--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 16:28:35 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0271/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -489.02          -492.21
2       -489.07          -494.44
--------------------------------------
TOTAL     -489.05          -493.85
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.900128    0.088853    0.350188    1.464683    0.863917   1349.44   1375.32    1.000
r(A<->C){all}   0.172074    0.021095    0.000014    0.467901    0.132118    357.67    359.77    1.001
r(A<->G){all}   0.175271    0.021052    0.000068    0.459692    0.137203    207.64    225.12    1.000
r(A<->T){all}   0.174066    0.021147    0.000056    0.460526    0.135433    155.93    231.43    1.003
r(C<->G){all}   0.171021    0.020471    0.000151    0.455174    0.136085    245.89    257.68    1.000
r(C<->T){all}   0.161538    0.018432    0.000021    0.428921    0.126245    301.88    328.38    1.002
r(G<->T){all}   0.146030    0.015709    0.000042    0.403690    0.110331    198.26    226.05    1.012
pi(A){all}      0.115912    0.000274    0.084297    0.149378    0.115745   1248.67   1374.83    1.000
pi(C){all}      0.276573    0.000526    0.232424    0.320675    0.275836   1386.36   1428.07    1.000
pi(G){all}      0.348058    0.000601    0.301757    0.397773    0.347183   1032.23   1122.93    1.000
pi(T){all}      0.259457    0.000519    0.218245    0.306431    0.258817   1367.61   1372.18    1.001
alpha{1,2}      0.413829    0.219987    0.000246    1.347485    0.248585   1158.63   1291.99    1.000
alpha{3}        0.455291    0.238589    0.000272    1.451697    0.290701   1162.86   1198.16    1.000
pinvar{all}     0.995544    0.000027    0.985214    0.999996    0.997183   1501.00   1501.00    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-473.952972
Model 2: PositiveSelection	-473.952972
Model 0: one-ratio	-473.952975
Model 7: beta	-473.952965
Model 8: beta&w>1	-473.952973


Model 0 vs 1	5.999999984851456E-6

Model 2 vs 1	0.0

Model 8 vs 7	1.5999999959603883E-5
>C1
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C2
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C3
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C4
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C5
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C6
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=123 

C1              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C2              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C3              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C4              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C5              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C6              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
                **************************************************

C1              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C2              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C3              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C4              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C5              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C6              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
                **************************************************

C1              TTAALFLGWRAVVELILRRRSTR
C2              TTAALFLGWRAVVELILRRRSTR
C3              TTAALFLGWRAVVELILRRRSTR
C4              TTAALFLGWRAVVELILRRRSTR
C5              TTAALFLGWRAVVELILRRRSTR
C6              TTAALFLGWRAVVELILRRRSTR
                ***********************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3690]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3690]--->[3690]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.460 Mb, Max= 30.652 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C2              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C3              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C4              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C5              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C6              MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
                **************************************************

C1              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C2              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C3              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C4              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C5              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C6              GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
                **************************************************

C1              TTAALFLGWRAVVELILRRRSTR
C2              TTAALFLGWRAVVELILRRRSTR
C3              TTAALFLGWRAVVELILRRRSTR
C4              TTAALFLGWRAVVELILRRRSTR
C5              TTAALFLGWRAVVELILRRRSTR
C6              TTAALFLGWRAVVELILRRRSTR
                ***********************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C2              ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C3              ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C4              ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C5              ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C6              ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
                **************************************************

C1              GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C2              GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C3              GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C4              GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C5              GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C6              GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
                **************************************************

C1              TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C2              TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C3              TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C4              TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C5              TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C6              TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
                **************************************************

C1              GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C2              GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C3              GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C4              GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C5              GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C6              GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
                **************************************************

C1              CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C2              CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C3              CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C4              CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C5              CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C6              CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
                **************************************************

C1              AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C2              AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C3              AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C4              AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C5              AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C6              AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
                **************************************************

C1              ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C2              ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C3              ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C4              ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C5              ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C6              ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
                **************************************************

C1              GAGGCGTCGCTCAACGCGT
C2              GAGGCGTCGCTCAACGCGT
C3              GAGGCGTCGCTCAACGCGT
C4              GAGGCGTCGCTCAACGCGT
C5              GAGGCGTCGCTCAACGCGT
C6              GAGGCGTCGCTCAACGCGT
                *******************



>C1
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C2
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C3
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C4
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C5
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C6
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C1
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C2
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C3
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C4
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C5
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C6
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 369 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579796844
      Setting output file names to "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1961589369
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0539252201
      Seed = 1598031998
      Swapseed = 1579796844
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -825.839685 -- -24.965149
         Chain 2 -- -825.839560 -- -24.965149
         Chain 3 -- -825.839560 -- -24.965149
         Chain 4 -- -825.839560 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -825.839685 -- -24.965149
         Chain 2 -- -825.839685 -- -24.965149
         Chain 3 -- -825.839685 -- -24.965149
         Chain 4 -- -825.839685 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-825.840] (-825.840) (-825.840) (-825.840) * [-825.840] (-825.840) (-825.840) (-825.840) 
        500 -- (-516.210) (-506.460) (-508.865) [-509.359] * (-504.457) [-500.650] (-513.866) (-500.982) -- 0:00:00
       1000 -- (-516.258) (-502.529) (-498.912) [-506.881] * (-501.325) (-507.352) [-501.854] (-495.645) -- 0:00:00
       1500 -- (-500.814) (-500.302) (-495.511) [-500.206] * (-495.274) [-497.232] (-501.900) (-496.257) -- 0:00:00
       2000 -- [-499.006] (-493.818) (-500.899) (-500.059) * (-498.786) [-498.848] (-500.513) (-497.863) -- 0:00:00
       2500 -- (-505.704) (-497.667) (-496.557) [-498.237] * [-494.854] (-500.967) (-499.286) (-498.755) -- 0:00:00
       3000 -- (-498.168) (-500.026) [-492.037] (-501.212) * (-509.883) [-497.678] (-498.273) (-507.077) -- 0:00:00
       3500 -- (-503.467) (-499.670) [-492.872] (-496.152) * [-490.889] (-501.939) (-496.975) (-496.584) -- 0:00:00
       4000 -- (-496.767) (-495.461) [-504.969] (-503.315) * (-500.845) (-499.352) [-496.088] (-497.731) -- 0:00:00
       4500 -- [-499.107] (-498.312) (-501.102) (-500.053) * (-498.441) (-504.126) (-501.086) [-491.160] -- 0:00:00
       5000 -- (-497.464) (-506.149) (-503.791) [-495.686] * (-507.091) (-506.417) (-504.756) [-500.518] -- 0:00:00

      Average standard deviation of split frequencies: 0.085115

       5500 -- [-497.107] (-505.045) (-498.804) (-503.226) * [-505.627] (-505.981) (-498.418) (-503.282) -- 0:00:00
       6000 -- (-495.045) (-502.209) (-496.312) [-494.886] * (-501.296) (-503.189) [-497.120] (-499.029) -- 0:00:00
       6500 -- (-501.175) (-498.455) [-497.933] (-502.718) * (-496.192) (-497.214) [-495.451] (-499.611) -- 0:00:00
       7000 -- [-496.615] (-496.417) (-495.193) (-498.083) * (-503.478) (-495.348) [-494.543] (-494.517) -- 0:00:00
       7500 -- (-495.999) (-500.928) [-498.427] (-508.071) * (-501.242) (-494.673) [-498.855] (-501.918) -- 0:00:00
       8000 -- (-497.491) (-502.531) [-498.432] (-497.979) * (-501.609) (-492.062) [-498.595] (-502.681) -- 0:00:00
       8500 -- (-503.744) [-496.830] (-501.999) (-497.267) * [-494.563] (-498.395) (-505.557) (-499.006) -- 0:00:00
       9000 -- (-494.015) (-500.259) [-497.919] (-501.004) * (-500.277) [-495.667] (-501.516) (-495.120) -- 0:00:00
       9500 -- (-499.636) (-506.549) [-500.883] (-495.579) * (-502.501) (-501.513) (-501.829) [-499.122] -- 0:00:00
      10000 -- [-493.951] (-500.389) (-499.545) (-501.748) * (-497.965) (-498.451) [-493.150] (-501.676) -- 0:00:00

      Average standard deviation of split frequencies: 0.086284

      10500 -- (-494.579) (-501.353) [-493.902] (-509.936) * (-498.907) [-495.166] (-498.638) (-500.375) -- 0:01:34
      11000 -- (-497.622) (-503.000) (-502.682) [-496.994] * (-500.628) (-500.773) [-495.698] (-502.962) -- 0:01:29
      11500 -- (-501.702) (-498.509) [-499.190] (-494.940) * (-504.310) (-509.737) (-505.146) [-501.617] -- 0:01:25
      12000 -- (-496.039) (-494.069) [-496.334] (-499.667) * (-501.474) [-503.980] (-503.861) (-497.297) -- 0:01:22
      12500 -- (-494.253) [-497.159] (-497.523) (-504.043) * (-498.692) (-502.258) [-496.307] (-500.694) -- 0:01:19
      13000 -- [-492.392] (-496.224) (-500.972) (-519.888) * [-492.173] (-498.179) (-510.296) (-496.678) -- 0:01:15
      13500 -- (-497.459) [-500.929] (-496.287) (-502.948) * (-496.168) (-497.550) (-500.043) [-494.429] -- 0:01:13
      14000 -- (-499.912) [-494.566] (-500.532) (-500.719) * (-501.828) (-496.281) (-506.002) [-497.259] -- 0:01:10
      14500 -- (-496.618) (-514.733) (-497.518) [-496.089] * (-500.279) [-497.790] (-507.227) (-502.326) -- 0:01:07
      15000 -- (-495.902) (-512.713) [-496.556] (-488.469) * [-498.942] (-500.574) (-499.670) (-505.464) -- 0:01:05

      Average standard deviation of split frequencies: 0.068746

      15500 -- (-498.906) (-497.516) [-498.798] (-487.734) * [-501.072] (-497.835) (-499.540) (-501.697) -- 0:01:03
      16000 -- (-499.987) [-491.311] (-501.021) (-495.061) * (-499.015) (-500.138) [-495.585] (-508.404) -- 0:01:01
      16500 -- (-499.098) [-488.295] (-503.344) (-489.771) * (-511.310) (-494.870) (-503.925) [-500.817] -- 0:00:59
      17000 -- (-500.039) [-488.794] (-497.998) (-488.892) * (-498.783) (-501.702) (-493.935) [-502.130] -- 0:00:57
      17500 -- (-496.927) [-489.876] (-498.388) (-488.802) * (-495.501) (-502.412) [-498.293] (-503.184) -- 0:00:56
      18000 -- (-503.964) [-490.176] (-502.553) (-492.871) * (-498.104) [-493.738] (-504.792) (-499.669) -- 0:00:54
      18500 -- (-501.579) (-490.968) (-499.120) [-489.904] * [-499.893] (-497.972) (-507.906) (-500.192) -- 0:00:53
      19000 -- (-500.970) (-491.307) (-498.853) [-493.189] * (-502.827) [-495.503] (-503.891) (-497.266) -- 0:00:51
      19500 -- [-495.611] (-488.557) (-494.602) (-490.917) * (-498.716) (-502.296) (-513.138) [-496.169] -- 0:00:50
      20000 -- (-497.165) [-490.239] (-500.254) (-491.095) * [-492.852] (-500.636) (-510.987) (-504.166) -- 0:00:49

      Average standard deviation of split frequencies: 0.058450

      20500 -- (-496.767) [-489.720] (-496.659) (-489.312) * (-497.216) [-496.914] (-509.671) (-497.651) -- 0:00:47
      21000 -- [-499.360] (-490.535) (-497.371) (-489.782) * (-496.014) [-502.252] (-493.763) (-500.366) -- 0:00:46
      21500 -- (-497.364) (-489.399) (-497.914) [-489.232] * [-498.632] (-508.052) (-492.812) (-503.373) -- 0:00:45
      22000 -- (-501.026) [-489.164] (-499.615) (-488.952) * (-502.292) (-502.963) [-492.486] (-493.870) -- 0:00:44
      22500 -- [-500.884] (-494.345) (-501.472) (-489.298) * (-502.994) (-500.624) (-489.844) [-501.739] -- 0:00:43
      23000 -- (-490.352) (-488.726) [-494.112] (-490.664) * (-495.464) (-489.257) (-487.958) [-497.390] -- 0:00:42
      23500 -- (-513.204) (-489.738) (-505.739) [-489.708] * (-502.899) (-488.820) [-490.325] (-506.504) -- 0:00:41
      24000 -- (-493.296) (-491.275) (-499.895) [-489.338] * (-499.455) (-489.527) (-488.364) [-496.717] -- 0:00:40
      24500 -- (-500.670) (-488.389) [-495.960] (-488.182) * (-497.111) [-489.458] (-490.924) (-505.195) -- 0:00:39
      25000 -- [-502.190] (-490.955) (-496.367) (-487.736) * (-506.698) (-491.789) [-488.439] (-500.399) -- 0:00:39

      Average standard deviation of split frequencies: 0.041207

      25500 -- (-500.800) (-491.887) [-498.134] (-488.413) * (-503.813) (-491.724) [-488.764] (-497.385) -- 0:00:38
      26000 -- (-499.188) (-489.418) [-493.381] (-497.103) * (-507.266) (-489.866) (-488.879) [-500.529] -- 0:00:37
      26500 -- (-498.437) (-494.210) [-495.959] (-489.264) * (-502.109) (-492.276) [-488.457] (-497.323) -- 0:01:13
      27000 -- [-498.085] (-496.679) (-506.153) (-494.261) * (-495.957) (-488.701) (-489.094) [-499.001] -- 0:01:12
      27500 -- (-496.501) (-494.331) [-499.299] (-492.594) * (-494.645) (-489.236) (-489.074) [-498.862] -- 0:01:10
      28000 -- (-500.423) [-488.726] (-507.370) (-489.327) * (-496.120) (-490.555) [-487.782] (-496.289) -- 0:01:09
      28500 -- [-499.351] (-489.276) (-515.584) (-491.852) * (-493.487) (-489.496) (-491.269) [-501.338] -- 0:01:08
      29000 -- (-494.710) (-489.170) (-496.898) [-489.859] * (-498.034) (-489.645) (-492.009) [-501.726] -- 0:01:06
      29500 -- [-498.188] (-489.569) (-489.162) (-492.873) * (-494.606) (-494.002) [-488.542] (-518.359) -- 0:01:05
      30000 -- (-500.038) (-490.195) (-489.616) [-487.983] * (-497.401) (-491.116) [-488.628] (-507.411) -- 0:01:04

      Average standard deviation of split frequencies: 0.040526

      30500 -- [-495.990] (-490.184) (-489.084) (-490.369) * [-498.984] (-491.455) (-487.575) (-501.276) -- 0:01:03
      31000 -- (-504.482) (-488.043) [-489.295] (-488.127) * (-494.440) (-487.981) (-487.615) [-490.796] -- 0:01:02
      31500 -- (-508.947) (-489.394) (-488.928) [-490.105] * (-496.193) [-487.663] (-490.208) (-489.865) -- 0:01:01
      32000 -- (-496.545) [-488.995] (-491.546) (-490.433) * (-502.177) (-487.578) (-488.335) [-488.041] -- 0:01:00
      32500 -- (-495.756) (-490.260) [-492.618] (-487.799) * (-502.723) (-492.833) (-488.204) [-490.873] -- 0:00:59
      33000 -- (-501.178) (-489.502) (-488.127) [-489.502] * [-495.656] (-494.618) (-489.862) (-490.381) -- 0:00:58
      33500 -- (-494.429) (-488.474) [-488.444] (-489.972) * [-498.671] (-489.111) (-492.198) (-488.697) -- 0:00:57
      34000 -- (-504.704) (-490.735) [-487.986] (-490.748) * (-508.843) [-491.121] (-499.350) (-490.942) -- 0:00:56
      34500 -- (-497.438) (-490.545) (-488.001) [-491.105] * (-501.393) [-488.099] (-490.051) (-488.381) -- 0:00:55
      35000 -- (-498.392) (-489.749) (-487.706) [-489.771] * (-503.103) (-489.464) (-490.339) [-490.585] -- 0:00:55

      Average standard deviation of split frequencies: 0.035838

      35500 -- (-499.646) (-491.400) [-487.884] (-489.508) * [-499.270] (-490.905) (-493.372) (-488.706) -- 0:00:54
      36000 -- (-499.705) (-490.114) [-490.469] (-489.144) * (-495.915) (-490.472) (-489.570) [-489.306] -- 0:00:53
      36500 -- [-497.943] (-491.329) (-489.871) (-489.419) * (-492.399) [-489.218] (-487.675) (-490.402) -- 0:00:52
      37000 -- (-500.166) (-491.913) [-489.296] (-490.179) * [-499.956] (-487.820) (-489.580) (-489.931) -- 0:00:52
      37500 -- [-503.613] (-488.242) (-490.724) (-487.541) * [-500.844] (-489.518) (-490.586) (-488.263) -- 0:00:51
      38000 -- (-501.585) (-489.697) [-488.599] (-488.381) * (-508.599) (-490.032) (-491.385) [-488.421] -- 0:00:50
      38500 -- (-496.289) (-488.361) (-488.601) [-488.474] * (-498.573) [-490.208] (-488.927) (-488.926) -- 0:00:49
      39000 -- (-500.671) (-492.531) [-489.097] (-487.909) * (-500.700) (-491.492) [-488.115] (-488.410) -- 0:00:49
      39500 -- (-504.808) (-492.708) (-488.709) [-494.042] * [-498.520] (-491.450) (-489.179) (-489.509) -- 0:00:48
      40000 -- (-501.656) [-489.906] (-489.200) (-491.624) * (-495.338) (-490.629) (-488.952) [-489.957] -- 0:00:48

      Average standard deviation of split frequencies: 0.036606

      40500 -- (-506.743) (-488.577) (-488.835) [-490.553] * (-496.024) (-489.693) (-490.263) [-489.850] -- 0:00:47
      41000 -- [-495.386] (-488.396) (-489.061) (-490.652) * (-502.867) [-487.442] (-487.826) (-491.132) -- 0:00:46
      41500 -- (-511.127) (-490.500) (-492.388) [-489.747] * (-498.352) (-489.065) [-491.053] (-491.035) -- 0:00:46
      42000 -- [-493.180] (-488.766) (-490.536) (-489.239) * (-499.042) (-489.699) [-488.705] (-490.216) -- 0:00:45
      42500 -- (-500.641) (-489.242) [-489.149] (-488.884) * (-501.698) (-491.919) (-495.486) [-489.351] -- 0:00:45
      43000 -- [-497.341] (-491.250) (-488.186) (-491.524) * (-507.094) (-489.252) (-492.218) [-488.977] -- 0:01:06
      43500 -- (-500.521) (-490.300) (-488.588) [-489.481] * [-495.542] (-491.449) (-488.603) (-490.683) -- 0:01:05
      44000 -- [-500.790] (-492.118) (-490.043) (-488.744) * (-496.667) (-490.033) [-488.052] (-487.992) -- 0:01:05
      44500 -- (-496.574) (-491.276) [-490.862] (-488.220) * (-500.475) (-489.250) (-489.114) [-489.764] -- 0:01:04
      45000 -- (-494.737) (-489.458) (-488.673) [-491.118] * [-497.278] (-489.730) (-488.111) (-493.940) -- 0:01:03

      Average standard deviation of split frequencies: 0.028304

      45500 -- (-497.536) (-489.017) [-489.314] (-488.619) * (-501.860) (-488.399) (-490.992) [-491.688] -- 0:01:02
      46000 -- (-508.263) (-490.102) [-489.781] (-488.062) * (-501.684) (-488.915) (-489.497) [-489.451] -- 0:01:02
      46500 -- (-496.038) (-491.241) (-488.966) [-488.155] * [-501.071] (-489.449) (-492.788) (-488.299) -- 0:01:01
      47000 -- (-511.955) [-490.767] (-490.172) (-488.047) * [-495.223] (-488.464) (-488.667) (-488.029) -- 0:01:00
      47500 -- (-502.891) (-488.122) [-491.027] (-488.415) * [-496.711] (-490.499) (-489.050) (-488.984) -- 0:01:00
      48000 -- (-498.591) (-491.230) (-488.785) [-489.769] * (-500.062) [-492.043] (-490.668) (-490.910) -- 0:00:59
      48500 -- (-505.956) [-494.915] (-490.573) (-490.905) * (-497.069) (-490.063) (-494.125) [-489.764] -- 0:00:58
      49000 -- (-496.272) (-491.281) (-489.754) [-488.583] * [-501.342] (-490.055) (-492.350) (-490.460) -- 0:00:58
      49500 -- [-496.796] (-489.186) (-492.716) (-491.834) * (-500.335) (-490.367) (-491.172) [-494.836] -- 0:00:57
      50000 -- (-499.295) [-488.755] (-493.670) (-488.481) * (-504.059) [-492.906] (-491.527) (-492.191) -- 0:00:57

