | 7/9
9 h-m-p 0.0000 0.0007 63.6077 ++++ 270.244446 m 0.0007 124 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 Y 270.244446 0 0.4000 136 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 270.244446 0 0.4000 149
Out..
lnL = -270.244446
150 lfun, 1650 eigenQcodon, 9000 P(t)
Time used: 0:04
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053835 0.015416 0.088650 0.085814 0.098207 0.107048 0.000100 0.900000 1.180578 1.565052 1.299976
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.643525
np = 11
lnL0 = -299.456494
Iterating by ming2
Initial: fx= 299.456494
x= 0.05383 0.01542 0.08865 0.08581 0.09821 0.10705 0.00011 0.90000 1.18058 1.56505 1.29998
1 h-m-p 0.0000 0.0000 150.6358 ++ 299.306654 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0020 60.1307 ++++ 293.348939 m 0.0020 32 | 2/11
3 h-m-p 0.0005 0.0024 55.4429 ++ 280.728897 m 0.0024 46 | 3/11
4 h-m-p 0.0026 0.0128 39.4825 ++ 272.532255 m 0.0128 60 | 4/11
5 h-m-p 0.0000 0.0001 1327.3699 ++ 271.971236 m 0.0001 74 | 5/11
6 h-m-p 0.0002 0.0023 382.8369 ++ 270.634485 m 0.0023 88 | 6/11
7 h-m-p 0.0000 0.0000 54662.4009 +
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+ 270.395276 m 0.0000 102
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212356e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
| 7/11
8 h-m-p 0.0076 0.0517 35.9116
QuantileBeta(0.15, 0.00500, 2.14679) = 1.231594e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16697) = 1.217110e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17201) = 1.213542e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17327) = 1.212653e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17359) = 1.212431e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17367) = 1.212375e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212362e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212358e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212356e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
| 7/11
9 h-m-p 0.0000 0.0000 69.4416
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+ 270.244515 m 0.0000 141
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212356e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
| 8/11
10 h-m-p 0.1091 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+ 270.244515 m 8.0000 157
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17381) = 1.212272e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17357) = 1.212442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
| 7/11
11 h-m-p 0.0465 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+ 270.244515 m 8.0000 176
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17381) = 1.212272e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17357) = 1.212442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
| 7/11
12 h-m-p 0.0075 3.7573 0.4571
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+ 270.244503 m 3.7573 197
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17381) = 1.212272e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17357) = 1.212442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
| 8/11
13 h-m-p 0.0714 0.3568 0.7403
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
+ 270.244495 m 0.3568 215
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17381) = 1.212272e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17357) = 1.212442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
| 9/11
14 h-m-p 0.5019 2.5097 0.2611
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
C 270.244495 0 0.0000 245
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17381) = 1.212272e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17357) = 1.212442e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212357e-160 2000 rounds
| 9/11
15 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.17369) = 1.212356e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17370) = 1.212355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17370) = 1.212349e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17374) = 1.212326e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17387) = 1.212234e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
+ 270.244495 m 8.0000 264
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17415) = 1.212032e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17391) = 1.212203e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
| 9/11
16 h-m-p 0.0041 2.0410 0.3424
QuantileBeta(0.15, 0.00500, 2.17355) = 1.212456e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17391) = 1.212202e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17400) = 1.212139e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212123e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212119e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212118e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212118e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
N 270.244495 0 0.0000 291
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17415) = 1.212032e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17391) = 1.212203e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
| 9/11
17 h-m-p 0.0003 0.1391 2.6327
QuantileBeta(0.15, 0.00500, 2.17429) = 1.211940e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17504) = 1.211409e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17806) = 1.209288e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19015) = 1.200877e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.23852) = 1.168360e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
+ 270.244446 m 0.1391 310
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.168895e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129465e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29998) = 1.129466e-160 2000 rounds
| 10/11
18 h-m-p 1.0000 8.0000 0.1259
QuantileBeta(0.15, 0.00500, 2.17403) = 1.212117e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26849) = 1.149066e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29211) = 1.134304e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29801) = 1.130672e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29949) = 1.129767e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29985) = 1.129541e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129483e-160 2000 rounds
C 270.244446 0 0.0002 329
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.168915e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30007) = 1.129409e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29982) = 1.129561e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
| 10/11
19 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
N 270.244446 0 0.4000 344
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.168915e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30007) = 1.129409e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29982) = 1.129561e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
| 10/11
20 h-m-p 0.6667 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
Y 270.244446 0 0.6667 359
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.168915e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30007) = 1.129409e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29982) = 1.129561e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
| 10/11
21 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
N 270.244446 0 0.1000 375
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
Out..