      Average standard deviation of split frequencies: 0.029773

      50500 -- (-496.811) [-488.561] (-491.883) (-489.394) * (-498.708) [-490.279] (-492.131) (-489.810) -- 0:00:56
      51000 -- [-502.642] (-490.009) (-488.948) (-491.083) * (-495.657) (-489.989) (-490.516) [-488.825] -- 0:00:55
      51500 -- (-496.533) [-489.600] (-497.157) (-490.441) * (-507.758) (-489.710) (-491.967) [-488.517] -- 0:00:55
      52000 -- [-500.050] (-489.215) (-491.871) (-492.035) * (-503.212) [-488.647] (-493.560) (-487.734) -- 0:00:54
      52500 -- (-498.444) (-488.465) (-489.103) [-488.323] * (-509.680) [-489.541] (-490.868) (-491.388) -- 0:00:54
      53000 -- (-499.939) (-492.169) (-488.920) [-487.763] * (-499.049) (-488.814) [-489.033] (-492.077) -- 0:00:53
      53500 -- [-503.807] (-488.857) (-488.131) (-491.148) * [-490.268] (-488.657) (-490.271) (-491.575) -- 0:00:53
      54000 -- (-498.991) (-488.276) [-489.265] (-492.362) * (-489.354) [-488.475] (-490.386) (-494.644) -- 0:00:52
      54500 -- (-495.144) [-488.737] (-488.091) (-495.689) * (-490.306) (-490.745) [-490.040] (-487.990) -- 0:00:52
      55000 -- (-503.527) [-489.478] (-489.040) (-490.598) * (-489.653) (-492.250) (-488.748) [-489.347] -- 0:00:51

      Average standard deviation of split frequencies: 0.031196

      55500 -- [-496.686] (-490.114) (-489.785) (-494.809) * (-489.136) (-489.923) (-490.931) [-489.939] -- 0:00:51
      56000 -- [-494.757] (-490.105) (-489.365) (-491.396) * [-492.524] (-490.396) (-489.555) (-487.669) -- 0:00:50
      56500 -- (-497.297) (-488.909) [-490.798] (-492.095) * [-489.678] (-491.483) (-488.872) (-489.114) -- 0:00:50
      57000 -- [-498.995] (-490.054) (-491.280) (-492.984) * (-491.191) (-492.657) [-487.771] (-489.302) -- 0:00:49
      57500 -- (-499.755) (-489.165) (-488.318) [-490.648] * (-488.857) [-492.471] (-489.090) (-491.145) -- 0:00:49
      58000 -- (-499.570) [-490.252] (-488.750) (-491.975) * (-491.275) (-492.654) [-488.828] (-490.922) -- 0:00:48
      58500 -- (-498.934) [-493.075] (-489.807) (-492.647) * (-490.903) [-488.533] (-488.316) (-492.455) -- 0:00:48
      59000 -- (-496.558) (-490.783) (-490.986) [-489.962] * (-490.195) [-491.103] (-488.559) (-492.151) -- 0:00:47
      59500 -- (-501.837) (-489.344) (-493.534) [-490.767] * [-490.083] (-488.102) (-487.747) (-493.223) -- 0:00:47
      60000 -- [-499.541] (-491.286) (-490.980) (-492.829) * (-488.237) (-490.103) (-487.849) [-487.666] -- 0:00:47

      Average standard deviation of split frequencies: 0.036521

      60500 -- (-498.384) (-491.428) [-488.720] (-489.947) * (-487.938) [-493.700] (-490.270) (-492.359) -- 0:01:02
      61000 -- (-503.939) (-491.497) (-491.959) [-489.177] * [-491.121] (-492.149) (-488.833) (-491.839) -- 0:01:01
      61500 -- [-497.536] (-489.097) (-489.419) (-488.522) * (-489.826) [-489.879] (-487.684) (-493.148) -- 0:01:01
      62000 -- (-496.673) (-487.592) [-488.259] (-489.454) * [-490.356] (-489.537) (-489.003) (-489.333) -- 0:01:00
      62500 -- (-497.499) (-487.873) [-489.425] (-488.647) * (-489.124) [-489.840] (-490.436) (-488.602) -- 0:01:00
      63000 -- (-500.286) [-492.160] (-490.128) (-491.155) * (-492.467) [-490.510] (-489.400) (-488.423) -- 0:00:59
      63500 -- [-496.723] (-492.922) (-489.890) (-490.803) * (-488.056) (-492.487) (-490.186) [-488.114] -- 0:00:58
      64000 -- (-495.128) [-490.251] (-489.038) (-490.055) * [-487.898] (-496.075) (-491.290) (-488.702) -- 0:00:58
      64500 -- (-504.896) [-487.998] (-489.054) (-489.658) * (-488.470) [-490.371] (-492.550) (-494.441) -- 0:00:58
      65000 -- (-497.869) [-490.063] (-489.300) (-492.143) * [-488.600] (-490.514) (-491.771) (-489.793) -- 0:00:57

      Average standard deviation of split frequencies: 0.032311

      65500 -- (-498.788) (-493.304) (-489.630) [-489.637] * (-489.160) [-490.245] (-492.164) (-497.142) -- 0:00:57
      66000 -- (-500.688) (-490.834) (-490.283) [-491.509] * (-488.169) (-488.873) [-488.148] (-490.679) -- 0:00:56
      66500 -- (-495.789) [-490.606] (-490.843) (-492.277) * (-488.122) [-491.899] (-488.412) (-491.561) -- 0:00:56
      67000 -- (-500.842) [-490.231] (-488.330) (-490.924) * (-489.903) (-489.301) [-487.809] (-488.311) -- 0:00:55
      67500 -- [-495.886] (-490.920) (-489.275) (-489.259) * (-489.953) (-488.820) (-487.835) [-493.116] -- 0:00:55
      68000 -- (-492.690) [-490.272] (-495.007) (-490.154) * (-490.466) [-490.635] (-489.470) (-489.519) -- 0:00:54
      68500 -- [-497.251] (-488.911) (-494.057) (-492.910) * (-491.605) [-487.917] (-494.988) (-490.126) -- 0:00:54
      69000 -- (-492.241) (-489.909) [-489.801] (-492.496) * (-492.032) (-491.190) [-490.342] (-489.681) -- 0:00:53
      69500 -- (-497.572) [-489.206] (-488.769) (-492.490) * (-490.620) [-489.358] (-492.315) (-490.010) -- 0:00:53
      70000 -- [-495.207] (-489.540) (-490.082) (-490.378) * (-489.320) (-488.537) (-489.638) [-490.750] -- 0:00:53

      Average standard deviation of split frequencies: 0.030495

      70500 -- (-494.937) [-488.640] (-488.514) (-492.452) * [-488.160] (-490.587) (-489.229) (-490.592) -- 0:00:52
      71000 -- (-506.316) [-490.927] (-489.450) (-488.977) * (-489.885) (-488.462) [-488.050] (-490.230) -- 0:00:52
      71500 -- (-505.452) (-493.539) [-497.559] (-495.584) * [-490.409] (-488.567) (-492.524) (-488.792) -- 0:00:51
      72000 -- (-497.979) [-490.435] (-493.745) (-493.319) * (-492.334) [-488.536] (-492.588) (-492.182) -- 0:00:51
      72500 -- [-499.359] (-489.200) (-489.221) (-488.412) * [-489.937] (-492.218) (-491.893) (-491.192) -- 0:00:51
      73000 -- (-511.507) [-490.336] (-490.017) (-488.544) * (-490.450) (-488.571) (-491.988) [-488.171] -- 0:00:50
      73500 -- (-510.055) (-487.896) (-493.183) [-488.866] * (-489.049) (-489.759) (-493.603) [-488.433] -- 0:00:50
      74000 -- (-499.648) (-488.492) [-492.104] (-488.423) * (-488.272) [-489.069] (-488.319) (-488.350) -- 0:00:50
      74500 -- (-489.606) (-487.927) (-487.650) [-489.832] * [-488.191] (-491.637) (-491.117) (-489.197) -- 0:00:49
      75000 -- [-490.399] (-492.351) (-487.890) (-492.502) * (-492.164) [-493.859] (-494.437) (-488.749) -- 0:00:49

      Average standard deviation of split frequencies: 0.026051

      75500 -- (-491.265) (-497.061) (-490.102) [-489.958] * (-490.078) (-492.837) [-488.685] (-490.674) -- 0:00:48
      76000 -- [-490.111] (-493.705) (-488.111) (-492.832) * [-489.609] (-488.180) (-490.665) (-490.731) -- 0:00:48
      76500 -- (-491.287) (-489.070) (-488.553) [-491.246] * (-487.841) (-487.993) [-492.736] (-488.972) -- 0:00:48
      77000 -- (-492.122) [-489.686] (-488.090) (-487.660) * (-487.821) (-489.684) (-488.867) [-491.889] -- 0:00:47
      77500 -- [-489.700] (-489.723) (-489.843) (-490.641) * (-488.033) [-489.389] (-488.688) (-489.773) -- 0:00:59
      78000 -- [-488.250] (-490.076) (-489.455) (-491.239) * (-489.321) (-488.808) [-489.899] (-491.896) -- 0:00:59
      78500 -- [-489.141] (-489.090) (-488.875) (-490.793) * [-491.748] (-491.066) (-487.869) (-489.192) -- 0:00:58
      79000 -- (-491.213) (-488.394) [-490.907] (-491.751) * [-487.648] (-488.996) (-495.253) (-488.789) -- 0:00:58
      79500 -- [-488.563] (-492.380) (-492.162) (-488.208) * [-489.712] (-492.239) (-493.618) (-489.489) -- 0:00:57
      80000 -- [-488.319] (-490.078) (-490.691) (-489.218) * [-488.207] (-488.576) (-490.034) (-489.276) -- 0:00:57

      Average standard deviation of split frequencies: 0.025129

      80500 -- (-493.361) [-489.132] (-488.183) (-490.071) * [-488.623] (-490.547) (-487.898) (-489.803) -- 0:00:57
      81000 -- (-489.327) [-488.438] (-489.594) (-489.536) * (-488.501) [-488.110] (-489.978) (-489.220) -- 0:00:56
      81500 -- (-489.032) (-490.324) [-489.399] (-491.554) * (-488.761) [-489.469] (-493.096) (-488.077) -- 0:00:56
      82000 -- (-487.782) (-491.470) (-490.478) [-490.306] * [-492.908] (-491.278) (-494.706) (-489.546) -- 0:00:55
      82500 -- (-488.688) (-488.953) (-490.356) [-487.859] * (-489.962) [-490.889] (-489.098) (-489.410) -- 0:00:55
      83000 -- (-489.373) (-489.559) (-488.740) [-488.866] * (-488.243) (-490.570) (-489.376) [-494.341] -- 0:00:55
      83500 -- (-488.611) (-491.672) (-488.802) [-489.453] * [-488.997] (-490.220) (-488.714) (-494.123) -- 0:00:54
      84000 -- (-488.437) [-494.479] (-490.976) (-488.816) * [-488.383] (-488.730) (-490.031) (-490.618) -- 0:00:54
      84500 -- [-489.705] (-488.922) (-489.442) (-490.881) * (-491.656) (-488.489) [-491.242] (-491.500) -- 0:00:54
      85000 -- (-493.417) [-489.722] (-490.523) (-491.073) * (-490.029) (-490.763) [-490.882] (-492.423) -- 0:00:53

      Average standard deviation of split frequencies: 0.021926

      85500 -- [-490.792] (-489.428) (-489.661) (-491.489) * (-488.993) (-491.583) [-488.842] (-487.779) -- 0:00:53
      86000 -- (-494.741) [-488.941] (-488.675) (-490.905) * (-493.090) (-488.962) [-487.721] (-488.445) -- 0:00:53
      86500 -- [-489.577] (-488.493) (-490.451) (-488.760) * (-490.187) (-487.780) [-493.927] (-492.811) -- 0:00:52
      87000 -- [-489.587] (-489.542) (-489.930) (-488.790) * (-488.963) (-488.558) (-491.738) [-489.466] -- 0:00:52
      87500 -- [-489.903] (-490.775) (-488.790) (-490.780) * [-490.237] (-491.236) (-489.369) (-489.136) -- 0:00:52
      88000 -- [-493.636] (-491.082) (-491.608) (-488.337) * (-489.101) (-493.608) (-488.738) [-488.857] -- 0:00:51
      88500 -- (-490.023) (-490.994) [-489.322] (-489.935) * [-491.808] (-490.963) (-490.122) (-488.286) -- 0:00:51
      89000 -- (-489.142) (-488.013) (-492.473) [-489.452] * (-488.639) (-490.142) (-488.469) [-488.900] -- 0:00:51
      89500 -- (-490.944) (-488.304) [-488.930] (-490.641) * (-489.975) (-487.651) [-489.436] (-489.696) -- 0:00:50
      90000 -- (-497.095) (-488.882) (-490.286) [-489.469] * (-488.591) (-487.880) (-490.220) [-489.564] -- 0:00:50

      Average standard deviation of split frequencies: 0.024759

      90500 -- (-490.719) [-488.220] (-490.775) (-489.873) * (-497.326) [-491.950] (-492.988) (-487.980) -- 0:00:50
      91000 -- (-488.090) (-489.349) (-491.378) [-491.745] * [-491.221] (-495.284) (-494.284) (-488.144) -- 0:00:49
      91500 -- (-489.936) (-489.477) (-494.184) [-488.198] * (-488.794) (-489.710) (-489.006) [-487.986] -- 0:00:49
      92000 -- (-492.052) [-489.552] (-492.158) (-490.835) * [-489.117] (-488.721) (-489.873) (-488.644) -- 0:00:49
      92500 -- (-491.711) (-487.852) (-492.652) [-491.442] * (-489.688) [-489.795] (-490.553) (-492.213) -- 0:00:49
      93000 -- [-488.426] (-488.901) (-490.604) (-489.452) * (-489.546) (-492.692) [-491.475] (-489.945) -- 0:00:48
      93500 -- (-491.049) (-488.665) [-491.299] (-489.314) * (-491.099) [-489.181] (-489.988) (-489.300) -- 0:00:48
      94000 -- [-487.938] (-489.640) (-489.175) (-490.820) * (-489.025) [-490.264] (-488.137) (-491.444) -- 0:00:57
      94500 -- [-489.716] (-489.155) (-488.545) (-488.690) * (-489.544) [-488.117] (-490.234) (-491.361) -- 0:00:57
      95000 -- [-488.246] (-490.604) (-490.664) (-490.532) * (-488.172) [-488.264] (-491.920) (-491.088) -- 0:00:57

      Average standard deviation of split frequencies: 0.027499

      95500 -- (-489.590) [-493.573] (-488.574) (-490.625) * [-488.506] (-489.167) (-490.193) (-488.568) -- 0:00:56
      96000 -- (-491.625) [-499.841] (-489.487) (-489.118) * (-488.358) (-490.397) [-490.920] (-488.712) -- 0:00:56
      96500 -- (-492.602) [-491.078] (-490.244) (-495.821) * [-489.946] (-488.219) (-489.569) (-487.819) -- 0:00:56
      97000 -- [-491.540] (-488.698) (-490.432) (-495.193) * (-490.156) (-493.028) [-488.576] (-488.217) -- 0:00:55
      97500 -- (-493.813) (-493.021) [-490.921] (-487.821) * (-488.732) [-489.194] (-489.298) (-488.637) -- 0:00:55
      98000 -- (-493.857) (-490.573) (-492.018) [-488.033] * (-491.795) (-490.362) [-489.018] (-490.833) -- 0:00:55
      98500 -- (-491.403) (-491.945) (-488.711) [-489.562] * [-487.460] (-492.274) (-489.267) (-487.722) -- 0:00:54
      99000 -- (-489.280) [-487.744] (-492.123) (-492.317) * (-492.211) [-488.661] (-491.674) (-487.961) -- 0:00:54
      99500 -- (-489.306) (-494.647) [-487.881] (-487.902) * (-492.994) (-490.815) [-489.051] (-491.845) -- 0:00:54
      100000 -- (-488.632) [-490.127] (-489.582) (-488.327) * (-491.090) (-490.290) (-493.003) [-491.514] -- 0:00:54

      Average standard deviation of split frequencies: 0.024585

      100500 -- (-490.493) (-491.191) (-489.640) [-488.876] * (-491.273) [-490.124] (-489.703) (-490.558) -- 0:00:53
      101000 -- [-491.925] (-490.776) (-490.414) (-488.158) * [-491.645] (-494.483) (-489.167) (-494.687) -- 0:00:53
      101500 -- (-490.252) (-490.357) [-487.821] (-487.958) * [-488.435] (-488.751) (-492.992) (-488.740) -- 0:00:53
      102000 -- (-495.941) (-490.761) (-488.933) [-487.902] * (-492.096) (-491.393) (-492.100) [-490.873] -- 0:00:52
      102500 -- (-493.386) (-491.463) [-488.455] (-489.801) * (-491.746) [-489.925] (-489.135) (-490.241) -- 0:00:52
      103000 -- (-492.638) (-490.501) (-490.435) [-490.436] * [-491.554] (-489.059) (-488.106) (-488.265) -- 0:00:52
      103500 -- (-488.637) [-490.966] (-488.668) (-493.468) * (-488.463) (-491.439) (-488.260) [-488.577] -- 0:00:51
      104000 -- [-488.879] (-489.104) (-488.657) (-493.961) * (-488.696) [-490.897] (-488.250) (-488.843) -- 0:00:51
      104500 -- (-489.104) (-487.974) [-488.055] (-491.254) * (-490.801) (-491.971) (-488.390) [-490.237] -- 0:00:51
      105000 -- (-487.705) (-490.743) [-488.098] (-490.674) * [-491.340] (-489.035) (-488.394) (-491.373) -- 0:00:51

      Average standard deviation of split frequencies: 0.024015

      105500 -- (-487.409) (-491.151) [-488.404] (-491.134) * (-493.046) (-488.672) [-491.849] (-495.684) -- 0:00:50
      106000 -- [-488.630] (-490.863) (-488.986) (-488.696) * (-490.670) [-489.396] (-495.074) (-489.993) -- 0:00:50
      106500 -- (-487.910) (-492.666) [-489.223] (-490.688) * [-490.948] (-489.620) (-490.068) (-488.383) -- 0:00:50
      107000 -- [-488.533] (-492.867) (-488.748) (-490.876) * (-488.976) (-488.793) (-490.764) [-487.666] -- 0:00:50
      107500 -- [-489.627] (-490.952) (-489.747) (-490.092) * [-489.428] (-488.312) (-488.135) (-489.956) -- 0:00:49
      108000 -- (-491.095) (-490.541) [-489.396] (-494.033) * [-491.191] (-491.076) (-490.128) (-493.011) -- 0:00:49
      108500 -- (-494.262) (-490.518) [-491.099] (-493.719) * [-488.711] (-489.003) (-497.418) (-490.782) -- 0:00:49
      109000 -- (-488.944) (-490.475) [-491.877] (-490.458) * [-487.806] (-489.223) (-493.959) (-487.780) -- 0:00:49
      109500 -- (-490.774) (-489.952) [-492.684] (-490.507) * (-492.397) [-487.700] (-488.051) (-490.038) -- 0:00:48
      110000 -- [-489.165] (-490.895) (-490.068) (-489.575) * (-493.643) (-489.257) (-487.427) [-487.803] -- 0:00:48

      Average standard deviation of split frequencies: 0.023002

      110500 -- (-487.859) [-488.346] (-492.171) (-487.734) * (-489.498) [-489.072] (-489.564) (-490.453) -- 0:00:48
      111000 -- (-489.273) (-488.100) [-491.215] (-489.303) * [-489.170] (-491.719) (-491.820) (-489.170) -- 0:00:56
      111500 -- (-489.079) (-490.950) [-490.068] (-492.649) * [-488.564] (-494.960) (-491.410) (-488.320) -- 0:00:55
      112000 -- [-488.468] (-490.176) (-489.627) (-490.521) * (-489.404) (-491.967) (-490.427) [-488.900] -- 0:00:55
      112500 -- (-488.307) (-488.358) (-490.687) [-492.185] * (-489.947) [-488.861] (-492.081) (-490.689) -- 0:00:55
      113000 -- (-488.095) (-494.823) (-488.927) [-491.301] * (-489.259) [-490.471] (-489.470) (-488.645) -- 0:00:54
      113500 -- (-489.866) (-487.873) [-490.370] (-491.738) * (-490.901) [-491.614] (-489.679) (-489.198) -- 0:00:54
      114000 -- [-488.129] (-489.371) (-489.506) (-493.147) * (-489.402) (-489.744) (-487.846) [-488.709] -- 0:00:54
      114500 -- (-492.198) [-492.698] (-489.686) (-490.736) * [-489.246] (-491.732) (-489.556) (-489.878) -- 0:00:54
      115000 -- (-487.975) (-492.081) (-489.155) [-489.681] * (-492.967) [-488.917] (-488.745) (-491.883) -- 0:00:53

      Average standard deviation of split frequencies: 0.022061

      115500 -- (-487.772) (-489.602) (-489.017) [-490.317] * (-489.239) (-490.966) [-492.286] (-488.205) -- 0:00:53
      116000 -- (-489.549) [-488.917] (-488.888) (-489.537) * (-491.711) (-489.759) (-487.877) [-489.037] -- 0:00:53
      116500 -- (-496.156) (-489.717) [-489.551] (-491.001) * [-489.706] (-490.183) (-489.701) (-488.506) -- 0:00:53
      117000 -- (-492.587) [-490.887] (-490.461) (-489.409) * [-492.824] (-497.491) (-487.960) (-492.807) -- 0:00:52
      117500 -- (-491.085) (-493.365) [-492.625] (-490.684) * (-495.691) (-488.102) [-490.367] (-488.356) -- 0:00:52
      118000 -- (-491.029) [-489.908] (-493.330) (-490.380) * (-492.139) [-487.958] (-489.502) (-489.775) -- 0:00:52
      118500 -- [-489.572] (-491.962) (-489.235) (-490.057) * [-488.756] (-497.269) (-487.630) (-494.099) -- 0:00:52
      119000 -- (-489.111) (-490.886) (-490.766) [-489.786] * [-489.208] (-489.490) (-488.500) (-493.590) -- 0:00:51
      119500 -- (-491.425) [-488.135] (-488.726) (-489.921) * (-489.440) (-490.092) (-488.889) [-491.729] -- 0:00:51
      120000 -- (-488.171) [-488.572] (-487.968) (-490.181) * (-489.146) (-498.381) [-487.465] (-490.121) -- 0:00:51

      Average standard deviation of split frequencies: 0.022823

      120500 -- (-487.921) (-488.058) [-489.323] (-489.338) * [-488.061] (-489.923) (-488.171) (-489.758) -- 0:00:51
      121000 -- (-489.733) (-489.514) [-488.765] (-489.832) * (-489.991) (-489.915) (-487.602) [-488.892] -- 0:00:50
      121500 -- (-487.770) (-490.994) [-488.922] (-488.310) * (-488.315) (-490.523) (-490.263) [-488.963] -- 0:00:50
      122000 -- [-490.392] (-490.036) (-488.915) (-488.202) * (-489.858) (-491.990) (-490.482) [-488.139] -- 0:00:50
      122500 -- (-488.138) (-490.571) (-490.711) [-489.759] * (-490.486) (-491.013) (-493.047) [-489.570] -- 0:00:50
      123000 -- [-489.555] (-490.640) (-492.965) (-491.676) * (-488.616) (-489.878) (-492.692) [-490.072] -- 0:00:49
      123500 -- [-493.407] (-488.419) (-489.975) (-488.712) * [-488.209] (-489.909) (-489.687) (-494.135) -- 0:00:49
      124000 -- (-492.890) [-489.365] (-487.587) (-487.483) * (-489.119) (-488.587) (-488.263) [-488.490] -- 0:00:49
      124500 -- (-490.209) (-489.612) (-488.625) [-492.423] * (-487.671) [-488.916] (-491.154) (-488.362) -- 0:00:49
      125000 -- [-493.309] (-487.872) (-491.710) (-491.058) * (-487.986) (-488.952) (-489.721) [-487.984] -- 0:00:49

      Average standard deviation of split frequencies: 0.022618

      125500 -- [-490.105] (-488.693) (-490.096) (-488.925) * [-489.015] (-490.090) (-489.459) (-489.741) -- 0:00:48
      126000 -- [-487.981] (-491.711) (-488.814) (-491.156) * [-488.708] (-490.725) (-488.959) (-489.594) -- 0:00:48
      126500 -- (-492.813) (-490.614) (-489.784) [-490.134] * (-489.232) (-491.022) (-487.709) [-488.663] -- 0:00:48
      127000 -- (-493.444) (-488.682) (-490.133) [-488.998] * (-489.437) (-489.963) (-491.521) [-491.844] -- 0:00:48
      127500 -- (-489.833) (-489.794) (-490.352) [-488.070] * (-489.129) [-490.856] (-492.776) (-490.863) -- 0:00:47
      128000 -- (-494.390) [-493.235] (-491.111) (-489.668) * (-489.036) [-489.933] (-491.121) (-492.182) -- 0:00:47
      128500 -- [-487.470] (-490.535) (-489.732) (-490.224) * [-490.393] (-490.365) (-490.340) (-493.276) -- 0:00:54
      129000 -- (-488.140) (-491.382) [-491.171] (-490.824) * (-489.779) (-488.518) [-488.978] (-491.589) -- 0:00:54
      129500 -- (-489.618) (-488.993) [-487.898] (-488.734) * (-489.580) [-489.681] (-490.230) (-488.800) -- 0:00:53
      130000 -- (-492.331) (-490.544) (-490.262) [-489.098] * (-490.496) (-490.408) [-488.811] (-488.665) -- 0:00:53

      Average standard deviation of split frequencies: 0.020564

      130500 -- (-490.254) (-491.564) [-489.638] (-489.069) * (-492.847) (-490.862) (-488.389) [-488.373] -- 0:00:53
      131000 -- (-492.374) (-489.095) (-490.088) [-490.414] * (-491.804) (-488.698) (-491.974) [-490.424] -- 0:00:53
      131500 -- (-490.350) (-490.052) [-489.615] (-491.384) * (-494.630) (-488.490) (-495.901) [-489.778] -- 0:00:52
      132000 -- (-489.797) (-490.734) [-490.632] (-492.020) * (-491.330) [-489.102] (-493.338) (-488.968) -- 0:00:52
      132500 -- [-487.908] (-488.421) (-489.208) (-493.572) * (-490.573) [-488.753] (-490.554) (-488.690) -- 0:00:52
      133000 -- (-488.586) (-489.183) (-488.360) [-491.063] * (-492.055) (-490.493) (-490.687) [-489.479] -- 0:00:52
      133500 -- [-488.325] (-491.296) (-487.486) (-491.335) * [-491.970] (-490.086) (-492.505) (-492.136) -- 0:00:51
      134000 -- (-489.641) (-491.129) (-487.579) [-488.235] * [-489.481] (-490.829) (-487.922) (-491.778) -- 0:00:51
      134500 -- (-491.309) (-487.790) [-487.813] (-487.647) * (-498.519) (-488.311) [-487.848] (-493.760) -- 0:00:51
      135000 -- [-488.340] (-489.060) (-490.393) (-487.812) * [-490.654] (-488.575) (-490.660) (-492.008) -- 0:00:51

      Average standard deviation of split frequencies: 0.019703

      135500 -- [-491.959] (-490.370) (-489.589) (-493.998) * (-498.229) [-492.288] (-492.446) (-490.934) -- 0:00:51
      136000 -- (-489.328) (-489.066) (-491.877) [-492.281] * (-491.023) (-487.970) [-488.767] (-489.797) -- 0:00:50
      136500 -- (-490.911) (-488.650) (-492.172) [-494.409] * (-488.935) (-490.503) [-490.517] (-490.916) -- 0:00:50
      137000 -- (-488.273) (-493.230) [-488.089] (-491.591) * [-489.358] (-490.786) (-488.366) (-489.894) -- 0:00:50
      137500 -- (-492.354) [-489.578] (-489.903) (-489.448) * [-488.676] (-491.966) (-491.103) (-490.421) -- 0:00:50
      138000 -- (-492.514) [-491.047] (-489.295) (-490.209) * (-489.260) (-489.150) [-490.861] (-490.847) -- 0:00:49
      138500 -- (-488.579) [-490.052] (-490.114) (-490.112) * (-489.973) [-488.949] (-492.330) (-489.649) -- 0:00:49
      139000 -- (-489.170) [-488.177] (-489.632) (-488.631) * (-494.080) (-488.828) (-495.004) [-490.571] -- 0:00:49
      139500 -- [-490.501] (-489.799) (-492.359) (-489.160) * (-489.711) [-489.436] (-490.440) (-492.583) -- 0:00:49
      140000 -- (-491.865) (-489.702) [-487.826] (-489.426) * [-489.250] (-488.611) (-488.084) (-489.963) -- 0:00:49

      Average standard deviation of split frequencies: 0.022453

      140500 -- (-490.844) (-489.137) (-489.979) [-489.990] * [-489.727] (-489.052) (-487.916) (-491.690) -- 0:00:48
      141000 -- (-492.140) (-491.455) [-489.977] (-488.463) * (-491.037) (-488.728) (-494.138) [-491.914] -- 0:00:48
      141500 -- (-489.484) (-489.514) [-488.063] (-490.782) * (-491.737) (-489.405) (-489.970) [-488.323] -- 0:00:48
      142000 -- (-495.690) (-490.401) (-488.661) [-488.103] * (-490.291) (-489.688) (-489.994) [-489.366] -- 0:00:48
      142500 -- [-495.796] (-492.218) (-491.195) (-489.326) * (-489.383) (-487.987) [-488.841] (-492.632) -- 0:00:48
      143000 -- (-493.669) (-493.427) [-489.613] (-488.900) * [-491.599] (-487.987) (-489.058) (-493.446) -- 0:00:47
      143500 -- (-490.859) (-494.481) [-493.079] (-488.526) * [-491.205] (-492.065) (-490.481) (-488.240) -- 0:00:47
      144000 -- [-487.492] (-489.090) (-490.442) (-490.441) * (-488.692) (-492.938) (-489.675) [-491.792] -- 0:00:47
      144500 -- (-489.740) [-487.526] (-493.338) (-490.888) * (-494.215) (-489.289) [-487.617] (-489.117) -- 0:00:47
      145000 -- [-493.385] (-488.994) (-492.545) (-488.343) * (-489.713) (-488.595) [-488.234] (-492.910) -- 0:00:47

      Average standard deviation of split frequencies: 0.022117

      145500 -- (-490.986) [-488.557] (-488.312) (-492.550) * (-489.056) [-489.903] (-489.294) (-488.346) -- 0:00:52
      146000 -- (-491.194) (-492.212) [-490.462] (-488.956) * [-488.256] (-487.847) (-488.480) (-489.182) -- 0:00:52
      146500 -- (-493.367) (-489.365) (-490.910) [-488.250] * (-489.961) (-490.725) (-488.484) [-491.406] -- 0:00:52
      147000 -- (-492.195) (-496.854) [-488.330] (-489.465) * (-490.665) [-490.218] (-489.437) (-491.614) -- 0:00:52
      147500 -- [-489.584] (-492.460) (-489.791) (-489.750) * (-493.020) [-488.571] (-489.047) (-487.919) -- 0:00:52
      148000 -- (-488.897) (-492.357) (-491.553) [-489.076] * (-492.481) [-490.824] (-488.263) (-488.061) -- 0:00:51
      148500 -- (-489.860) (-493.041) (-490.411) [-488.284] * [-489.627] (-489.164) (-490.179) (-490.652) -- 0:00:51
      149000 -- (-488.265) [-489.911] (-491.803) (-494.357) * (-487.740) [-489.967] (-489.099) (-491.493) -- 0:00:51
      149500 -- (-488.785) [-488.422] (-491.591) (-490.691) * (-488.891) [-492.088] (-488.602) (-492.374) -- 0:00:51
      150000 -- [-490.589] (-492.523) (-490.305) (-489.126) * [-489.084] (-492.423) (-490.501) (-490.134) -- 0:00:51

      Average standard deviation of split frequencies: 0.021432

      150500 -- (-490.847) (-493.167) (-490.294) [-487.963] * [-490.738] (-488.156) (-492.699) (-491.430) -- 0:00:50
      151000 -- (-493.949) (-494.957) [-488.712] (-489.632) * (-489.183) (-488.798) [-488.289] (-487.883) -- 0:00:50
      151500 -- (-492.549) (-492.357) (-487.617) [-488.440] * [-495.161] (-489.818) (-488.789) (-489.980) -- 0:00:50
      152000 -- (-491.539) [-489.848] (-488.391) (-488.034) * (-490.734) (-488.787) [-488.590] (-494.398) -- 0:00:50
      152500 -- (-490.086) (-493.432) [-489.653] (-490.374) * (-489.812) (-489.448) [-489.739] (-490.257) -- 0:00:50
      153000 -- (-491.804) [-489.597] (-488.469) (-489.596) * (-489.168) (-489.832) (-490.229) [-487.710] -- 0:00:49
      153500 -- [-491.601] (-490.848) (-489.239) (-489.308) * (-489.391) (-490.025) [-490.116] (-490.152) -- 0:00:49
      154000 -- (-491.680) (-488.932) [-488.497] (-488.861) * (-489.722) (-492.059) (-490.604) [-491.471] -- 0:00:49
      154500 -- [-490.559] (-488.945) (-490.329) (-488.752) * (-491.596) (-489.116) (-492.826) [-488.148] -- 0:00:49
      155000 -- (-493.462) (-489.445) (-490.843) [-487.769] * [-489.884] (-487.909) (-489.137) (-487.594) -- 0:00:49

      Average standard deviation of split frequencies: 0.017124

      155500 -- (-490.420) (-489.514) [-493.658] (-489.620) * (-488.583) (-492.452) [-489.647] (-489.206) -- 0:00:48
      156000 -- (-495.536) [-489.349] (-491.598) (-493.559) * (-488.079) [-490.952] (-490.085) (-489.197) -- 0:00:48
      156500 -- [-490.126] (-489.556) (-491.681) (-488.277) * (-487.705) [-491.503] (-491.271) (-491.846) -- 0:00:48
      157000 -- [-489.046] (-488.702) (-489.181) (-489.849) * (-491.820) [-490.123] (-489.133) (-490.344) -- 0:00:48
      157500 -- (-488.556) (-492.215) (-492.441) [-490.682] * (-490.010) [-494.586] (-495.244) (-491.324) -- 0:00:48
      158000 -- (-488.757) (-490.156) [-490.184] (-488.707) * (-489.518) [-492.122] (-494.822) (-491.459) -- 0:00:47
      158500 -- (-488.633) [-489.194] (-490.980) (-489.617) * [-489.539] (-490.048) (-490.476) (-488.288) -- 0:00:47
      159000 -- (-488.601) (-487.901) (-490.237) [-490.087] * (-490.671) [-488.725] (-488.954) (-495.177) -- 0:00:47
      159500 -- (-492.273) (-488.561) (-491.167) [-487.832] * (-490.159) (-490.486) (-489.942) [-493.259] -- 0:00:47
      160000 -- (-490.027) (-490.806) [-488.354] (-488.013) * [-489.514] (-488.546) (-489.874) (-489.147) -- 0:00:47

      Average standard deviation of split frequencies: 0.016741

      160500 -- (-488.916) (-490.317) [-490.352] (-487.838) * [-489.831] (-493.478) (-490.784) (-489.263) -- 0:00:47
      161000 -- (-489.032) (-489.706) [-489.989] (-489.710) * (-491.895) (-489.018) [-490.622] (-489.067) -- 0:00:46
      161500 -- (-490.630) (-493.758) [-490.058] (-487.723) * (-491.354) [-489.325] (-489.567) (-490.424) -- 0:00:46
      162000 -- (-490.597) (-488.708) [-496.833] (-488.341) * (-491.004) (-491.411) [-489.230] (-490.129) -- 0:00:51
      162500 -- (-489.139) (-488.169) [-489.381] (-489.007) * (-496.109) (-488.984) (-491.142) [-487.950] -- 0:00:51
      163000 -- (-490.428) [-487.534] (-490.674) (-490.899) * [-491.675] (-488.494) (-490.466) (-488.046) -- 0:00:51
      163500 -- (-488.559) (-490.348) [-489.315] (-490.217) * (-489.080) (-491.381) (-488.717) [-488.660] -- 0:00:51
      164000 -- (-487.694) (-490.524) [-490.194] (-490.880) * (-488.347) [-488.860] (-490.040) (-493.044) -- 0:00:50
      164500 -- [-489.670] (-491.333) (-492.971) (-488.691) * [-487.695] (-489.438) (-490.390) (-490.706) -- 0:00:50
      165000 -- [-488.254] (-490.993) (-488.242) (-488.632) * (-488.084) (-488.966) [-489.124] (-489.247) -- 0:00:50

      Average standard deviation of split frequencies: 0.014514

      165500 -- (-494.890) [-491.353] (-488.359) (-489.812) * (-489.029) (-488.898) [-494.839] (-493.855) -- 0:00:50
      166000 -- (-489.205) (-488.811) [-487.933] (-490.210) * [-489.171] (-491.488) (-488.318) (-487.498) -- 0:00:50
      166500 -- (-493.549) [-490.525] (-488.705) (-489.925) * (-488.902) (-490.263) (-488.247) [-487.998] -- 0:00:50
      167000 -- (-488.562) (-489.908) [-488.557] (-488.505) * (-488.369) [-488.677] (-493.645) (-489.371) -- 0:00:49
      167500 -- (-492.487) (-495.113) (-491.320) [-489.739] * (-489.755) [-489.690] (-490.152) (-489.646) -- 0:00:49
      168000 -- [-490.425] (-492.221) (-488.565) (-489.452) * (-490.239) [-488.080] (-495.843) (-488.130) -- 0:00:49
      168500 -- (-491.603) (-496.531) [-490.039] (-489.800) * [-490.954] (-488.808) (-491.620) (-488.776) -- 0:00:49
      169000 -- [-487.680] (-488.138) (-488.765) (-489.803) * (-490.749) (-490.210) (-492.830) [-491.026] -- 0:00:49
      169500 -- (-487.818) (-489.291) (-488.598) [-490.399] * (-497.946) [-491.080] (-492.251) (-490.226) -- 0:00:48
      170000 -- (-487.416) (-488.745) [-490.415] (-489.274) * [-489.654] (-489.891) (-489.053) (-491.360) -- 0:00:48

      Average standard deviation of split frequencies: 0.015410

      170500 -- (-488.976) (-488.604) [-488.111] (-492.696) * [-489.268] (-489.171) (-490.596) (-490.382) -- 0:00:48
      171000 -- (-490.378) [-488.893] (-491.546) (-488.402) * (-489.398) (-489.712) [-489.746] (-491.339) -- 0:00:48
      171500 -- (-489.312) [-492.033] (-487.985) (-488.235) * (-489.860) (-491.585) [-489.018] (-488.327) -- 0:00:48
      172000 -- (-488.938) (-488.826) (-487.823) [-488.827] * [-487.626] (-494.056) (-487.926) (-493.140) -- 0:00:48
      172500 -- [-489.300] (-491.037) (-488.548) (-490.224) * [-488.551] (-490.175) (-489.354) (-491.892) -- 0:00:47
      173000 -- [-488.127] (-489.824) (-488.243) (-490.897) * (-488.465) [-490.377] (-491.525) (-489.263) -- 0:00:47
      173500 -- (-489.166) [-488.029] (-489.179) (-490.021) * (-487.765) [-489.871] (-488.959) (-488.481) -- 0:00:47
      174000 -- [-490.606] (-487.863) (-488.117) (-491.467) * (-493.389) [-489.289] (-489.150) (-489.856) -- 0:00:47
      174500 -- [-492.664] (-487.820) (-494.898) (-489.891) * (-495.408) (-492.100) (-490.175) [-487.743] -- 0:00:47
      175000 -- (-488.284) [-488.313] (-494.941) (-495.020) * (-488.078) [-489.302] (-491.655) (-489.621) -- 0:00:47

      Average standard deviation of split frequencies: 0.014802

      175500 -- (-489.759) [-489.139] (-489.266) (-488.316) * (-488.504) [-491.798] (-489.548) (-489.683) -- 0:00:46
      176000 -- (-488.138) [-490.362] (-489.548) (-492.656) * (-493.878) (-491.526) (-491.690) [-491.387] -- 0:00:46
      176500 -- (-489.061) [-488.620] (-489.066) (-489.113) * (-491.197) [-490.283] (-490.148) (-490.593) -- 0:00:46
      177000 -- (-489.562) (-491.229) [-488.311] (-488.329) * [-488.613] (-488.497) (-492.333) (-498.255) -- 0:00:46
      177500 -- (-489.622) [-489.462] (-490.627) (-488.008) * [-491.561] (-488.401) (-492.342) (-491.796) -- 0:00:46
      178000 -- (-488.558) (-489.981) [-488.752] (-488.126) * (-492.903) [-488.462] (-488.770) (-487.886) -- 0:00:46
      178500 -- (-489.087) [-491.884] (-492.600) (-487.607) * (-489.090) (-491.730) [-489.978] (-488.934) -- 0:00:46
      179000 -- (-491.137) (-487.447) (-488.731) [-488.749] * (-491.883) (-492.906) [-490.866] (-491.562) -- 0:00:45
      179500 -- (-490.843) (-489.473) [-489.133] (-493.597) * (-491.680) [-491.220] (-489.934) (-488.729) -- 0:00:50
      180000 -- (-489.608) (-489.972) [-487.800] (-490.424) * (-492.818) (-496.268) (-489.930) [-488.928] -- 0:00:50

      Average standard deviation of split frequencies: 0.015793

      180500 -- [-488.507] (-491.287) (-490.342) (-495.404) * [-489.403] (-494.283) (-490.043) (-487.996) -- 0:00:49
      181000 -- (-489.962) (-488.792) (-490.030) [-491.946] * (-487.440) (-489.657) [-488.092] (-491.419) -- 0:00:49
      181500 -- [-492.985] (-488.729) (-490.379) (-491.146) * (-488.714) (-490.454) (-488.660) [-492.932] -- 0:00:49
      182000 -- [-490.884] (-490.998) (-490.055) (-490.407) * (-488.547) (-490.115) [-488.353] (-491.133) -- 0:00:49
      182500 -- [-492.188] (-490.491) (-492.507) (-487.530) * (-488.716) (-489.601) [-489.469] (-490.269) -- 0:00:49
      183000 -- (-488.724) (-490.516) (-492.396) [-487.854] * (-490.144) (-488.890) [-487.720] (-492.951) -- 0:00:49
      183500 -- (-487.710) [-489.212] (-488.760) (-487.754) * (-491.901) [-487.881] (-488.443) (-491.235) -- 0:00:48
      184000 -- (-490.361) [-488.382] (-490.212) (-489.843) * (-490.863) [-488.958] (-492.428) (-492.467) -- 0:00:48
      184500 -- [-490.041] (-491.967) (-488.350) (-492.382) * (-492.967) (-492.639) [-491.040] (-490.392) -- 0:00:48
      185000 -- (-491.245) (-488.511) (-494.726) [-490.266] * (-489.559) (-491.717) [-491.887] (-490.996) -- 0:00:48