lnL = -270.244446
376 lfun, 4512 eigenQcodon, 24816 P(t)
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -270.262947 S = -270.244732 -0.008007
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 33 patterns 0:10
did 20 / 33 patterns 0:10
did 30 / 33 patterns 0:11
did 33 / 33 patterns 0:11
QuantileBeta(0.15, 0.00500, 2.29995) = 1.129485e-160 2000 rounds
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=70
NC_011896_1_WP_010907638_1_275_MLBR_RS01350 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
NC_002677_1_NP_301314_1_186_ML0265 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER
**************************************************
NC_011896_1_WP_010907638_1_275_MLBR_RS01350 PDDVVKTQLFARIVTLLTWI
NC_002677_1_NP_301314_1_186_ML0265 PDDVVKTQLFARIVTLLTWI
NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585 PDDVVKTQLFARIVTLLTWI
NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485 PDDVVKTQLFARIVTLLTWI
NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425 PDDVVKTQLFARIVTLLTWI
NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475 PDDVVKTQLFARIVTLLTWI
********************
>NC_011896_1_WP_010907638_1_275_MLBR_RS01350 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT CACCTGGATT >NC_002677_1_NP_301314_1_186_ML0265 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT CACCTGGATT >NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT CACCTGGATT >NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT CACCTGGATT >NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT CACCTGGATT >NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475 TTGGTGCTGACAGTTTTGGTATTTGCGCTCACCGAGTCGTTCACCACCAG CTGGATAAAGCAGTTTAGCATCGCCGGGATCTTGTGGGTGGTGCTCATTG GCCAGCTGACCGGCGAACTGTTTGTGCGTGACTTCGCAGCCGCGGAACGG CCTGACGACGTGGTCAAGACTCAGCTGTTCGCCCGGATCGTTACGCTACT CACCTGGATT
>NC_011896_1_WP_010907638_1_275_MLBR_RS01350 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER PDDVVKTQLFARIVTLLTWI >NC_002677_1_NP_301314_1_186_ML0265 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER PDDVVKTQLFARIVTLLTWI >NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER PDDVVKTQLFARIVTLLTWI >NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER PDDVVKTQLFARIVTLLTWI >NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER PDDVVKTQLFARIVTLLTWI >NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475 LVLTVLVFALTESFTTSWIKQFSIAGILWVVLIGQLTGELFVRDFAAAER PDDVVKTQLFARIVTLLTWI
#NEXUS
[ID: 0331645202]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907638_1_275_MLBR_RS01350
NC_002677_1_NP_301314_1_186_ML0265
NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585
NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485
NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425
NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907638_1_275_MLBR_RS01350,
2 NC_002677_1_NP_301314_1_186_ML0265,
3 NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585,
4 NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485,
5 NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425,
6 NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07055465,2:0.06949947,3:0.06792402,4:0.06913299,5:0.06645164,6:0.06908335);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07055465,2:0.06949947,3:0.06792402,4:0.06913299,5:0.06645164,6:0.06908335);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -288.80 -291.91
2 -288.79 -292.30
--------------------------------------
TOTAL -288.80 -292.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0265/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895882 0.095827 0.380378 1.526504 0.857581 1280.96 1390.98 1.000
r(A<->C){all} 0.170543 0.020742 0.000021 0.463445 0.132601 120.02 147.04 1.002
r(A<->G){all} 0.160298 0.018971 0.000030 0.429086 0.120020 239.22 288.40 1.000
r(A<->T){all} 0.174874 0.022368 0.000063 0.473358 0.135955 140.68 161.48 1.000
r(C<->G){all} 0.149526 0.017595 0.000093 0.422501 0.110395 220.90 235.56 1.000
r(C<->T){all} 0.171901 0.020091 0.000206 0.474434 0.137472 189.30 229.00 1.000
r(G<->T){all} 0.172857 0.020666 0.000098 0.465335 0.137672 191.66 217.90 1.002