      Average standard deviation of split frequencies: 0.017207

      185500 -- (-488.766) (-488.324) [-489.723] (-491.817) * [-488.185] (-489.928) (-488.651) (-488.717) -- 0:00:48
      186000 -- (-488.431) (-490.679) [-488.265] (-491.679) * [-491.297] (-489.759) (-491.476) (-488.792) -- 0:00:48
      186500 -- (-490.312) (-489.266) (-489.186) [-491.381] * (-487.707) (-488.334) [-488.636] (-488.836) -- 0:00:47
      187000 -- (-491.751) (-493.012) (-489.103) [-491.048] * (-488.438) [-488.974] (-489.922) (-492.303) -- 0:00:47
      187500 -- (-489.760) (-488.231) (-489.014) [-491.292] * (-489.105) [-489.714] (-491.272) (-490.162) -- 0:00:47
      188000 -- (-494.485) (-489.727) (-488.171) [-488.689] * (-489.147) [-488.298] (-489.848) (-488.340) -- 0:00:47
      188500 -- (-492.105) (-490.999) [-491.166] (-488.353) * [-490.259] (-488.051) (-489.320) (-490.375) -- 0:00:47
      189000 -- (-489.550) [-490.449] (-491.130) (-491.699) * (-489.307) (-488.051) (-488.790) [-490.204] -- 0:00:47
      189500 -- (-488.472) (-488.327) (-489.353) [-492.077] * (-488.542) (-488.525) (-488.894) [-488.052] -- 0:00:47
      190000 -- [-491.309] (-491.246) (-488.704) (-487.979) * (-487.842) [-487.622] (-488.832) (-491.760) -- 0:00:46

      Average standard deviation of split frequencies: 0.017169

      190500 -- (-490.190) (-489.276) [-491.537] (-488.553) * [-487.888] (-489.490) (-490.402) (-494.664) -- 0:00:46
      191000 -- (-491.551) (-489.081) (-492.199) [-489.437] * [-487.425] (-489.396) (-492.349) (-490.715) -- 0:00:46
      191500 -- (-493.999) (-488.411) (-489.830) [-488.586] * (-488.222) (-493.209) [-491.300] (-488.414) -- 0:00:46
      192000 -- (-492.604) (-489.721) (-490.207) [-490.870] * (-488.908) (-490.584) (-490.195) [-491.125] -- 0:00:46
      192500 -- (-490.118) [-488.874] (-491.144) (-492.612) * (-488.941) (-489.562) (-488.084) [-491.835] -- 0:00:46
      193000 -- [-490.299] (-487.720) (-496.965) (-488.179) * [-488.221] (-489.931) (-490.137) (-489.666) -- 0:00:45
      193500 -- (-489.970) [-488.879] (-489.042) (-489.826) * (-490.749) [-494.691] (-490.189) (-490.921) -- 0:00:45
      194000 -- (-489.441) (-487.881) [-487.908] (-490.157) * [-489.192] (-490.986) (-494.398) (-491.392) -- 0:00:45
      194500 -- (-489.152) [-488.135] (-488.426) (-490.379) * (-489.386) (-493.462) (-490.471) [-494.007] -- 0:00:45
      195000 -- [-490.635] (-488.821) (-487.839) (-493.021) * (-492.220) (-490.242) (-488.903) [-491.556] -- 0:00:45

      Average standard deviation of split frequencies: 0.015901

      195500 -- (-490.888) [-489.183] (-492.005) (-491.017) * (-490.435) [-489.532] (-491.272) (-491.140) -- 0:00:45
      196000 -- (-489.595) [-489.734] (-490.240) (-489.151) * (-489.975) (-489.312) (-490.069) [-488.225] -- 0:00:45
      196500 -- (-489.469) (-489.025) [-489.616] (-491.005) * (-489.450) (-489.010) (-491.420) [-488.627] -- 0:00:49
      197000 -- (-491.458) [-490.638] (-487.914) (-490.217) * (-487.981) (-491.954) (-490.050) [-490.157] -- 0:00:48
      197500 -- (-497.323) (-491.326) (-492.071) [-488.853] * [-491.634] (-490.462) (-492.958) (-488.973) -- 0:00:48
      198000 -- (-494.006) (-490.753) [-491.655] (-490.125) * (-488.674) (-489.628) [-491.398] (-489.877) -- 0:00:48
      198500 -- [-489.580] (-490.319) (-488.237) (-489.668) * (-489.989) (-487.838) [-491.766] (-491.739) -- 0:00:48
      199000 -- (-488.287) [-493.620] (-489.648) (-489.222) * [-489.476] (-488.016) (-489.511) (-492.781) -- 0:00:48
      199500 -- (-495.091) (-489.923) [-490.781] (-490.094) * [-493.108] (-488.525) (-489.307) (-488.643) -- 0:00:48
      200000 -- [-489.937] (-490.338) (-490.943) (-491.505) * (-488.676) (-488.071) (-495.151) [-491.519] -- 0:00:48

      Average standard deviation of split frequencies: 0.015922

      200500 -- [-490.204] (-490.726) (-491.355) (-489.580) * (-490.906) (-489.285) [-492.448] (-489.354) -- 0:00:47
      201000 -- (-490.724) [-490.609] (-492.475) (-490.029) * (-492.537) (-488.300) (-496.860) [-489.982] -- 0:00:47
      201500 -- (-490.464) (-490.252) [-489.910] (-487.745) * [-490.062] (-490.880) (-488.674) (-488.240) -- 0:00:47
      202000 -- [-490.484] (-489.455) (-488.812) (-492.936) * (-490.508) (-490.268) [-488.453] (-490.916) -- 0:00:47
      202500 -- (-489.084) (-488.184) (-489.156) [-493.207] * [-487.635] (-493.309) (-494.261) (-490.419) -- 0:00:47
      203000 -- (-489.309) (-489.062) (-494.192) [-490.477] * (-490.476) (-492.139) (-493.842) [-491.612] -- 0:00:47
      203500 -- (-491.223) (-489.176) [-490.521] (-488.908) * [-490.258] (-492.421) (-493.140) (-490.590) -- 0:00:46
      204000 -- (-493.216) [-489.302] (-489.178) (-489.049) * (-488.899) [-490.490] (-494.713) (-490.521) -- 0:00:46
      204500 -- (-488.994) (-488.144) (-490.119) [-491.592] * (-492.673) (-495.500) (-489.577) [-488.905] -- 0:00:46
      205000 -- (-487.551) (-490.182) [-490.606] (-489.986) * [-489.368] (-491.703) (-488.137) (-492.469) -- 0:00:46

      Average standard deviation of split frequencies: 0.015383

      205500 -- (-487.764) [-491.809] (-490.923) (-488.319) * [-488.206] (-490.175) (-490.422) (-488.903) -- 0:00:46
      206000 -- (-489.182) [-490.512] (-489.309) (-488.662) * (-489.597) (-491.275) [-491.188] (-488.678) -- 0:00:46
      206500 -- (-491.160) [-490.767] (-488.721) (-488.419) * (-493.198) (-489.573) [-489.689] (-488.730) -- 0:00:46
      207000 -- (-488.712) (-492.403) [-489.585] (-489.381) * (-488.846) (-493.452) [-490.003] (-489.614) -- 0:00:45
      207500 -- (-489.278) [-489.473] (-487.906) (-495.306) * [-487.985] (-489.880) (-489.280) (-488.547) -- 0:00:45
      208000 -- (-487.772) (-489.460) [-487.856] (-495.559) * [-488.638] (-488.526) (-487.630) (-489.183) -- 0:00:45
      208500 -- (-488.614) [-488.539] (-491.679) (-491.581) * (-488.744) (-490.156) [-493.365] (-487.943) -- 0:00:45
      209000 -- [-488.755] (-491.055) (-491.378) (-493.032) * (-488.020) (-492.433) (-489.249) [-488.337] -- 0:00:45
      209500 -- (-490.816) (-488.310) [-493.521] (-490.459) * (-492.117) (-489.490) (-490.514) [-488.523] -- 0:00:45
      210000 -- [-489.031] (-487.750) (-488.386) (-489.973) * [-492.855] (-491.706) (-490.035) (-489.874) -- 0:00:45

      Average standard deviation of split frequencies: 0.016161

      210500 -- (-488.487) (-489.447) (-489.373) [-488.922] * (-490.528) (-496.473) (-488.549) [-488.125] -- 0:00:45
      211000 -- (-488.136) (-488.408) (-489.259) [-488.024] * (-492.365) (-492.099) (-488.340) [-489.104] -- 0:00:44
      211500 -- (-488.176) (-497.400) [-489.666] (-490.796) * [-492.202] (-488.633) (-491.487) (-488.167) -- 0:00:44
      212000 -- (-490.071) [-488.724] (-489.534) (-489.673) * [-487.938] (-490.206) (-488.033) (-488.124) -- 0:00:44
      212500 -- (-488.979) [-489.405] (-491.337) (-490.675) * (-489.101) (-489.696) [-488.532] (-490.767) -- 0:00:44
      213000 -- (-489.367) (-489.363) [-492.295] (-489.410) * (-490.804) (-490.874) [-495.259] (-488.023) -- 0:00:48
      213500 -- (-490.491) (-491.107) [-489.330] (-490.063) * (-492.104) [-491.947] (-487.815) (-491.684) -- 0:00:47
      214000 -- [-490.639] (-489.571) (-487.926) (-489.463) * (-488.941) [-487.931] (-488.854) (-493.158) -- 0:00:47
      214500 -- [-488.505] (-494.496) (-490.361) (-490.467) * (-488.522) (-489.662) (-488.457) [-488.597] -- 0:00:47
      215000 -- [-491.742] (-491.035) (-488.387) (-488.890) * (-492.451) (-495.658) [-488.432] (-490.829) -- 0:00:47

      Average standard deviation of split frequencies: 0.015047

      215500 -- (-489.489) (-488.836) [-495.054] (-488.242) * (-489.793) [-493.420] (-488.670) (-489.375) -- 0:00:47
      216000 -- (-492.500) (-490.920) (-492.385) [-492.661] * (-490.310) (-495.794) [-489.503] (-490.394) -- 0:00:47
      216500 -- [-494.202] (-490.985) (-491.280) (-492.082) * (-491.726) (-489.606) [-488.543] (-489.361) -- 0:00:47
      217000 -- (-493.496) [-489.003] (-491.010) (-488.951) * [-490.200] (-489.926) (-488.192) (-490.886) -- 0:00:46
      217500 -- (-493.765) (-489.071) (-487.913) [-490.677] * [-488.310] (-493.903) (-492.123) (-492.240) -- 0:00:46
      218000 -- [-489.112] (-494.565) (-488.778) (-492.105) * (-488.426) (-488.061) (-489.405) [-494.286] -- 0:00:46
      218500 -- [-489.872] (-488.465) (-489.952) (-489.608) * (-489.284) [-491.409] (-491.791) (-489.029) -- 0:00:46
      219000 -- (-488.864) (-487.871) [-493.686] (-489.239) * [-491.778] (-490.175) (-491.168) (-489.580) -- 0:00:46
      219500 -- [-489.109] (-490.523) (-491.591) (-489.592) * (-489.580) (-489.684) [-489.724] (-489.662) -- 0:00:46
      220000 -- [-489.933] (-489.816) (-488.911) (-489.939) * (-490.966) (-488.559) (-488.973) [-489.744] -- 0:00:46

      Average standard deviation of split frequencies: 0.013949

      220500 -- (-488.548) (-487.898) [-489.569] (-488.845) * (-488.866) (-491.861) (-487.693) [-488.468] -- 0:00:45
      221000 -- (-491.571) (-489.438) (-487.683) [-490.558] * (-490.473) (-492.680) [-487.316] (-491.110) -- 0:00:45
      221500 -- (-492.549) (-490.456) (-489.328) [-493.795] * (-488.769) (-489.610) [-490.483] (-489.821) -- 0:00:45
      222000 -- (-491.050) (-487.880) (-492.033) [-488.064] * [-488.462] (-490.885) (-493.018) (-490.522) -- 0:00:45
      222500 -- (-487.937) [-488.746] (-489.899) (-492.672) * (-488.326) (-488.445) [-489.870] (-490.362) -- 0:00:45
      223000 -- (-489.539) (-489.800) [-489.416] (-493.866) * (-489.299) [-491.060] (-488.913) (-489.824) -- 0:00:45
      223500 -- (-488.649) (-488.536) [-489.806] (-488.354) * (-490.813) (-489.984) (-489.660) [-489.663] -- 0:00:45
      224000 -- (-491.165) (-492.723) [-490.378] (-491.309) * (-490.817) (-488.494) [-489.194] (-493.911) -- 0:00:45
      224500 -- (-491.652) [-493.256] (-494.984) (-489.867) * (-489.160) [-491.413] (-489.829) (-492.308) -- 0:00:44
      225000 -- (-488.527) (-489.146) (-494.903) [-490.659] * (-489.375) [-490.240] (-488.871) (-491.986) -- 0:00:44

      Average standard deviation of split frequencies: 0.014821

      225500 -- (-491.683) (-487.826) (-490.153) [-490.475] * (-494.847) (-488.968) (-489.945) [-489.415] -- 0:00:44
      226000 -- (-489.964) (-491.709) (-489.476) [-489.784] * (-490.768) [-488.643] (-490.717) (-494.065) -- 0:00:44
      226500 -- (-488.623) [-490.445] (-487.963) (-489.704) * (-490.171) (-491.220) (-487.953) [-492.241] -- 0:00:44
      227000 -- (-491.845) (-491.992) [-488.289] (-488.140) * (-490.295) [-490.039] (-492.797) (-491.570) -- 0:00:44
      227500 -- (-489.959) (-489.341) (-492.131) [-494.157] * (-488.852) [-490.882] (-496.758) (-489.589) -- 0:00:44
      228000 -- (-487.973) (-488.628) [-489.913] (-495.648) * [-488.652] (-490.271) (-492.456) (-487.605) -- 0:00:44
      228500 -- (-488.695) (-488.828) (-489.111) [-489.056] * (-490.661) (-492.788) (-492.437) [-489.909] -- 0:00:43
      229000 -- (-487.821) [-489.512] (-488.414) (-492.137) * [-487.856] (-490.406) (-488.485) (-490.726) -- 0:00:43
      229500 -- (-492.527) (-489.500) [-490.625] (-490.799) * (-489.893) (-495.182) [-491.706] (-490.240) -- 0:00:43
      230000 -- [-492.886] (-491.408) (-490.950) (-493.801) * [-490.397] (-488.647) (-493.997) (-491.168) -- 0:00:43

      Average standard deviation of split frequencies: 0.014843

      230500 -- (-492.634) (-490.615) [-489.296] (-492.989) * (-487.868) (-492.401) (-493.032) [-492.515] -- 0:00:46
      231000 -- (-493.034) (-490.737) [-491.085] (-494.636) * [-489.004] (-488.685) (-490.180) (-489.401) -- 0:00:46
      231500 -- (-487.860) (-490.150) [-488.977] (-489.742) * (-489.681) (-491.087) (-487.812) [-489.683] -- 0:00:46
      232000 -- (-490.581) (-490.842) [-489.828] (-490.186) * (-493.218) (-488.516) [-489.050] (-489.737) -- 0:00:46
      232500 -- (-489.057) [-488.365] (-492.254) (-489.325) * (-490.844) [-491.726] (-490.612) (-488.449) -- 0:00:46
      233000 -- (-489.400) (-492.210) [-488.960] (-491.583) * (-489.215) (-491.104) [-489.744] (-489.643) -- 0:00:46
      233500 -- (-494.041) (-489.856) [-490.126] (-488.173) * (-494.632) (-489.373) (-490.294) [-490.084] -- 0:00:45
      234000 -- (-489.006) [-487.592] (-491.056) (-489.490) * (-493.874) [-488.928] (-488.048) (-498.446) -- 0:00:45
      234500 -- (-488.312) (-488.227) (-493.108) [-490.212] * (-494.852) (-488.517) (-487.928) [-490.906] -- 0:00:45
      235000 -- (-493.353) (-488.292) (-488.730) [-490.588] * (-492.125) [-488.892] (-492.206) (-488.748) -- 0:00:45

      Average standard deviation of split frequencies: 0.014093

      235500 -- (-488.276) (-489.586) (-489.377) [-488.982] * (-496.497) (-491.375) [-488.651] (-490.439) -- 0:00:45
      236000 -- (-489.214) (-488.396) (-490.981) [-489.215] * (-488.470) (-490.179) [-488.361] (-495.249) -- 0:00:45
      236500 -- (-488.220) (-488.628) [-488.337] (-490.439) * (-489.471) (-493.117) [-488.769] (-491.861) -- 0:00:45
      237000 -- (-495.848) (-497.180) [-489.696] (-490.931) * (-493.005) (-491.119) (-488.457) [-488.432] -- 0:00:45
      237500 -- (-494.846) [-489.078] (-488.481) (-491.284) * [-491.890] (-490.083) (-487.482) (-489.647) -- 0:00:44
      238000 -- [-487.928] (-489.338) (-489.972) (-488.836) * [-489.746] (-490.002) (-489.009) (-490.444) -- 0:00:44
      238500 -- (-488.396) (-495.279) [-491.659] (-488.845) * (-489.940) (-489.011) (-489.075) [-488.629] -- 0:00:44
      239000 -- [-487.987] (-495.853) (-489.580) (-488.907) * (-489.080) (-489.482) (-490.647) [-494.615] -- 0:00:44
      239500 -- (-488.822) (-494.615) [-487.783] (-491.863) * (-491.565) [-491.465] (-491.898) (-489.902) -- 0:00:44
      240000 -- (-488.245) [-488.025] (-489.074) (-492.996) * (-491.549) (-490.056) [-490.863] (-490.608) -- 0:00:44

      Average standard deviation of split frequencies: 0.013494

      240500 -- (-492.727) (-488.170) (-489.462) [-489.504] * (-490.263) [-488.419] (-489.241) (-490.096) -- 0:00:44
      241000 -- [-491.524] (-490.290) (-488.596) (-488.666) * (-489.188) (-487.769) (-489.422) [-488.130] -- 0:00:44
      241500 -- [-489.994] (-490.094) (-487.688) (-490.618) * (-488.029) (-494.935) (-491.715) [-488.627] -- 0:00:43
      242000 -- (-490.129) (-489.355) [-489.014] (-490.966) * (-489.589) (-489.067) (-490.535) [-490.532] -- 0:00:43
      242500 -- [-492.241] (-488.862) (-488.426) (-491.101) * (-490.890) [-492.269] (-488.985) (-490.272) -- 0:00:43
      243000 -- (-490.327) (-489.413) [-490.236] (-490.543) * [-487.952] (-491.998) (-489.362) (-490.293) -- 0:00:43
      243500 -- [-488.692] (-489.465) (-490.589) (-490.203) * [-490.915] (-490.179) (-487.921) (-487.919) -- 0:00:43
      244000 -- (-490.535) (-489.830) (-490.640) [-488.473] * (-489.032) [-487.891] (-489.839) (-488.266) -- 0:00:43
      244500 -- [-489.616] (-488.322) (-487.858) (-488.736) * (-493.239) [-488.823] (-490.579) (-488.950) -- 0:00:43
      245000 -- [-487.927] (-488.742) (-488.952) (-493.913) * (-494.187) (-489.205) (-495.877) [-489.955] -- 0:00:43

      Average standard deviation of split frequencies: 0.012988

      245500 -- (-492.784) (-488.035) [-490.102] (-489.504) * (-492.754) (-488.047) (-491.885) [-489.587] -- 0:00:43
      246000 -- (-494.288) (-487.780) (-488.735) [-488.194] * (-488.321) [-488.579] (-489.060) (-491.064) -- 0:00:42
      246500 -- (-490.422) (-491.431) [-488.662] (-491.198) * (-489.965) [-488.571] (-491.922) (-490.211) -- 0:00:42
      247000 -- (-489.212) (-495.241) (-490.504) [-488.743] * (-490.046) (-488.726) (-491.994) [-489.034] -- 0:00:42
      247500 -- (-489.479) (-491.848) (-489.503) [-490.108] * [-489.780] (-488.021) (-492.477) (-491.807) -- 0:00:45
      248000 -- (-489.122) (-489.059) [-494.086] (-489.141) * (-489.194) (-489.687) (-491.619) [-488.511] -- 0:00:45
      248500 -- [-489.065] (-488.244) (-491.537) (-488.875) * (-489.318) (-490.115) [-491.087] (-490.478) -- 0:00:45
      249000 -- (-490.489) [-487.774] (-488.360) (-490.578) * (-490.686) (-491.086) [-488.863] (-490.508) -- 0:00:45
      249500 -- (-490.449) (-488.949) (-488.642) [-490.559] * [-491.264] (-494.821) (-492.697) (-490.842) -- 0:00:45
      250000 -- (-487.395) (-489.455) [-489.399] (-491.225) * (-497.656) (-494.505) [-491.849] (-491.832) -- 0:00:45

      Average standard deviation of split frequencies: 0.012867

      250500 -- (-487.394) (-491.810) (-488.364) [-488.254] * (-490.999) (-490.082) (-490.105) [-488.299] -- 0:00:44
      251000 -- (-491.580) (-489.629) (-487.804) [-488.223] * (-488.137) (-490.093) [-489.171] (-487.929) -- 0:00:44
      251500 -- (-492.640) (-492.807) [-490.056] (-489.199) * (-488.466) (-489.371) (-493.873) [-492.502] -- 0:00:44
      252000 -- (-492.049) [-490.669] (-489.024) (-489.708) * (-488.074) [-488.400] (-492.324) (-496.362) -- 0:00:44
      252500 -- (-488.772) (-492.350) (-489.614) [-492.306] * (-491.218) (-491.417) (-492.084) [-490.870] -- 0:00:44
      253000 -- (-487.840) [-489.291] (-489.350) (-488.968) * (-488.069) (-491.446) (-493.191) [-489.574] -- 0:00:44
      253500 -- (-491.809) [-491.761] (-492.922) (-490.736) * (-493.449) (-491.816) (-490.994) [-489.314] -- 0:00:44
      254000 -- (-493.128) [-490.025] (-490.120) (-489.775) * [-487.537] (-487.790) (-491.384) (-488.364) -- 0:00:44
      254500 -- (-488.424) [-489.344] (-490.798) (-491.619) * (-490.573) (-488.888) [-489.751] (-492.186) -- 0:00:43
      255000 -- (-487.636) (-489.062) (-490.828) [-489.334] * (-488.181) (-488.012) [-489.821] (-490.570) -- 0:00:43

      Average standard deviation of split frequencies: 0.012565

      255500 -- [-488.070] (-489.442) (-488.967) (-489.081) * (-489.849) [-488.515] (-490.022) (-489.713) -- 0:00:43
      256000 -- (-489.941) (-492.278) [-488.105] (-489.758) * [-488.380] (-489.491) (-490.048) (-490.442) -- 0:00:43
      256500 -- (-491.278) [-489.596] (-493.638) (-490.331) * [-488.139] (-494.691) (-490.077) (-491.187) -- 0:00:43
      257000 -- (-488.297) (-489.833) [-495.761] (-492.021) * [-488.335] (-488.183) (-488.930) (-489.414) -- 0:00:43
      257500 -- (-488.210) (-488.011) [-489.606] (-495.039) * [-489.604] (-488.651) (-495.057) (-489.653) -- 0:00:43
      258000 -- (-489.288) (-491.547) (-491.226) [-489.094] * (-492.821) (-488.828) [-490.005] (-489.923) -- 0:00:43
      258500 -- [-488.804] (-490.469) (-489.854) (-487.937) * (-488.478) (-489.150) (-493.362) [-487.856] -- 0:00:43
      259000 -- (-490.724) (-489.004) (-487.929) [-489.491] * (-491.221) [-493.244] (-491.571) (-492.830) -- 0:00:42
      259500 -- (-489.551) [-487.588] (-491.308) (-487.990) * (-490.592) (-493.806) (-489.053) [-489.056] -- 0:00:42
      260000 -- (-492.066) (-488.577) (-490.198) [-489.419] * (-489.319) [-489.913] (-490.657) (-488.634) -- 0:00:42

      Average standard deviation of split frequencies: 0.012446

      260500 -- (-488.764) (-488.635) (-487.903) [-489.938] * [-490.079] (-491.732) (-489.190) (-494.282) -- 0:00:42
      261000 -- [-491.238] (-490.075) (-488.554) (-491.757) * [-488.186] (-491.816) (-492.000) (-492.985) -- 0:00:42
      261500 -- (-489.336) (-488.637) [-489.058] (-490.405) * (-488.938) (-493.199) (-488.955) [-492.126] -- 0:00:42
      262000 -- [-493.225] (-491.526) (-491.818) (-489.699) * [-489.030] (-490.009) (-491.297) (-490.029) -- 0:00:42
      262500 -- (-494.248) (-493.880) [-490.597] (-492.038) * (-491.888) (-491.168) (-493.051) [-489.617] -- 0:00:42
      263000 -- (-490.166) [-489.872] (-488.102) (-487.948) * (-488.495) (-489.137) [-488.575] (-491.362) -- 0:00:42
      263500 -- (-490.787) (-492.904) (-492.370) [-489.585] * [-489.202] (-496.067) (-495.912) (-488.893) -- 0:00:41
      264000 -- (-489.330) [-490.834] (-488.843) (-489.478) * (-490.642) [-490.200] (-489.286) (-492.157) -- 0:00:41
      264500 -- [-490.024] (-490.373) (-491.505) (-488.382) * (-491.393) [-489.786] (-491.269) (-489.476) -- 0:00:44
      265000 -- (-491.453) [-489.071] (-491.403) (-491.335) * [-488.316] (-489.926) (-490.634) (-490.623) -- 0:00:44

      Average standard deviation of split frequencies: 0.012499

      265500 -- [-488.387] (-490.327) (-490.370) (-491.896) * [-491.508] (-488.605) (-492.182) (-490.080) -- 0:00:44
      266000 -- (-488.076) (-489.266) [-488.145] (-491.266) * (-488.907) (-488.645) (-491.621) [-490.621] -- 0:00:44
      266500 -- (-489.724) (-491.590) [-488.884] (-490.641) * (-491.072) (-490.126) (-488.320) [-491.240] -- 0:00:44
      267000 -- (-492.743) (-491.620) [-490.542] (-492.397) * (-489.246) (-491.201) [-491.233] (-490.908) -- 0:00:43
      267500 -- [-490.735] (-490.093) (-489.681) (-490.868) * [-487.741] (-489.058) (-490.763) (-488.678) -- 0:00:43
      268000 -- [-488.079] (-488.388) (-493.548) (-488.332) * (-491.784) (-490.150) (-489.416) [-494.510] -- 0:00:43
      268500 -- (-490.871) [-491.086] (-492.916) (-488.628) * [-490.474] (-490.857) (-488.970) (-489.665) -- 0:00:43
      269000 -- (-489.510) (-496.128) [-488.902] (-489.751) * (-489.116) (-492.994) [-488.356] (-497.793) -- 0:00:43
      269500 -- (-495.326) (-492.339) [-490.905] (-488.732) * (-488.378) (-487.836) [-489.136] (-488.101) -- 0:00:43
      270000 -- (-490.086) [-489.863] (-489.090) (-489.580) * (-490.222) (-488.032) (-489.668) [-490.213] -- 0:00:43

      Average standard deviation of split frequencies: 0.012100

      270500 -- (-491.681) (-490.593) (-488.742) [-488.183] * (-488.681) (-487.527) [-488.748] (-488.430) -- 0:00:43
      271000 -- (-489.840) (-489.013) [-487.776] (-496.949) * (-489.876) (-487.927) [-491.080] (-490.605) -- 0:00:43
      271500 -- (-488.880) (-490.191) [-490.158] (-490.582) * (-490.392) (-488.461) (-490.770) [-489.986] -- 0:00:42
      272000 -- (-488.714) (-489.047) (-489.150) [-488.799] * (-488.873) [-488.080] (-490.716) (-490.259) -- 0:00:42
      272500 -- (-491.840) [-488.952] (-491.021) (-491.211) * [-489.429] (-488.750) (-490.530) (-491.481) -- 0:00:42
      273000 -- (-490.597) [-492.055] (-490.117) (-488.856) * (-488.495) [-489.782] (-489.643) (-489.047) -- 0:00:42
      273500 -- (-488.737) (-490.421) (-491.242) [-489.491] * (-488.922) [-487.923] (-492.194) (-491.096) -- 0:00:42
      274000 -- [-488.513] (-488.512) (-496.060) (-488.475) * (-489.386) [-491.298] (-494.248) (-490.006) -- 0:00:42
      274500 -- [-489.917] (-487.823) (-492.879) (-488.657) * (-496.382) (-491.814) (-489.629) [-488.883] -- 0:00:42
      275000 -- (-489.541) (-490.424) [-491.292] (-490.872) * (-493.061) [-488.499] (-488.368) (-491.684) -- 0:00:42

      Average standard deviation of split frequencies: 0.011766

      275500 -- (-490.643) (-489.585) [-493.504] (-488.780) * [-487.821] (-487.900) (-491.598) (-488.673) -- 0:00:42
      276000 -- (-489.474) (-488.060) [-491.452] (-487.851) * (-490.807) (-488.474) [-488.784] (-492.062) -- 0:00:41
      276500 -- (-492.191) (-490.280) (-492.108) [-488.817] * (-492.572) (-490.132) (-491.779) [-488.747] -- 0:00:41
      277000 -- (-490.104) (-489.545) (-490.940) [-489.665] * (-489.315) (-489.200) [-490.470] (-487.755) -- 0:00:41
      277500 -- (-496.343) (-491.231) [-490.918] (-488.691) * (-488.636) (-488.955) [-488.135] (-487.714) -- 0:00:41
      278000 -- [-490.940] (-492.719) (-488.680) (-488.713) * (-490.164) (-488.420) (-490.001) [-488.897] -- 0:00:41
      278500 -- [-488.596] (-489.138) (-489.007) (-494.416) * (-489.321) (-490.294) [-489.845] (-490.973) -- 0:00:41
      279000 -- [-488.292] (-490.590) (-488.478) (-492.148) * (-488.601) (-490.583) [-487.890] (-493.911) -- 0:00:41
      279500 -- (-492.034) (-490.715) [-487.626] (-489.936) * [-491.250] (-488.840) (-487.672) (-488.036) -- 0:00:41
      280000 -- [-490.698] (-490.004) (-491.238) (-488.182) * (-491.088) [-492.402] (-488.802) (-491.550) -- 0:00:41

      Average standard deviation of split frequencies: 0.014056

      280500 -- [-489.118] (-490.463) (-492.431) (-491.814) * [-487.915] (-490.003) (-490.133) (-489.157) -- 0:00:41
      281000 -- (-489.331) (-487.640) [-488.208] (-492.599) * [-489.310] (-488.211) (-490.764) (-491.469) -- 0:00:40
      281500 -- [-487.974] (-487.937) (-489.099) (-490.410) * (-489.403) (-489.884) (-491.588) [-488.082] -- 0:00:43
      282000 -- (-491.694) [-490.107] (-490.263) (-487.905) * (-488.775) (-491.110) [-489.114] (-488.438) -- 0:00:43
      282500 -- (-488.353) (-490.742) [-488.957] (-489.276) * [-488.163] (-488.579) (-488.499) (-493.345) -- 0:00:43
      283000 -- (-489.936) (-489.106) [-490.605] (-487.644) * [-489.510] (-487.597) (-488.978) (-491.362) -- 0:00:43
      283500 -- [-490.575] (-491.816) (-489.446) (-488.899) * (-489.633) [-487.486] (-489.398) (-491.194) -- 0:00:42
      284000 -- (-490.758) [-492.355] (-490.755) (-491.895) * [-488.743] (-488.321) (-490.071) (-488.574) -- 0:00:42
      284500 -- (-491.383) [-491.653] (-487.798) (-491.801) * (-490.713) (-490.949) (-490.804) [-487.878] -- 0:00:42
      285000 -- (-487.816) (-489.804) (-491.470) [-489.735] * (-491.197) (-487.538) (-491.359) [-487.942] -- 0:00:42

      Average standard deviation of split frequencies: 0.013269

      285500 -- (-490.745) [-489.803] (-491.470) (-491.594) * (-491.002) (-490.255) (-488.428) [-491.571] -- 0:00:42
      286000 -- (-488.863) [-489.140] (-489.234) (-491.655) * (-487.957) [-489.314] (-490.459) (-492.587) -- 0:00:42
      286500 -- [-488.400] (-487.948) (-489.901) (-491.765) * (-491.975) (-492.118) [-493.045] (-492.385) -- 0:00:42
      287000 -- (-493.833) (-487.775) [-488.668] (-490.427) * (-492.744) (-488.990) (-490.089) [-488.026] -- 0:00:42
      287500 -- [-495.721] (-492.076) (-489.193) (-490.354) * (-489.906) [-491.266] (-492.075) (-488.647) -- 0:00:42
      288000 -- [-487.697] (-491.113) (-488.920) (-488.712) * (-488.533) [-488.246] (-488.182) (-491.356) -- 0:00:42
      288500 -- (-487.608) [-489.893] (-489.809) (-489.567) * [-487.980] (-488.301) (-490.638) (-491.156) -- 0:00:41
      289000 -- (-490.817) (-489.566) (-488.889) [-489.305] * [-487.782] (-490.219) (-488.898) (-490.357) -- 0:00:41
      289500 -- (-488.410) (-487.860) [-488.815] (-493.880) * [-489.103] (-488.235) (-490.033) (-491.404) -- 0:00:41
      290000 -- (-490.043) [-491.768] (-488.907) (-491.369) * (-496.182) (-494.620) [-489.959] (-490.511) -- 0:00:41

      Average standard deviation of split frequencies: 0.012731

      290500 -- (-490.775) (-489.412) (-490.504) [-488.421] * (-493.360) (-491.457) (-489.461) [-490.360] -- 0:00:41
      291000 -- (-488.271) (-489.057) (-490.927) [-487.835] * [-489.767] (-490.647) (-489.269) (-489.891) -- 0:00:41
      291500 -- (-489.404) [-489.294] (-489.845) (-490.974) * (-489.210) (-490.965) [-490.451] (-495.032) -- 0:00:41
      292000 -- (-489.998) [-489.830] (-488.677) (-490.771) * (-489.602) (-494.562) (-494.623) [-493.840] -- 0:00:41
      292500 -- [-490.913] (-489.457) (-488.647) (-489.015) * [-490.105] (-490.917) (-492.141) (-490.745) -- 0:00:41
      293000 -- (-490.467) (-494.356) [-490.279] (-493.057) * (-489.160) [-491.369] (-491.854) (-490.871) -- 0:00:41
      293500 -- (-488.158) (-493.511) [-490.478] (-493.419) * (-491.186) [-489.580] (-489.240) (-490.195) -- 0:00:40
      294000 -- (-492.351) [-490.252] (-492.441) (-492.674) * [-490.017] (-491.830) (-487.611) (-490.471) -- 0:00:40
      294500 -- (-490.116) (-488.610) (-489.913) [-491.565] * (-490.882) (-488.961) [-489.875] (-488.591) -- 0:00:40
      295000 -- [-489.976] (-494.220) (-490.673) (-489.723) * (-490.053) [-488.811] (-490.702) (-494.863) -- 0:00:40

      Average standard deviation of split frequencies: 0.013183

      295500 -- [-491.712] (-489.958) (-491.265) (-489.326) * (-490.795) [-487.883] (-490.617) (-493.036) -- 0:00:40
      296000 -- [-491.122] (-489.327) (-491.999) (-491.093) * (-488.904) (-491.688) (-489.604) [-490.824] -- 0:00:40
      296500 -- (-491.684) [-488.974] (-488.881) (-490.421) * [-489.149] (-488.908) (-488.819) (-489.979) -- 0:00:40
      297000 -- (-489.605) (-490.844) (-490.919) [-491.875] * (-488.396) (-490.661) (-487.574) [-489.508] -- 0:00:40
      297500 -- (-489.831) (-490.523) (-493.059) [-489.883] * [-488.556] (-488.508) (-488.685) (-492.227) -- 0:00:40
      298000 -- (-489.750) (-489.669) [-489.041] (-490.230) * (-491.480) [-488.610] (-490.949) (-492.143) -- 0:00:40
      298500 -- (-491.042) (-491.769) (-488.420) [-490.128] * (-490.798) (-488.989) (-489.644) [-490.618] -- 0:00:42
      299000 -- (-488.798) (-489.285) [-491.453] (-489.517) * (-491.100) [-490.212] (-487.549) (-490.446) -- 0:00:42
      299500 -- [-487.618] (-496.233) (-491.391) (-488.738) * (-490.566) (-487.681) (-488.248) [-489.424] -- 0:00:42
      300000 -- (-487.941) (-496.485) [-489.063] (-491.442) * (-487.866) (-487.971) (-489.601) [-489.104] -- 0:00:42

      Average standard deviation of split frequencies: 0.013698

      300500 -- [-490.694] (-498.617) (-490.513) (-488.140) * (-489.739) (-488.011) (-489.602) [-493.683] -- 0:00:41
      301000 -- (-490.928) [-489.361] (-490.437) (-488.018) * (-490.009) (-488.683) (-489.023) [-489.421] -- 0:00:41
      301500 -- (-488.408) (-488.804) [-488.541] (-488.682) * (-488.671) (-494.062) (-490.424) [-489.648] -- 0:00:41
      302000 -- (-490.530) [-488.816] (-490.859) (-489.246) * (-488.384) [-490.208] (-487.508) (-491.855) -- 0:00:41
      302500 -- [-488.648] (-490.980) (-489.676) (-488.605) * (-489.338) [-488.160] (-491.096) (-488.880) -- 0:00:41
      303000 -- (-488.623) (-488.604) (-490.236) [-489.164] * (-489.916) (-490.342) [-489.723] (-490.020) -- 0:00:41
      303500 -- [-489.794] (-488.439) (-491.333) (-491.202) * (-491.177) (-490.260) [-488.523] (-489.931) -- 0:00:41
      304000 -- (-488.752) [-489.809] (-488.966) (-489.377) * (-489.163) (-489.683) (-491.074) [-489.540] -- 0:00:41
      304500 -- (-488.550) [-488.302] (-489.399) (-489.274) * [-488.602] (-488.892) (-490.384) (-499.273) -- 0:00:41
      305000 -- (-489.567) (-491.970) [-488.447] (-488.074) * (-493.578) [-489.049] (-489.903) (-495.633) -- 0:00:41

      Average standard deviation of split frequencies: 0.012632

      305500 -- (-490.827) (-495.504) [-489.978] (-488.645) * (-490.369) (-489.202) [-489.957] (-490.827) -- 0:00:40
      306000 -- (-492.710) [-493.838] (-491.378) (-489.571) * (-490.574) (-489.786) (-488.659) [-491.958] -- 0:00:40
      306500 -- (-495.814) [-493.295] (-493.008) (-490.158) * (-491.338) (-489.887) (-488.291) [-491.865] -- 0:00:40
      307000 -- (-492.117) (-490.742) (-490.053) [-489.500] * [-489.846] (-487.779) (-489.184) (-490.243) -- 0:00:40
      307500 -- (-489.510) (-489.945) [-488.572] (-491.118) * (-491.043) [-490.884] (-487.573) (-488.162) -- 0:00:40
      308000 -- (-490.045) [-490.063] (-490.575) (-490.548) * [-488.801] (-490.353) (-489.396) (-492.871) -- 0:00:40
      308500 -- (-489.701) (-490.923) (-488.220) [-489.761] * (-487.570) (-493.654) (-491.799) [-488.996] -- 0:00:40
      309000 -- [-491.018] (-491.512) (-489.780) (-496.856) * [-488.706] (-490.227) (-491.786) (-495.893) -- 0:00:40
      309500 -- (-493.376) [-490.128] (-488.960) (-491.151) * (-494.221) (-491.066) (-493.809) [-489.578] -- 0:00:40
      310000 -- (-487.780) [-494.681] (-489.462) (-490.759) * (-491.826) [-488.544] (-495.161) (-490.624) -- 0:00:40

      Average standard deviation of split frequencies: 0.012139

      310500 -- (-488.490) (-487.982) [-488.220] (-490.374) * (-488.828) [-489.252] (-490.764) (-489.950) -- 0:00:39
      311000 -- (-488.743) (-487.977) (-488.709) [-490.872] * (-492.867) [-487.907] (-491.242) (-488.841) -- 0:00:39
      311500 -- (-488.693) [-490.497] (-488.380) (-488.552) * (-491.545) [-488.021] (-492.750) (-493.052) -- 0:00:39
      312000 -- (-488.354) (-488.269) (-489.155) [-488.845] * (-491.796) [-488.100] (-491.334) (-489.457) -- 0:00:39
      312500 -- (-487.949) [-490.511] (-488.958) (-490.695) * (-489.157) (-489.629) (-487.905) [-489.215] -- 0:00:39
      313000 -- (-492.479) [-489.558] (-489.922) (-495.420) * (-489.921) (-489.513) (-487.941) [-491.965] -- 0:00:39
      313500 -- [-488.997] (-494.623) (-490.751) (-490.121) * (-488.159) (-487.842) (-488.985) [-489.421] -- 0:00:39
      314000 -- (-488.457) (-493.950) [-491.578] (-489.131) * (-491.493) [-491.023] (-490.723) (-488.420) -- 0:00:39
      314500 -- (-490.108) (-491.088) (-489.068) [-488.902] * (-487.841) [-488.046] (-488.796) (-492.038) -- 0:00:39
      315000 -- (-490.038) (-490.063) (-489.199) [-491.042] * (-488.747) [-492.027] (-489.582) (-489.441) -- 0:00:41

      Average standard deviation of split frequencies: 0.011282

      315500 -- (-489.387) (-493.104) (-493.633) [-488.273] * (-491.673) (-488.981) (-488.296) [-488.465] -- 0:00:41
      316000 -- (-491.303) (-491.833) [-488.963] (-488.656) * [-491.802] (-488.558) (-491.831) (-488.641) -- 0:00:41
      316500 -- (-490.607) [-493.020] (-491.684) (-488.347) * (-488.477) (-491.812) [-490.862] (-490.114) -- 0:00:41
      317000 -- (-492.577) (-494.107) [-489.083] (-489.280) * [-488.389] (-490.745) (-492.343) (-497.479) -- 0:00:40
      317500 -- (-496.621) [-489.394] (-488.028) (-488.359) * (-488.315) (-490.407) [-489.346] (-492.305) -- 0:00:40
      318000 -- (-492.868) (-493.679) (-488.308) [-489.198] * (-491.175) (-488.273) [-488.046] (-491.621) -- 0:00:40
      318500 -- (-489.276) (-493.038) (-489.591) [-488.828] * (-489.980) [-489.502] (-493.851) (-488.477) -- 0:00:40
      319000 -- (-487.939) (-489.549) (-489.849) [-489.129] * [-489.802] (-489.381) (-492.672) (-491.631) -- 0:00:40
      319500 -- [-488.502] (-488.323) (-490.566) (-490.064) * (-490.913) (-490.044) [-488.083] (-488.607) -- 0:00:40
      320000 -- (-488.049) (-488.041) (-487.721) [-489.491] * (-490.524) (-487.985) (-489.334) [-490.546] -- 0:00:40