pi(A){all} 0.174210 0.000681 0.122705 0.225415 0.173436 1120.58 1310.79 1.000
pi(C){all} 0.265446 0.000891 0.209849 0.325972 0.264334 1165.55 1250.76 1.000
pi(G){all} 0.298161 0.000991 0.238360 0.361513 0.297308 1171.02 1247.74 1.001
pi(T){all} 0.262183 0.000904 0.201532 0.317675 0.261163 1313.65 1407.33 1.001
alpha{1,2} 0.417385 0.230205 0.000237 1.397936 0.243918 800.00 1011.86 1.000
alpha{3} 0.440089 0.241295 0.000216 1.442665 0.280301 1457.63 1479.31 1.000
pinvar{all} 0.992042 0.000097 0.973463 0.999992 0.995156 1356.80 1362.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0265/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 70
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 4 4 4 4 4 4 | CCG 0 0 0 0 0 0 | CAG 3 3 3 3 3 3 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 5 5 5 5 5 5 | AAC 0 0 0 0 0 0 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 1 1 1 1 1 1 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 0 0 0 0 0 0 | Asp GAT 0 0 0 0 0 0 | Gly GGT 0 0 0 0 0 0
GTC 1 1 1 1 1 1 | GCC 3 3 3 3 3 3 | GAC 3 3 3 3 3 3 | GGC 2 2 2 2 2 2
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 2 2 2 2 2 2 | GGA 0 0 0 0 0 0
GTG 5 5 5 5 5 5 | GCG 2 2 2 2 2 2 | GAG 1 1 1 1 1 1 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907638_1_275_MLBR_RS01350
position 1: T:0.18571 C:0.21429 A:0.25714 G:0.34286
position 2: T:0.45714 C:0.22857 A:0.15714 G:0.15714
position 3: T:0.14286 C:0.35714 A:0.10000 G:0.40000
Average T:0.26190 C:0.26667 A:0.17143 G:0.30000
#2: NC_002677_1_NP_301314_1_186_ML0265
position 1: T:0.18571 C:0.21429 A:0.25714 G:0.34286
position 2: T:0.45714 C:0.22857 A:0.15714 G:0.15714
position 3: T:0.14286 C:0.35714 A:0.10000 G:0.40000
Average T:0.26190 C:0.26667 A:0.17143 G:0.30000
#3: NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585
position 1: T:0.18571 C:0.21429 A:0.25714 G:0.34286
position 2: T:0.45714 C:0.22857 A:0.15714 G:0.15714
position 3: T:0.14286 C:0.35714 A:0.10000 G:0.40000
Average T:0.26190 C:0.26667 A:0.17143 G:0.30000
#4: NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485
position 1: T:0.18571 C:0.21429 A:0.25714 G:0.34286
position 2: T:0.45714 C:0.22857 A:0.15714 G:0.15714
position 3: T:0.14286 C:0.35714 A:0.10000 G:0.40000
Average T:0.26190 C:0.26667 A:0.17143 G:0.30000
#5: NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425
position 1: T:0.18571 C:0.21429 A:0.25714 G:0.34286
position 2: T:0.45714 C:0.22857 A:0.15714 G:0.15714
position 3: T:0.14286 C:0.35714 A:0.10000 G:0.40000
Average T:0.26190 C:0.26667 A:0.17143 G:0.30000
#6: NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475
position 1: T:0.18571 C:0.21429 A:0.25714 G:0.34286
position 2: T:0.45714 C:0.22857 A:0.15714 G:0.15714
position 3: T:0.14286 C:0.35714 A:0.10000 G:0.40000
Average T:0.26190 C:0.26667 A:0.17143 G:0.30000
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 0 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 6 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 6
CTC 18 | CCC 0 | CAC 0 | CGC 0
CTA 6 | CCA 0 | Gln Q CAA 0 | CGA 0
CTG 24 | CCG 0 | CAG 18 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 18 | ACC 30 | AAC 0 | AGC 12
ATA 6 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 0 | ACG 6 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 0 | Asp D GAT 0 | Gly G GGT 0
GTC 6 | GCC 18 | GAC 18 | GGC 12
GTA 6 | GCA 6 | Glu E GAA 12 | GGA 0
GTG 30 | GCG 12 | GAG 6 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18571 C:0.21429 A:0.25714 G:0.34286
position 2: T:0.45714 C:0.22857 A:0.15714 G:0.15714
position 3: T:0.14286 C:0.35714 A:0.10000 G:0.40000
Average T:0.26190 C:0.26667 A:0.17143 G:0.30000
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -270.244510 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300141 1.299976
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907638_1_275_MLBR_RS01350: 0.000004, NC_002677_1_NP_301314_1_186_ML0265: 0.000004, NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585: 0.000004, NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485: 0.000004, NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425: 0.000004, NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30014