      Average standard deviation of split frequencies: 0.011501

      320500 -- (-488.653) (-487.592) (-489.578) [-489.250] * (-487.958) (-493.535) [-489.108] (-489.663) -- 0:00:40
      321000 -- [-489.664] (-489.525) (-491.515) (-493.163) * [-487.985] (-491.802) (-488.426) (-490.361) -- 0:00:40
      321500 -- [-489.577] (-488.092) (-488.448) (-489.189) * (-489.103) (-491.509) [-491.562] (-492.233) -- 0:00:40
      322000 -- (-488.464) (-491.713) (-488.495) [-489.546] * [-489.120] (-489.543) (-489.087) (-488.820) -- 0:00:40
      322500 -- (-491.960) (-495.743) (-489.347) [-494.362] * (-491.628) [-487.673] (-489.397) (-488.241) -- 0:00:39
      323000 -- (-489.636) (-490.702) [-488.853] (-493.278) * (-489.755) [-489.555] (-488.056) (-490.962) -- 0:00:39
      323500 -- (-489.210) (-491.162) (-493.641) [-490.989] * (-489.154) (-489.374) (-488.515) [-490.630] -- 0:00:39
      324000 -- (-495.369) [-489.381] (-492.153) (-493.146) * (-488.594) (-489.964) [-491.350] (-488.817) -- 0:00:39
      324500 -- (-489.080) [-488.871] (-489.941) (-491.249) * (-489.465) (-489.843) [-493.117] (-491.717) -- 0:00:39
      325000 -- (-495.332) (-488.550) [-487.829] (-490.535) * (-489.771) (-491.211) (-489.552) [-489.307] -- 0:00:39

      Average standard deviation of split frequencies: 0.010773

      325500 -- (-490.006) (-487.829) (-491.658) [-488.676] * (-488.446) (-490.267) [-490.700] (-489.503) -- 0:00:39
      326000 -- (-491.383) (-488.154) [-489.255] (-488.236) * (-490.011) (-488.626) (-491.224) [-489.946] -- 0:00:39
      326500 -- [-489.439] (-488.534) (-489.193) (-488.641) * (-490.053) (-490.096) [-491.083] (-491.504) -- 0:00:39
      327000 -- [-490.081] (-488.878) (-489.273) (-489.780) * (-488.776) [-488.698] (-488.089) (-488.933) -- 0:00:39
      327500 -- (-492.882) (-488.133) (-497.162) [-489.835] * [-488.418] (-492.006) (-491.903) (-490.695) -- 0:00:39
      328000 -- (-490.524) (-489.043) [-489.183] (-488.823) * (-492.009) (-494.962) [-490.132] (-493.246) -- 0:00:38
      328500 -- (-489.784) (-493.164) (-488.653) [-494.640] * [-491.287] (-490.863) (-489.058) (-490.401) -- 0:00:38
      329000 -- [-489.943] (-490.516) (-489.586) (-498.188) * (-489.773) (-488.456) (-488.398) [-488.899] -- 0:00:38
      329500 -- [-491.550] (-488.448) (-492.701) (-488.930) * [-494.459] (-493.679) (-489.310) (-489.692) -- 0:00:38
      330000 -- (-490.355) (-489.850) (-492.219) [-488.015] * [-489.609] (-488.617) (-490.019) (-489.807) -- 0:00:38

      Average standard deviation of split frequencies: 0.011484

      330500 -- [-488.837] (-490.869) (-488.172) (-491.558) * (-488.954) (-488.907) [-489.450] (-492.142) -- 0:00:38
      331000 -- (-488.854) [-490.877] (-488.133) (-490.311) * (-488.142) [-491.753] (-489.157) (-495.713) -- 0:00:40
      331500 -- (-488.474) [-490.847] (-488.570) (-490.058) * (-488.679) (-488.912) [-488.241] (-489.632) -- 0:00:40
      332000 -- (-491.000) [-488.632] (-492.474) (-490.664) * (-489.732) (-490.649) [-490.680] (-488.703) -- 0:00:40
      332500 -- (-490.354) [-489.226] (-490.443) (-488.652) * [-489.300] (-493.202) (-493.693) (-493.173) -- 0:00:40
      333000 -- (-490.950) [-489.490] (-489.633) (-489.585) * [-492.193] (-491.415) (-491.800) (-491.913) -- 0:00:40
      333500 -- (-491.841) [-489.280] (-493.713) (-488.569) * [-490.283] (-490.324) (-488.361) (-488.954) -- 0:00:39
      334000 -- (-491.699) (-488.639) [-490.667] (-489.643) * (-489.594) [-489.257] (-489.088) (-489.154) -- 0:00:39
      334500 -- [-490.248] (-489.354) (-488.911) (-489.340) * (-491.680) (-489.455) [-492.566] (-488.743) -- 0:00:39
      335000 -- (-489.534) (-489.284) [-489.558] (-494.082) * (-492.408) (-493.750) (-491.249) [-491.383] -- 0:00:39

      Average standard deviation of split frequencies: 0.011536

      335500 -- (-489.356) (-489.491) [-487.796] (-497.564) * (-488.531) (-491.291) [-489.572] (-492.905) -- 0:00:39
      336000 -- (-490.500) [-488.072] (-489.204) (-488.913) * (-489.491) (-488.627) (-490.746) [-495.745] -- 0:00:39
      336500 -- (-489.632) (-491.050) [-491.967] (-490.325) * (-488.497) [-489.721] (-491.725) (-491.540) -- 0:00:39
      337000 -- (-491.154) (-489.751) (-489.364) [-490.520] * (-487.659) [-488.689] (-494.320) (-490.888) -- 0:00:39
      337500 -- (-491.445) (-488.899) [-490.944] (-488.438) * [-488.917] (-489.042) (-489.263) (-489.557) -- 0:00:39
      338000 -- (-491.278) (-488.335) [-489.298] (-491.183) * [-489.258] (-492.473) (-493.279) (-488.511) -- 0:00:39
      338500 -- [-488.983] (-492.633) (-492.767) (-489.416) * (-487.947) (-488.511) [-495.940] (-488.470) -- 0:00:39
      339000 -- [-494.602] (-488.658) (-491.128) (-490.174) * [-488.782] (-492.173) (-495.541) (-487.524) -- 0:00:38
      339500 -- (-493.264) [-489.047] (-488.087) (-491.607) * [-489.545] (-491.789) (-491.082) (-490.154) -- 0:00:38
      340000 -- (-491.611) [-489.516] (-490.185) (-488.784) * (-489.647) (-488.008) [-488.188] (-491.708) -- 0:00:38

      Average standard deviation of split frequencies: 0.011916

      340500 -- (-492.047) [-489.973] (-489.541) (-488.861) * [-488.884] (-488.295) (-488.281) (-489.605) -- 0:00:38
      341000 -- (-491.950) [-490.603] (-489.365) (-488.817) * (-489.066) (-487.805) (-490.311) [-491.563] -- 0:00:38
      341500 -- (-490.079) [-495.492] (-489.378) (-489.450) * (-489.342) [-488.608] (-488.157) (-491.658) -- 0:00:38
      342000 -- [-489.200] (-490.614) (-491.137) (-490.304) * (-493.131) (-487.439) (-490.447) [-491.070] -- 0:00:38
      342500 -- (-487.902) (-491.460) (-495.412) [-492.906] * (-488.847) [-488.509] (-488.012) (-489.535) -- 0:00:38
      343000 -- (-492.499) (-491.179) [-491.459] (-490.091) * (-490.704) [-487.869] (-489.488) (-488.579) -- 0:00:38
      343500 -- (-490.594) [-489.486] (-491.989) (-496.610) * (-491.081) [-488.368] (-488.029) (-489.011) -- 0:00:38
      344000 -- (-490.321) (-488.584) (-491.668) [-487.984] * (-491.619) (-490.353) [-487.941] (-489.280) -- 0:00:38
      344500 -- (-492.658) [-490.848] (-487.940) (-488.214) * (-488.635) (-489.338) (-491.592) [-489.643] -- 0:00:38
      345000 -- (-490.329) (-488.188) (-488.972) [-488.242] * (-488.268) (-488.545) [-489.213] (-491.001) -- 0:00:37

      Average standard deviation of split frequencies: 0.010294

      345500 -- [-491.598] (-491.144) (-491.038) (-489.549) * (-489.400) [-489.407] (-488.263) (-491.846) -- 0:00:37
      346000 -- (-492.353) [-489.397] (-490.684) (-490.527) * (-488.639) (-488.043) (-487.977) [-491.156] -- 0:00:37
      346500 -- (-488.213) [-489.124] (-492.561) (-491.037) * (-488.545) [-489.056] (-488.027) (-490.385) -- 0:00:37
      347000 -- (-489.654) (-495.201) (-494.159) [-490.718] * (-488.330) (-493.995) (-488.497) [-489.532] -- 0:00:37
      347500 -- [-491.890] (-490.245) (-493.487) (-488.823) * [-490.200] (-494.549) (-489.369) (-491.187) -- 0:00:37
      348000 -- (-490.001) (-489.398) [-490.194] (-489.619) * (-490.653) (-493.890) [-489.697] (-488.765) -- 0:00:39
      348500 -- (-490.551) (-492.015) (-493.169) [-489.793] * (-489.836) [-488.818] (-490.499) (-493.429) -- 0:00:39
      349000 -- (-488.032) (-488.895) (-493.554) [-487.757] * [-491.569] (-489.581) (-488.719) (-491.435) -- 0:00:39
      349500 -- (-491.062) [-487.852] (-491.078) (-489.248) * (-492.767) (-490.618) [-490.556] (-488.440) -- 0:00:39
      350000 -- (-489.692) [-489.058] (-494.279) (-490.159) * (-487.941) [-490.390] (-488.605) (-489.629) -- 0:00:39

      Average standard deviation of split frequencies: 0.010359

      350500 -- (-489.505) (-487.828) [-488.097] (-489.716) * (-492.676) (-488.377) (-488.656) [-489.364] -- 0:00:38
      351000 -- (-490.159) (-490.971) (-488.305) [-489.619] * (-490.916) (-489.417) [-488.973] (-488.173) -- 0:00:38
      351500 -- (-489.115) (-488.381) (-490.858) [-489.314] * (-491.530) (-491.481) (-489.030) [-492.705] -- 0:00:38
      352000 -- [-490.829] (-488.222) (-491.643) (-490.234) * [-489.743] (-490.615) (-489.557) (-492.501) -- 0:00:38
      352500 -- (-493.599) (-490.883) [-487.970] (-490.151) * [-490.351] (-489.795) (-488.807) (-489.941) -- 0:00:38
      353000 -- (-489.932) [-490.289] (-491.072) (-489.024) * [-490.769] (-490.404) (-489.304) (-489.703) -- 0:00:38
      353500 -- (-493.074) (-496.519) [-489.400] (-488.097) * (-488.554) [-489.382] (-488.307) (-488.480) -- 0:00:38
      354000 -- (-490.662) (-492.078) [-490.045] (-488.708) * [-489.234] (-491.952) (-490.418) (-489.392) -- 0:00:38
      354500 -- (-489.673) (-488.641) (-491.548) [-490.774] * (-492.822) (-491.993) (-489.981) [-493.058] -- 0:00:38
      355000 -- (-490.138) (-490.992) (-489.785) [-489.356] * (-489.669) (-489.713) (-488.622) [-494.059] -- 0:00:38

      Average standard deviation of split frequencies: 0.010438

      355500 -- (-490.983) (-489.515) (-496.379) [-490.795] * (-490.904) (-488.318) (-488.905) [-491.628] -- 0:00:38
      356000 -- (-494.819) (-492.003) (-494.038) [-492.463] * [-488.340] (-489.969) (-488.017) (-491.508) -- 0:00:37
      356500 -- [-489.164] (-490.825) (-492.667) (-488.601) * (-488.337) (-488.883) (-493.570) [-492.337] -- 0:00:37
      357000 -- (-494.678) (-490.854) [-489.603] (-488.829) * [-491.012] (-490.077) (-490.739) (-489.623) -- 0:00:37
      357500 -- (-490.204) (-489.196) (-496.793) [-488.756] * (-487.857) (-494.179) (-489.261) [-488.900] -- 0:00:37
      358000 -- [-490.867] (-491.069) (-489.420) (-491.701) * (-488.407) (-491.711) (-489.093) [-491.201] -- 0:00:37
      358500 -- [-489.778] (-490.594) (-492.124) (-489.442) * (-491.581) [-489.213] (-489.581) (-490.910) -- 0:00:37
      359000 -- (-494.202) (-487.795) [-488.496] (-488.743) * [-493.007] (-492.896) (-493.281) (-488.715) -- 0:00:37
      359500 -- [-496.218] (-489.763) (-491.669) (-489.958) * (-489.556) (-488.407) [-493.326] (-490.036) -- 0:00:37
      360000 -- (-488.884) [-489.158] (-490.184) (-490.842) * (-489.453) (-492.837) (-490.332) [-488.333] -- 0:00:37

      Average standard deviation of split frequencies: 0.009803

      360500 -- (-489.672) [-488.385] (-488.530) (-492.660) * (-493.099) (-494.015) (-489.496) [-492.184] -- 0:00:37
      361000 -- (-489.386) (-488.672) [-488.564] (-490.673) * (-495.021) [-488.506] (-488.420) (-487.778) -- 0:00:37
      361500 -- (-488.511) [-489.649] (-490.324) (-491.056) * [-490.189] (-487.677) (-487.916) (-489.810) -- 0:00:37
      362000 -- (-491.425) [-488.737] (-489.268) (-492.149) * (-490.952) [-488.417] (-490.127) (-491.513) -- 0:00:37
      362500 -- [-491.181] (-490.268) (-491.450) (-491.963) * [-489.342] (-489.064) (-488.680) (-491.442) -- 0:00:36
      363000 -- (-490.858) (-490.289) [-492.307] (-493.638) * (-490.677) [-488.976] (-493.409) (-489.326) -- 0:00:36
      363500 -- (-489.319) (-488.580) (-492.310) [-488.709] * (-490.598) (-489.071) (-490.530) [-490.783] -- 0:00:36
      364000 -- (-488.367) [-489.376] (-489.346) (-488.126) * (-490.441) (-490.075) (-490.128) [-487.918] -- 0:00:36
      364500 -- [-491.479] (-492.981) (-489.430) (-490.006) * (-487.636) (-491.699) [-489.571] (-490.224) -- 0:00:36
      365000 -- (-488.227) (-488.825) (-490.859) [-488.244] * [-490.348] (-492.689) (-493.034) (-493.895) -- 0:00:38

      Average standard deviation of split frequencies: 0.009257

      365500 -- (-487.820) [-492.044] (-493.030) (-488.805) * [-489.424] (-488.668) (-489.569) (-494.816) -- 0:00:38
      366000 -- [-488.469] (-492.645) (-489.635) (-489.330) * [-489.194] (-494.545) (-488.622) (-490.242) -- 0:00:38
      366500 -- (-490.661) (-498.019) [-490.382] (-490.039) * [-488.580] (-493.315) (-492.703) (-490.220) -- 0:00:38
      367000 -- (-489.696) (-488.738) [-492.703] (-489.650) * (-489.425) [-490.588] (-492.960) (-489.190) -- 0:00:37
      367500 -- (-488.541) [-490.356] (-492.825) (-490.775) * (-490.373) (-490.307) (-493.661) [-488.123] -- 0:00:37
      368000 -- (-489.579) (-492.774) (-491.335) [-490.526] * (-490.923) (-488.806) (-490.716) [-492.403] -- 0:00:37
      368500 -- (-490.080) (-488.412) [-488.643] (-493.268) * [-488.951] (-491.777) (-488.483) (-492.527) -- 0:00:37
      369000 -- [-490.278] (-493.449) (-489.303) (-488.504) * (-490.317) (-492.131) (-489.534) [-491.245] -- 0:00:37
      369500 -- (-490.182) [-494.179] (-488.425) (-491.541) * (-488.912) (-490.797) [-489.240] (-489.300) -- 0:00:37
      370000 -- (-490.141) (-489.720) (-487.862) [-489.729] * [-489.247] (-490.346) (-489.772) (-488.766) -- 0:00:37

      Average standard deviation of split frequencies: 0.009114

      370500 -- [-491.356] (-488.582) (-491.692) (-491.834) * [-490.152] (-489.554) (-491.085) (-488.214) -- 0:00:37
      371000 -- (-491.560) (-488.963) [-489.994] (-489.448) * (-488.646) [-487.965] (-494.684) (-493.175) -- 0:00:37
      371500 -- (-491.140) (-491.777) (-490.066) [-487.879] * (-492.822) [-488.978] (-490.171) (-490.323) -- 0:00:37
      372000 -- [-487.628] (-500.092) (-491.488) (-490.821) * (-488.836) [-489.634] (-493.650) (-492.358) -- 0:00:37
      372500 -- (-493.179) (-497.244) (-489.265) [-488.702] * (-488.937) (-490.575) [-489.591] (-489.115) -- 0:00:37
      373000 -- (-490.913) (-493.549) [-487.951] (-488.990) * (-490.456) (-491.171) (-488.780) [-488.976] -- 0:00:36
      373500 -- [-491.251] (-488.519) (-489.653) (-490.556) * (-491.253) [-488.261] (-489.996) (-488.231) -- 0:00:36
      374000 -- (-488.528) (-491.138) (-488.116) [-491.267] * [-490.997] (-490.274) (-487.793) (-489.438) -- 0:00:36
      374500 -- (-490.002) (-489.322) (-488.615) [-489.109] * (-489.921) (-488.948) (-488.383) [-490.353] -- 0:00:36
      375000 -- (-488.620) (-487.738) (-493.107) [-489.575] * [-489.877] (-488.552) (-490.345) (-491.585) -- 0:00:36

      Average standard deviation of split frequencies: 0.007817

      375500 -- [-493.951] (-488.234) (-491.323) (-493.589) * [-493.810] (-489.911) (-492.716) (-489.824) -- 0:00:36
      376000 -- (-490.489) (-489.031) [-488.910] (-491.603) * (-489.120) (-494.173) [-492.441] (-488.184) -- 0:00:36
      376500 -- (-488.059) (-488.089) (-490.427) [-488.494] * (-488.679) (-489.373) [-491.956] (-487.737) -- 0:00:36
      377000 -- (-489.838) (-491.772) (-492.392) [-488.025] * (-489.815) (-491.325) [-491.276] (-489.217) -- 0:00:36
      377500 -- (-488.524) (-492.329) [-488.379] (-490.285) * (-488.705) [-488.923] (-489.767) (-488.620) -- 0:00:36
      378000 -- (-488.960) (-491.032) (-487.534) [-490.956] * [-489.213] (-491.858) (-488.994) (-490.332) -- 0:00:36
      378500 -- (-491.278) [-494.312] (-488.324) (-488.006) * (-489.252) (-492.455) (-489.281) [-488.998] -- 0:00:36
      379000 -- (-489.509) (-494.554) (-490.172) [-490.432] * [-490.749] (-489.758) (-491.278) (-488.486) -- 0:00:36
      379500 -- (-491.428) (-496.495) [-494.536] (-490.733) * [-490.217] (-489.552) (-490.883) (-492.686) -- 0:00:35
      380000 -- (-490.449) [-489.163] (-489.960) (-489.492) * [-488.076] (-487.842) (-492.762) (-489.757) -- 0:00:35

      Average standard deviation of split frequencies: 0.008304

      380500 -- (-488.440) [-493.100] (-488.775) (-488.208) * (-489.169) (-490.313) (-489.687) [-490.877] -- 0:00:35
      381000 -- [-491.617] (-492.173) (-488.449) (-490.392) * (-491.005) [-491.211] (-490.220) (-489.836) -- 0:00:35
      381500 -- (-490.148) (-492.403) [-489.170] (-490.967) * [-491.215] (-493.774) (-489.984) (-488.933) -- 0:00:37
      382000 -- (-488.590) (-488.297) [-492.421] (-489.177) * (-487.790) (-489.169) (-488.611) [-489.883] -- 0:00:37
      382500 -- (-490.086) [-489.390] (-488.161) (-489.685) * [-488.404] (-489.764) (-489.565) (-491.062) -- 0:00:37
      383000 -- (-490.151) (-488.861) [-490.580] (-490.727) * [-488.163] (-489.036) (-489.505) (-489.416) -- 0:00:37
      383500 -- (-491.698) (-489.388) (-489.192) [-488.129] * (-489.347) (-488.551) [-487.796] (-489.249) -- 0:00:36
      384000 -- (-489.640) (-487.959) [-490.558] (-489.687) * (-487.958) (-487.729) [-488.914] (-490.071) -- 0:00:36
      384500 -- [-493.780] (-488.526) (-488.740) (-488.291) * (-490.013) (-494.807) [-490.686] (-488.264) -- 0:00:36
      385000 -- (-488.952) [-492.088] (-491.607) (-492.613) * (-489.442) [-488.698] (-490.617) (-491.728) -- 0:00:36