omega (dN/dS) = 1.29998
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 160.8 49.2 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 160.8 49.2 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 160.8 49.2 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 160.8 49.2 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 160.8 49.2 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 160.8 49.2 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -270.244501 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.279658 0.614408 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907638_1_275_MLBR_RS01350: 0.000004, NC_002677_1_NP_301314_1_186_ML0265: 0.000004, NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585: 0.000004, NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485: 0.000004, NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425: 0.000004, NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.27966
MLEs of dN/dS (w) for site classes (K=2)
p: 0.61441 0.38559
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 160.9 49.1 0.3856 0.0000 0.0000 0.0 0.0
7..2 0.000 160.9 49.1 0.3856 0.0000 0.0000 0.0 0.0
7..3 0.000 160.9 49.1 0.3856 0.0000 0.0000 0.0 0.0
7..4 0.000 160.9 49.1 0.3856 0.0000 0.0000 0.0 0.0
7..5 0.000 160.9 49.1 0.3856 0.0000 0.0000 0.0 0.0
7..6 0.000 160.9 49.1 0.3856 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -270.244503 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.259696 0.588988 0.256237 0.000001 1.488637
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907638_1_275_MLBR_RS01350: 0.000004, NC_002677_1_NP_301314_1_186_ML0265: 0.000004, NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585: 0.000004, NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485: 0.000004, NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425: 0.000004, NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.25970
MLEs of dN/dS (w) for site classes (K=3)
p: 0.58899 0.25624 0.15478
w: 0.00000 1.00000 1.48864
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 161.0 49.0 0.4866 0.0000 0.0000 0.0 0.0
7..2 0.000 161.0 49.0 0.4866 0.0000 0.0000 0.0 0.0
7..3 0.000 161.0 49.0 0.4866 0.0000 0.0000 0.0 0.0
7..4 0.000 161.0 49.0 0.4866 0.0000 0.0000 0.0 0.0
7..5 0.000 161.0 49.0 0.4866 0.0000 0.0000 0.0 0.0
7..6 0.000 161.0 49.0 0.4866 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907638_1_275_MLBR_RS01350)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907638_1_275_MLBR_RS01350)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -270.244446 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.572692
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907638_1_275_MLBR_RS01350: 0.000004, NC_002677_1_NP_301314_1_186_ML0265: 0.000004, NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585: 0.000004, NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485: 0.000004, NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425: 0.000004, NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.57269
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -270.244446 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.299947 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907638_1_275_MLBR_RS01350: 0.000004, NC_002677_1_NP_301314_1_186_ML0265: 0.000004, NZ_LVXE01000009_1_WP_010907638_1_2830_A3216_RS04585: 0.000004, NZ_LYPH01000016_1_WP_010907638_1_529_A8144_RS02485: 0.000004, NZ_CP029543_1_WP_010907638_1_275_DIJ64_RS01425: 0.000004, NZ_AP014567_1_WP_010907638_1_285_JK2ML_RS01475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.29995
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 162.0 48.0 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907638_1_275_MLBR_RS01350)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:11
Model 1: NearlyNeutral -270.244501 Model 2: PositiveSelection -270.244503 Model 0: one-ratio -270.24451 Model 7: beta -270.244446 Model 8: beta&w>1 -270.244446 Model 0 vs 1 1.799999995455437E-5 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