      Average standard deviation of split frequencies: 0.007759

      385500 -- [-490.824] (-493.108) (-493.604) (-490.864) * (-491.671) (-493.759) [-488.125] (-488.329) -- 0:00:36
      386000 -- (-489.071) [-490.413] (-491.583) (-496.968) * (-490.097) (-490.788) (-488.648) [-487.888] -- 0:00:36
      386500 -- (-487.626) (-495.508) [-488.359] (-493.408) * [-488.862] (-489.227) (-490.174) (-491.739) -- 0:00:36
      387000 -- (-488.315) (-488.008) (-488.118) [-488.639] * (-489.653) (-491.590) [-490.736] (-490.866) -- 0:00:36
      387500 -- [-489.680] (-491.531) (-492.829) (-488.961) * (-491.373) (-489.688) [-489.624] (-490.130) -- 0:00:36
      388000 -- [-488.026] (-493.683) (-488.955) (-489.560) * (-490.212) [-487.858] (-487.717) (-490.229) -- 0:00:36
      388500 -- [-491.859] (-496.080) (-488.096) (-488.126) * [-490.545] (-491.348) (-489.508) (-493.221) -- 0:00:36
      389000 -- (-490.933) (-491.940) [-489.087] (-492.660) * (-489.593) (-489.166) [-488.047] (-487.779) -- 0:00:36
      389500 -- (-489.325) (-488.030) [-490.385] (-493.536) * (-489.637) (-493.558) (-488.000) [-492.662] -- 0:00:36
      390000 -- (-491.608) (-487.620) [-493.010] (-489.270) * [-488.628] (-492.167) (-490.729) (-489.964) -- 0:00:35

      Average standard deviation of split frequencies: 0.007617

      390500 -- (-493.140) (-488.922) (-493.009) [-488.196] * (-489.692) (-488.975) (-489.980) [-490.723] -- 0:00:35
      391000 -- [-487.891] (-488.087) (-496.083) (-492.032) * [-489.152] (-490.970) (-487.717) (-488.693) -- 0:00:35
      391500 -- (-489.473) (-493.093) (-487.671) [-488.614] * [-489.635] (-496.404) (-490.364) (-488.913) -- 0:00:35
      392000 -- (-491.010) [-491.234] (-490.356) (-491.922) * (-491.543) [-490.939] (-491.739) (-489.835) -- 0:00:35
      392500 -- (-489.649) (-489.202) [-489.276] (-490.399) * (-488.015) (-488.587) (-492.179) [-489.971] -- 0:00:35
      393000 -- (-491.990) (-489.966) [-488.855] (-492.063) * (-489.646) (-489.175) (-488.580) [-489.941] -- 0:00:35
      393500 -- (-491.345) (-489.478) [-491.083] (-488.539) * (-489.138) (-495.090) (-488.574) [-490.254] -- 0:00:35
      394000 -- (-488.209) (-490.533) [-488.618] (-490.368) * [-488.816] (-490.756) (-487.429) (-488.119) -- 0:00:35
      394500 -- (-495.595) (-492.156) [-491.196] (-488.314) * (-490.008) (-489.559) (-492.333) [-488.798] -- 0:00:35
      395000 -- [-488.792] (-491.358) (-491.076) (-488.998) * [-490.427] (-491.542) (-491.888) (-494.586) -- 0:00:35

      Average standard deviation of split frequencies: 0.008556

      395500 -- (-490.849) (-492.954) [-488.384] (-487.641) * (-490.549) [-488.302] (-492.339) (-494.807) -- 0:00:35
      396000 -- (-490.277) (-489.467) [-490.225] (-488.754) * (-491.039) (-490.215) [-492.002] (-492.018) -- 0:00:35
      396500 -- (-488.145) [-492.958] (-489.973) (-489.764) * (-489.472) (-492.349) [-490.203] (-492.463) -- 0:00:35
      397000 -- (-487.932) [-497.120] (-490.276) (-488.087) * (-488.126) (-487.939) (-490.932) [-489.494] -- 0:00:34
      397500 -- (-495.509) (-493.344) [-488.421] (-488.423) * [-488.713] (-488.011) (-489.449) (-489.751) -- 0:00:34
      398000 -- (-490.716) (-490.327) [-489.336] (-489.890) * [-488.966] (-487.709) (-488.023) (-493.689) -- 0:00:34
      398500 -- [-487.932] (-490.104) (-489.926) (-493.094) * [-490.555] (-493.245) (-490.394) (-488.405) -- 0:00:36
      399000 -- (-491.011) (-489.905) (-489.406) [-488.539] * (-488.139) (-491.203) [-488.787] (-488.324) -- 0:00:36
      399500 -- (-489.898) (-492.618) [-494.723] (-488.874) * [-491.291] (-487.511) (-497.505) (-488.753) -- 0:00:36
      400000 -- (-487.940) (-492.684) [-488.902] (-490.991) * (-489.498) (-495.274) (-493.582) [-487.430] -- 0:00:36

      Average standard deviation of split frequencies: 0.008582

      400500 -- (-488.690) [-489.508] (-490.085) (-488.331) * (-489.557) (-488.010) [-489.084] (-490.807) -- 0:00:35
      401000 -- (-488.677) (-488.469) (-490.720) [-489.229] * (-493.438) (-488.405) (-491.174) [-491.977] -- 0:00:35
      401500 -- (-488.666) [-488.964] (-490.685) (-492.544) * (-489.803) (-490.487) [-491.361] (-490.030) -- 0:00:35
      402000 -- (-488.942) (-489.789) [-488.471] (-487.852) * [-491.815] (-489.050) (-491.286) (-491.050) -- 0:00:35
      402500 -- (-489.055) (-488.900) (-489.908) [-489.085] * [-488.407] (-489.699) (-489.667) (-492.844) -- 0:00:35
      403000 -- (-488.188) (-491.494) (-488.489) [-489.425] * (-488.475) (-491.900) [-488.565] (-490.458) -- 0:00:35
      403500 -- [-488.464] (-491.415) (-489.373) (-490.695) * (-490.514) (-491.128) [-488.099] (-489.049) -- 0:00:35
      404000 -- (-489.086) (-488.758) [-488.593] (-491.004) * [-488.611] (-488.964) (-494.568) (-489.139) -- 0:00:35
      404500 -- (-489.802) (-489.001) (-488.229) [-490.879] * (-488.688) (-488.524) [-490.773] (-489.522) -- 0:00:35
      405000 -- [-490.025] (-487.628) (-489.107) (-491.596) * (-488.253) (-489.190) (-487.581) [-489.178] -- 0:00:35

      Average standard deviation of split frequencies: 0.009144

      405500 -- (-490.196) [-489.508] (-493.490) (-490.474) * (-489.368) (-492.135) (-492.380) [-489.457] -- 0:00:35
      406000 -- (-491.181) (-492.315) (-492.726) [-490.011] * (-489.783) [-491.949] (-490.668) (-488.986) -- 0:00:35
      406500 -- (-489.815) (-489.586) (-490.665) [-489.780] * (-491.145) [-492.007] (-489.925) (-489.827) -- 0:00:35
      407000 -- (-492.632) [-490.982] (-490.393) (-488.443) * (-489.133) [-489.065] (-488.476) (-488.582) -- 0:00:34
      407500 -- (-492.944) (-490.946) (-492.659) [-490.126] * (-489.526) [-490.239] (-491.516) (-488.837) -- 0:00:34
      408000 -- (-492.092) [-488.605] (-490.492) (-491.383) * [-489.087] (-488.644) (-488.101) (-494.034) -- 0:00:34
      408500 -- [-489.145] (-488.542) (-488.885) (-487.594) * (-487.528) (-488.175) (-489.332) [-491.634] -- 0:00:34
      409000 -- (-488.870) (-490.655) (-490.750) [-487.944] * (-488.996) (-493.142) (-490.732) [-489.353] -- 0:00:34
      409500 -- (-487.949) (-488.217) [-490.459] (-489.964) * (-488.878) [-491.688] (-491.577) (-488.001) -- 0:00:34
      410000 -- (-491.565) (-489.393) (-491.146) [-488.233] * (-492.593) (-490.481) [-490.280] (-489.292) -- 0:00:34

      Average standard deviation of split frequencies: 0.008913

      410500 -- (-490.765) [-491.464] (-491.425) (-489.940) * (-492.392) (-491.912) (-491.214) [-489.212] -- 0:00:34
      411000 -- (-491.124) (-493.509) (-488.629) [-488.456] * (-491.789) (-488.409) (-489.523) [-488.832] -- 0:00:34
      411500 -- (-492.164) (-492.366) (-489.010) [-489.011] * (-496.299) [-488.073] (-491.275) (-487.735) -- 0:00:34
      412000 -- (-492.799) [-492.561] (-488.638) (-489.288) * [-490.779] (-487.956) (-490.042) (-488.750) -- 0:00:34
      412500 -- (-487.869) [-492.593] (-490.803) (-493.606) * (-490.105) (-489.944) (-490.489) [-491.813] -- 0:00:34
      413000 -- (-488.079) (-488.347) [-490.327] (-490.055) * (-494.352) (-490.357) (-491.105) [-494.888] -- 0:00:34
      413500 -- (-490.374) (-489.199) [-489.719] (-489.701) * (-489.926) (-492.888) (-490.802) [-488.725] -- 0:00:34
      414000 -- (-492.736) [-491.886] (-490.070) (-492.724) * (-490.318) (-490.575) [-490.721] (-488.165) -- 0:00:33
      414500 -- (-494.472) (-489.098) (-492.181) [-490.005] * (-490.767) (-490.150) (-490.907) [-489.056] -- 0:00:33
      415000 -- [-490.014] (-488.199) (-488.054) (-490.483) * (-490.332) (-489.927) [-488.355] (-491.101) -- 0:00:33

      Average standard deviation of split frequencies: 0.008853

      415500 -- (-495.366) (-489.801) (-491.045) [-491.484] * (-489.976) (-489.853) [-488.799] (-492.145) -- 0:00:35
      416000 -- (-492.089) (-489.888) (-490.882) [-491.913] * (-494.001) (-492.259) [-488.471] (-488.628) -- 0:00:35
      416500 -- (-490.663) (-493.992) (-492.069) [-488.938] * (-490.757) (-491.528) (-490.927) [-490.015] -- 0:00:35
      417000 -- (-488.226) (-488.852) [-488.674] (-488.971) * (-488.993) [-489.864] (-489.712) (-491.568) -- 0:00:34
      417500 -- (-488.324) (-489.039) [-489.709] (-489.250) * [-488.148] (-490.640) (-489.128) (-491.287) -- 0:00:34
      418000 -- (-490.600) [-489.537] (-494.673) (-495.682) * (-489.326) (-489.616) (-488.797) [-490.471] -- 0:00:34
      418500 -- (-488.462) (-490.592) (-491.015) [-491.784] * (-487.885) [-491.366] (-489.174) (-491.384) -- 0:00:34
      419000 -- (-491.720) (-493.034) [-492.832] (-493.124) * [-487.859] (-492.828) (-489.296) (-490.349) -- 0:00:34
      419500 -- [-489.399] (-491.465) (-493.114) (-491.639) * (-489.260) (-491.156) (-493.246) [-489.464] -- 0:00:34
      420000 -- [-488.724] (-490.224) (-491.766) (-488.961) * (-489.260) (-489.532) (-488.136) [-492.308] -- 0:00:34

      Average standard deviation of split frequencies: 0.008755

      420500 -- [-494.380] (-488.902) (-489.616) (-488.674) * (-489.669) [-489.225] (-491.480) (-494.250) -- 0:00:34
      421000 -- (-496.434) [-492.329] (-489.196) (-489.106) * [-488.220] (-490.174) (-491.386) (-492.076) -- 0:00:34
      421500 -- [-488.951] (-495.123) (-489.041) (-488.179) * (-491.664) [-488.251] (-489.766) (-493.329) -- 0:00:34
      422000 -- (-487.967) [-491.658] (-489.172) (-491.110) * (-489.344) (-488.692) (-494.525) [-488.909] -- 0:00:34
      422500 -- [-490.429] (-490.659) (-488.188) (-488.939) * (-488.042) [-490.781] (-491.686) (-489.801) -- 0:00:34
      423000 -- (-489.474) (-490.296) [-489.217] (-489.602) * [-488.110] (-490.548) (-491.944) (-487.873) -- 0:00:34
      423500 -- (-490.059) (-488.745) [-488.192] (-489.416) * [-488.804] (-489.101) (-489.429) (-490.215) -- 0:00:34
      424000 -- (-488.662) (-489.557) [-488.523] (-489.282) * (-488.797) [-489.588] (-492.065) (-488.744) -- 0:00:33
      424500 -- (-492.399) (-488.392) [-489.660] (-491.175) * (-488.985) (-489.795) (-487.596) [-489.657] -- 0:00:33
      425000 -- [-488.847] (-488.272) (-490.063) (-493.648) * (-493.070) (-489.764) [-488.738] (-488.294) -- 0:00:33

      Average standard deviation of split frequencies: 0.008784

      425500 -- (-490.814) (-488.847) (-494.643) [-488.863] * [-489.238] (-488.892) (-491.337) (-495.873) -- 0:00:33
      426000 -- (-489.608) [-490.225] (-489.028) (-487.862) * (-489.320) [-490.355] (-490.473) (-491.868) -- 0:00:33
      426500 -- (-487.811) [-490.671] (-490.974) (-489.993) * (-489.713) (-489.184) [-489.857] (-493.628) -- 0:00:33
      427000 -- (-488.643) (-491.386) [-489.134] (-489.660) * [-488.692] (-490.880) (-490.362) (-492.749) -- 0:00:33
      427500 -- [-487.303] (-489.922) (-489.347) (-496.600) * (-488.260) [-489.727] (-487.808) (-488.358) -- 0:00:33
      428000 -- (-488.539) [-489.097] (-494.016) (-490.433) * (-488.612) (-489.309) [-487.651] (-491.758) -- 0:00:33
      428500 -- (-495.430) (-489.344) [-489.766] (-489.759) * (-489.520) [-489.467] (-493.673) (-489.036) -- 0:00:33
      429000 -- (-493.238) (-490.682) [-492.031] (-489.410) * (-490.715) (-489.688) [-489.992] (-491.823) -- 0:00:33
      429500 -- (-491.414) (-488.407) (-492.615) [-489.734] * (-492.021) (-489.088) [-489.399] (-492.782) -- 0:00:33
      430000 -- (-490.822) (-490.064) [-491.827] (-489.491) * [-490.644] (-492.706) (-492.587) (-489.792) -- 0:00:33

      Average standard deviation of split frequencies: 0.008894

      430500 -- (-489.936) (-492.844) (-492.092) [-488.024] * (-492.350) (-490.308) [-490.561] (-492.467) -- 0:00:33
      431000 -- (-488.463) [-493.341] (-488.213) (-488.665) * (-493.266) (-491.155) [-490.477] (-491.296) -- 0:00:33
      431500 -- [-489.892] (-489.193) (-488.158) (-491.031) * (-488.822) [-487.730] (-491.620) (-491.000) -- 0:00:32
      432000 -- (-491.716) (-488.534) [-488.736] (-488.872) * (-489.687) (-492.915) (-489.238) [-490.173] -- 0:00:32
      432500 -- (-490.615) (-488.081) (-489.570) [-488.494] * (-489.616) (-489.896) (-489.502) [-488.024] -- 0:00:34
      433000 -- (-490.799) [-491.856] (-489.897) (-488.375) * (-488.374) (-488.005) [-491.494] (-493.635) -- 0:00:34
      433500 -- [-488.687] (-490.200) (-489.458) (-489.767) * (-491.302) [-489.955] (-490.903) (-494.528) -- 0:00:33
      434000 -- (-491.705) (-488.735) [-490.595] (-490.609) * [-493.547] (-488.807) (-497.342) (-491.096) -- 0:00:33
      434500 -- (-491.608) (-490.066) [-488.275] (-489.684) * (-488.462) (-490.633) [-488.117] (-491.348) -- 0:00:33
      435000 -- (-490.912) [-490.133] (-489.044) (-490.635) * (-490.792) (-490.101) [-487.784] (-488.905) -- 0:00:33

      Average standard deviation of split frequencies: 0.009731

      435500 -- [-492.372] (-491.528) (-489.731) (-490.511) * (-487.994) [-488.799] (-488.027) (-488.544) -- 0:00:33
      436000 -- (-488.725) (-491.788) (-488.792) [-489.282] * (-488.551) (-488.275) (-489.112) [-492.512] -- 0:00:33
      436500 -- (-489.546) (-489.341) [-491.341] (-492.212) * [-488.728] (-488.809) (-491.214) (-489.567) -- 0:00:33
      437000 -- (-488.792) [-489.924] (-488.291) (-491.170) * (-490.197) (-489.840) [-489.412] (-488.099) -- 0:00:33
      437500 -- (-490.621) (-488.872) (-490.145) [-489.876] * (-488.506) (-490.741) [-490.101] (-490.731) -- 0:00:33
      438000 -- (-491.609) [-489.183] (-488.495) (-488.708) * [-491.660] (-493.295) (-490.735) (-491.902) -- 0:00:33
      438500 -- (-489.835) (-490.473) (-491.307) [-491.010] * (-493.435) (-490.342) (-487.694) [-488.123] -- 0:00:33
      439000 -- [-489.299] (-490.419) (-489.114) (-489.186) * (-490.181) (-496.951) [-491.093] (-487.482) -- 0:00:33
      439500 -- (-490.631) [-488.728] (-491.463) (-490.536) * [-492.168] (-492.697) (-492.132) (-488.339) -- 0:00:33
      440000 -- [-487.493] (-490.442) (-489.678) (-490.173) * (-490.913) (-490.372) (-491.199) [-491.089] -- 0:00:33

      Average standard deviation of split frequencies: 0.010029

      440500 -- (-489.808) (-490.284) [-487.745] (-490.089) * (-487.615) [-491.348] (-488.482) (-488.531) -- 0:00:33
      441000 -- (-490.364) [-487.853] (-488.979) (-488.836) * (-488.610) (-490.641) [-488.755] (-489.160) -- 0:00:32
      441500 -- (-491.217) (-489.083) [-487.959] (-488.701) * [-489.485] (-488.606) (-489.212) (-489.683) -- 0:00:32
      442000 -- (-491.376) [-489.764] (-489.209) (-489.284) * (-490.989) (-487.917) [-492.118] (-491.233) -- 0:00:32
      442500 -- (-491.494) [-489.057] (-489.001) (-488.892) * (-491.328) (-487.509) [-492.038] (-492.059) -- 0:00:32
      443000 -- (-492.873) (-491.284) [-488.217] (-489.503) * (-491.719) (-489.233) [-491.858] (-489.423) -- 0:00:32
      443500 -- [-493.549] (-490.698) (-490.237) (-489.103) * (-494.264) [-490.004] (-493.182) (-492.822) -- 0:00:32
      444000 -- (-495.754) (-490.680) (-488.457) [-488.501] * [-489.425] (-494.185) (-492.195) (-492.916) -- 0:00:32
      444500 -- (-488.405) (-489.699) [-489.308] (-489.842) * (-490.685) (-489.776) [-489.423] (-488.730) -- 0:00:32
      445000 -- (-490.055) [-489.540] (-491.507) (-489.793) * (-489.651) (-490.400) (-490.298) [-493.257] -- 0:00:32

      Average standard deviation of split frequencies: 0.009843

      445500 -- (-489.462) [-490.642] (-489.073) (-495.696) * [-490.829] (-487.915) (-488.877) (-495.199) -- 0:00:32
      446000 -- (-489.511) (-487.646) (-490.879) [-489.441] * (-490.418) (-488.579) (-488.818) [-488.590] -- 0:00:32
      446500 -- (-490.258) (-488.115) (-491.002) [-489.745] * (-488.453) [-490.139] (-488.980) (-488.465) -- 0:00:32
      447000 -- (-489.170) [-490.009] (-490.045) (-489.954) * (-487.717) [-489.736] (-490.719) (-487.598) -- 0:00:32
      447500 -- (-491.898) [-490.848] (-488.768) (-488.598) * [-488.455] (-489.072) (-489.460) (-489.546) -- 0:00:32
      448000 -- (-490.383) (-491.028) [-489.027] (-490.862) * (-492.259) (-491.600) (-493.185) [-491.292] -- 0:00:32
      448500 -- [-489.678] (-491.446) (-491.688) (-488.470) * (-490.129) (-493.510) [-489.170] (-493.286) -- 0:00:31
      449000 -- [-489.568] (-489.638) (-488.964) (-487.977) * (-490.490) (-489.893) [-487.660] (-489.268) -- 0:00:31
      449500 -- [-488.155] (-493.234) (-489.377) (-487.576) * (-490.501) [-489.156] (-488.254) (-490.958) -- 0:00:33
      450000 -- (-490.187) [-495.533] (-489.273) (-490.223) * (-491.434) (-491.043) (-491.768) [-493.903] -- 0:00:33

      Average standard deviation of split frequencies: 0.009741

      450500 -- (-492.188) (-490.863) [-489.449] (-488.792) * (-488.356) [-490.498] (-491.812) (-489.733) -- 0:00:32
      451000 -- (-493.720) [-488.358] (-490.546) (-489.289) * [-489.054] (-491.053) (-490.015) (-491.743) -- 0:00:32
      451500 -- (-491.146) [-491.548] (-488.989) (-492.317) * (-488.371) (-488.011) [-489.888] (-490.163) -- 0:00:32
      452000 -- [-489.147] (-487.532) (-489.892) (-490.701) * (-488.263) (-487.746) [-488.053] (-488.768) -- 0:00:32
      452500 -- [-490.172] (-491.020) (-492.539) (-488.973) * (-488.667) (-491.331) (-488.497) [-488.182] -- 0:00:32
      453000 -- (-490.049) (-488.263) [-489.788] (-491.815) * (-487.823) (-488.264) [-492.480] (-491.704) -- 0:00:32
      453500 -- (-488.655) (-490.924) (-488.775) [-489.751] * (-490.009) [-488.923] (-492.149) (-488.100) -- 0:00:32
      454000 -- (-489.664) (-489.558) [-489.709] (-488.908) * (-491.599) [-488.462] (-490.604) (-490.938) -- 0:00:32
      454500 -- (-490.304) (-488.952) [-489.411] (-488.439) * (-491.530) (-489.759) [-490.489] (-490.542) -- 0:00:32
      455000 -- [-488.517] (-491.315) (-493.059) (-487.879) * (-488.855) (-488.553) [-490.117] (-488.901) -- 0:00:32

      Average standard deviation of split frequencies: 0.009821

      455500 -- (-490.468) (-491.786) (-489.483) [-488.788] * [-488.067] (-489.125) (-488.236) (-489.579) -- 0:00:32
      456000 -- (-491.130) (-489.699) (-489.272) [-488.800] * (-489.220) (-488.997) [-488.737] (-492.330) -- 0:00:32
      456500 -- [-491.688] (-489.574) (-488.950) (-487.831) * (-488.628) (-493.037) [-491.650] (-491.999) -- 0:00:32
      457000 -- [-488.346] (-489.718) (-489.010) (-490.186) * (-488.550) (-489.526) (-487.806) [-490.377] -- 0:00:32
      457500 -- [-489.321] (-488.920) (-490.839) (-490.341) * [-490.874] (-491.154) (-488.576) (-494.400) -- 0:00:32
      458000 -- (-488.456) [-489.047] (-489.104) (-490.414) * [-492.080] (-493.675) (-489.547) (-490.514) -- 0:00:31
      458500 -- (-488.569) [-493.941] (-491.473) (-487.506) * (-493.838) [-490.310] (-487.803) (-489.156) -- 0:00:31
      459000 -- (-489.430) (-491.371) (-492.281) [-489.556] * [-488.811] (-489.778) (-489.721) (-488.065) -- 0:00:31
      459500 -- (-488.946) (-491.592) (-490.578) [-489.564] * (-488.072) [-488.712] (-492.108) (-489.485) -- 0:00:31
      460000 -- [-488.270] (-493.236) (-491.369) (-489.961) * [-488.530] (-488.794) (-489.401) (-490.339) -- 0:00:31

      Average standard deviation of split frequencies: 0.010297

      460500 -- [-487.648] (-490.770) (-502.269) (-490.518) * (-492.293) (-489.306) (-492.265) [-489.204] -- 0:00:31
      461000 -- (-488.777) (-489.448) [-488.723] (-490.471) * (-489.622) (-490.524) (-492.059) [-488.013] -- 0:00:31
      461500 -- [-488.974] (-489.961) (-489.968) (-489.481) * (-489.707) (-488.667) [-491.446] (-489.762) -- 0:00:31
      462000 -- (-492.685) (-490.689) [-489.813] (-492.945) * (-489.499) [-488.006] (-493.581) (-488.178) -- 0:00:31
      462500 -- (-493.419) [-488.540] (-488.660) (-489.538) * (-489.697) [-489.997] (-488.342) (-489.690) -- 0:00:31
      463000 -- [-490.252] (-491.010) (-488.893) (-492.203) * (-488.643) [-489.577] (-489.987) (-488.871) -- 0:00:31
      463500 -- (-489.100) (-490.862) (-491.195) [-488.324] * (-489.595) [-489.942] (-488.973) (-488.252) -- 0:00:31
      464000 -- (-489.888) [-489.366] (-489.784) (-489.723) * (-492.676) (-489.569) [-488.597] (-490.567) -- 0:00:31
      464500 -- (-488.421) (-489.398) [-489.135] (-490.286) * (-489.329) [-491.499] (-491.922) (-493.260) -- 0:00:31
      465000 -- (-487.339) (-488.766) [-494.008] (-490.679) * [-489.136] (-493.425) (-488.805) (-489.492) -- 0:00:31

      Average standard deviation of split frequencies: 0.010432

      465500 -- (-487.649) (-488.612) (-490.306) [-489.405] * (-490.369) (-490.979) (-493.863) [-489.770] -- 0:00:31
      466000 -- (-488.806) [-488.811] (-490.633) (-488.725) * [-491.543] (-492.683) (-489.833) (-490.703) -- 0:00:32
      466500 -- (-488.707) (-491.274) [-488.803] (-490.076) * [-490.578] (-489.180) (-488.478) (-489.396) -- 0:00:32
      467000 -- (-487.724) (-490.742) [-497.775] (-489.274) * (-492.441) (-490.812) [-488.155] (-489.477) -- 0:00:31
      467500 -- (-490.305) [-489.999] (-489.285) (-489.042) * (-489.952) (-490.237) (-490.888) [-488.970] -- 0:00:31
      468000 -- [-487.763] (-492.480) (-490.930) (-487.835) * (-489.641) (-489.173) [-489.963] (-490.411) -- 0:00:31
      468500 -- [-488.290] (-491.690) (-492.097) (-488.584) * [-491.600] (-488.052) (-489.022) (-492.603) -- 0:00:31
      469000 -- (-488.669) (-490.718) [-493.550] (-488.498) * [-488.181] (-490.009) (-492.060) (-489.516) -- 0:00:31
      469500 -- (-490.599) (-489.357) (-491.830) [-491.307] * (-488.867) (-493.031) [-489.516] (-487.962) -- 0:00:31
      470000 -- (-493.362) (-493.265) (-488.121) [-489.126] * (-492.648) [-489.206] (-489.046) (-489.711) -- 0:00:31

      Average standard deviation of split frequencies: 0.010329

      470500 -- (-494.425) (-489.675) [-491.199] (-489.378) * (-491.442) (-490.106) [-487.352] (-491.501) -- 0:00:31
      471000 -- (-489.464) (-489.769) [-491.360] (-490.512) * (-488.683) (-488.256) (-488.556) [-490.389] -- 0:00:31
      471500 -- (-488.828) (-490.738) (-488.636) [-489.346] * (-494.439) (-488.250) (-487.887) [-489.800] -- 0:00:31
      472000 -- (-490.669) [-489.313] (-490.765) (-489.248) * (-487.990) [-487.931] (-489.080) (-492.737) -- 0:00:31
      472500 -- (-487.696) (-489.888) (-488.381) [-493.196] * (-488.162) (-496.015) (-489.614) [-493.540] -- 0:00:31
      473000 -- (-489.895) (-488.562) (-490.300) [-489.217] * (-488.508) (-489.889) (-488.614) [-487.449] -- 0:00:31
      473500 -- (-489.157) [-490.411] (-490.382) (-489.164) * [-489.061] (-489.594) (-488.355) (-492.801) -- 0:00:31
      474000 -- (-489.893) (-489.840) [-488.990] (-490.400) * (-488.506) [-489.090] (-489.677) (-490.413) -- 0:00:31
      474500 -- (-490.310) (-491.027) [-488.913] (-490.791) * [-488.597] (-489.403) (-489.578) (-490.108) -- 0:00:31
      475000 -- (-489.435) [-487.881] (-490.879) (-489.748) * [-489.641] (-490.919) (-488.953) (-488.776) -- 0:00:30

      Average standard deviation of split frequencies: 0.010399

      475500 -- [-489.214] (-489.376) (-489.576) (-488.315) * (-497.193) [-490.934] (-491.637) (-489.373) -- 0:00:30
      476000 -- (-488.304) (-490.937) (-488.423) [-488.850] * (-494.781) (-491.137) (-491.988) [-488.988] -- 0:00:30
      476500 -- (-488.512) (-490.557) (-487.918) [-488.627] * (-492.740) (-494.544) [-488.843] (-489.826) -- 0:00:30
      477000 -- [-489.651] (-494.309) (-489.227) (-489.844) * (-488.384) (-495.722) [-489.018] (-494.407) -- 0:00:30
      477500 -- (-491.079) (-489.648) (-492.258) [-490.198] * [-489.825] (-495.544) (-492.660) (-490.902) -- 0:00:30
      478000 -- [-490.498] (-490.150) (-491.061) (-489.719) * (-492.278) (-489.595) [-490.107] (-489.766) -- 0:00:30
      478500 -- (-491.386) (-490.051) [-489.173] (-490.333) * [-489.676] (-493.303) (-489.206) (-489.868) -- 0:00:30
      479000 -- (-488.675) [-488.460] (-490.556) (-488.544) * (-489.067) (-489.274) [-488.525] (-490.476) -- 0:00:30
      479500 -- (-487.348) [-488.283] (-490.946) (-491.935) * (-493.603) (-488.415) (-487.702) [-489.515] -- 0:00:30
      480000 -- [-489.256] (-491.434) (-489.909) (-488.620) * (-488.158) [-488.292] (-491.511) (-489.966) -- 0:00:30

      Average standard deviation of split frequencies: 0.010420

      480500 -- (-488.657) [-490.728] (-489.092) (-492.618) * (-490.228) (-489.479) [-491.288] (-490.169) -- 0:00:30
      481000 -- (-490.137) [-488.928] (-488.957) (-488.045) * (-487.496) (-489.193) (-491.991) [-491.375] -- 0:00:30
      481500 -- (-490.326) (-489.372) (-489.300) [-487.870] * (-492.274) (-489.599) [-490.512] (-487.949) -- 0:00:30
      482000 -- [-489.618] (-489.227) (-491.442) (-488.055) * [-490.755] (-490.227) (-488.348) (-496.886) -- 0:00:30
      482500 -- [-488.328] (-487.938) (-489.099) (-489.894) * (-491.972) (-493.618) (-489.395) [-489.450] -- 0:00:30
      483000 -- (-489.193) (-490.443) [-490.125] (-489.394) * (-492.898) [-492.269] (-487.674) (-488.133) -- 0:00:31
      483500 -- [-490.998] (-487.607) (-489.417) (-488.168) * (-492.549) (-498.246) [-489.185] (-490.376) -- 0:00:30
      484000 -- [-492.315] (-489.040) (-489.884) (-492.211) * (-488.503) (-489.919) [-488.989] (-490.116) -- 0:00:30
      484500 -- (-488.237) [-489.737] (-488.663) (-490.173) * (-489.938) (-490.236) (-490.969) [-491.334] -- 0:00:30
      485000 -- [-488.696] (-489.067) (-490.181) (-488.624) * (-491.200) (-492.054) [-488.644] (-491.386) -- 0:00:30

      Average standard deviation of split frequencies: 0.010185

      485500 -- (-488.286) (-489.307) [-488.218] (-488.638) * (-499.734) (-488.830) (-491.655) [-488.620] -- 0:00:30
      486000 -- (-489.848) [-488.810] (-490.619) (-488.848) * (-489.579) [-489.931] (-490.927) (-490.342) -- 0:00:30
      486500 -- (-492.204) (-489.961) (-490.589) [-489.255] * [-490.687] (-491.247) (-489.180) (-490.180) -- 0:00:30
      487000 -- (-492.905) (-489.133) (-490.750) [-491.862] * (-488.272) (-489.121) [-489.547] (-490.390) -- 0:00:30
      487500 -- [-491.764] (-491.299) (-490.533) (-493.205) * [-490.222] (-490.102) (-489.739) (-494.422) -- 0:00:30
      488000 -- (-491.247) [-488.006] (-493.507) (-494.457) * (-489.956) [-488.946] (-488.315) (-495.088) -- 0:00:30
      488500 -- [-491.825] (-491.969) (-489.337) (-491.550) * (-491.201) (-490.838) (-487.325) [-489.030] -- 0:00:30
      489000 -- (-492.133) (-491.563) (-490.062) [-488.457] * [-489.853] (-488.869) (-488.751) (-490.930) -- 0:00:30
      489500 -- (-489.235) [-491.362] (-492.224) (-496.737) * [-488.144] (-488.702) (-489.417) (-489.889) -- 0:00:30
      490000 -- (-488.568) (-488.585) (-496.785) [-489.819] * (-490.256) [-489.399] (-491.788) (-491.203) -- 0:00:30

      Average standard deviation of split frequencies: 0.009427

      490500 -- (-490.407) (-489.649) (-493.065) [-490.527] * (-491.083) [-490.433] (-492.797) (-487.760) -- 0:00:30
      491000 -- (-489.445) (-488.270) [-489.420] (-488.392) * (-488.644) (-497.986) (-488.543) [-487.673] -- 0:00:30
      491500 -- [-489.050] (-489.088) (-491.077) (-488.842) * (-489.491) [-487.834] (-490.714) (-488.135) -- 0:00:30
      492000 -- (-491.425) (-488.446) [-488.257] (-490.373) * (-489.896) (-487.796) (-487.988) [-488.558] -- 0:00:29
      492500 -- (-492.875) (-490.711) [-487.850] (-488.777) * (-491.529) (-490.071) [-488.859] (-487.690) -- 0:00:29
      493000 -- (-492.483) [-487.671] (-489.331) (-490.305) * (-488.213) (-490.425) [-492.166] (-488.641) -- 0:00:29
      493500 -- (-488.787) (-489.394) [-488.921] (-491.108) * (-493.175) (-489.410) [-488.547] (-490.440) -- 0:00:29
      494000 -- [-489.926] (-488.793) (-491.671) (-491.381) * (-489.101) (-490.328) [-488.934] (-490.291) -- 0:00:29
      494500 -- (-491.110) (-488.800) [-489.453] (-488.734) * (-490.690) [-491.545] (-488.772) (-488.588) -- 0:00:29
      495000 -- [-487.838] (-488.415) (-489.497) (-489.413) * [-489.945] (-491.303) (-487.758) (-490.129) -- 0:00:29

      Average standard deviation of split frequencies: 0.009124

      495500 -- [-492.460] (-488.396) (-489.691) (-491.281) * [-490.534] (-487.847) (-489.438) (-487.801) -- 0:00:29
      496000 -- [-491.077] (-489.465) (-487.961) (-491.702) * (-491.242) (-488.751) (-491.321) [-491.276] -- 0:00:29
      496500 -- (-496.399) (-490.982) [-488.961] (-488.663) * [-488.814] (-488.738) (-489.522) (-488.486) -- 0:00:29
      497000 -- (-488.806) (-488.820) [-488.091] (-492.046) * (-491.606) (-490.332) (-490.024) [-490.083] -- 0:00:29
      497500 -- (-488.944) (-488.618) [-487.993] (-490.229) * [-489.743] (-488.285) (-489.500) (-488.850) -- 0:00:29
      498000 -- (-489.928) (-490.701) [-489.132] (-491.069) * (-489.312) [-487.657] (-488.449) (-490.506) -- 0:00:29
      498500 -- (-495.386) [-490.248] (-488.202) (-493.016) * [-491.540] (-488.139) (-492.706) (-489.376) -- 0:00:29
      499000 -- (-503.500) (-488.787) (-489.426) [-489.214] * (-490.208) [-488.850] (-488.241) (-494.800) -- 0:00:29
      499500 -- (-492.843) (-488.810) [-489.994] (-488.358) * (-488.483) [-489.076] (-487.732) (-489.844) -- 0:00:30
      500000 -- [-491.237] (-489.378) (-490.958) (-487.782) * (-491.463) (-493.992) [-489.254] (-487.761) -- 0:00:30

      Average standard deviation of split frequencies: 0.009004

      500500 -- (-494.147) (-489.017) (-492.791) [-489.680] * [-490.890] (-493.651) (-491.270) (-488.415) -- 0:00:29
      501000 -- (-489.789) [-488.020] (-488.695) (-491.244) * (-488.265) [-489.480] (-488.277) (-489.290) -- 0:00:29
      501500 -- (-492.725) [-489.751] (-489.567) (-488.714) * (-492.300) [-489.588] (-488.108) (-492.045) -- 0:00:29
      502000 -- (-490.622) (-491.177) [-489.044] (-493.927) * (-489.518) [-487.510] (-488.172) (-487.735) -- 0:00:29
      502500 -- (-493.790) [-491.488] (-488.196) (-488.866) * (-489.733) (-488.659) [-488.357] (-492.094) -- 0:00:29
      503000 -- [-493.550] (-493.216) (-489.816) (-491.242) * (-489.790) [-487.390] (-489.336) (-489.962) -- 0:00:29
      503500 -- (-493.480) (-489.874) (-490.353) [-489.468] * (-492.287) [-489.074] (-490.617) (-489.676) -- 0:00:29
      504000 -- (-489.196) [-492.877] (-488.252) (-489.300) * (-487.699) (-489.143) (-491.113) [-489.073] -- 0:00:29
      504500 -- [-488.547] (-489.203) (-488.536) (-490.309) * (-488.470) [-490.442] (-489.840) (-495.254) -- 0:00:29
      505000 -- [-488.070] (-488.778) (-491.291) (-491.053) * (-488.433) (-489.194) [-488.857] (-489.584) -- 0:00:29

      Average standard deviation of split frequencies: 0.009025

      505500 -- (-488.416) (-488.864) [-492.180] (-491.183) * [-488.374] (-488.470) (-489.273) (-492.259) -- 0:00:29
      506000 -- (-489.570) [-489.676] (-488.545) (-489.474) * (-488.551) (-490.342) [-488.538] (-492.709) -- 0:00:29
      506500 -- (-487.896) (-489.773) (-492.274) [-487.820] * (-490.103) (-488.217) (-488.354) [-491.552] -- 0:00:29
      507000 -- (-488.548) (-491.869) (-493.216) [-489.274] * (-490.205) [-491.055] (-487.928) (-489.955) -- 0:00:29
      507500 -- (-488.873) (-494.929) (-489.877) [-491.327] * (-489.210) (-491.841) (-487.901) [-491.889] -- 0:00:29
      508000 -- (-492.047) (-489.089) (-488.504) [-492.049] * (-487.920) (-493.810) [-489.920] (-490.444) -- 0:00:29
      508500 -- (-489.121) (-493.914) [-488.875] (-489.084) * (-488.543) (-491.369) [-491.485] (-488.861) -- 0:00:28
      509000 -- (-488.119) (-491.337) (-489.310) [-489.159] * [-487.350] (-490.309) (-495.957) (-490.806) -- 0:00:28
      509500 -- [-490.228] (-490.524) (-489.057) (-487.865) * [-491.906] (-488.130) (-488.235) (-490.476) -- 0:00:28
      510000 -- (-493.176) (-491.668) (-491.940) [-488.270] * (-492.320) [-488.240] (-488.179) (-491.983) -- 0:00:28

      Average standard deviation of split frequencies: 0.009600

      510500 -- (-489.428) [-491.410] (-489.234) (-488.106) * [-488.953] (-488.241) (-491.490) (-491.463) -- 0:00:28
      511000 -- [-489.149] (-489.017) (-489.699) (-493.091) * (-490.722) (-489.142) (-490.231) [-488.243] -- 0:00:28
      511500 -- (-488.798) [-487.971] (-488.040) (-491.837) * (-487.631) (-489.599) [-487.941] (-490.473) -- 0:00:28
      512000 -- (-488.882) (-489.480) (-490.000) [-490.322] * (-490.390) [-489.066] (-489.389) (-488.508) -- 0:00:28
      512500 -- (-487.644) [-490.730] (-489.068) (-489.964) * (-490.623) [-490.538] (-492.903) (-490.044) -- 0:00:28
      513000 -- (-489.642) (-488.433) (-489.906) [-489.177] * [-489.370] (-489.036) (-489.069) (-492.166) -- 0:00:28
      513500 -- (-488.228) (-490.380) [-488.890] (-487.750) * (-488.467) [-489.766] (-487.873) (-490.230) -- 0:00:28
      514000 -- (-487.900) (-490.576) [-488.132] (-487.928) * (-498.508) [-489.155] (-491.028) (-490.532) -- 0:00:28
      514500 -- (-488.212) (-491.612) [-491.497] (-488.158) * (-490.409) [-488.296] (-490.578) (-491.312) -- 0:00:28
      515000 -- (-489.586) (-489.954) (-491.480) [-490.123] * (-488.475) (-492.112) [-490.826] (-490.300) -- 0:00:28

      Average standard deviation of split frequencies: 0.010354

      515500 -- (-489.807) (-488.422) (-489.069) [-487.986] * [-490.021] (-490.033) (-490.251) (-490.835) -- 0:00:28
      516000 -- (-490.290) (-489.523) [-488.351] (-488.185) * (-489.572) (-489.069) (-490.597) [-491.098] -- 0:00:28
      516500 -- [-489.442] (-488.884) (-489.326) (-488.563) * (-492.623) [-487.824] (-488.544) (-491.166) -- 0:00:29
      517000 -- (-488.341) (-489.806) [-491.007] (-489.316) * (-490.056) (-487.673) [-488.360] (-491.641) -- 0:00:28
      517500 -- (-489.838) [-494.072] (-489.808) (-488.276) * [-489.147] (-489.002) (-488.481) (-489.382) -- 0:00:28
      518000 -- [-489.534] (-491.067) (-489.330) (-490.625) * (-490.164) (-488.939) [-488.977] (-491.040) -- 0:00:28
      518500 -- [-489.216] (-489.937) (-490.155) (-489.867) * (-490.756) (-489.834) [-487.560] (-490.474) -- 0:00:28
      519000 -- (-491.545) (-490.461) [-489.337] (-488.839) * (-488.906) [-489.775] (-494.274) (-489.634) -- 0:00:28
      519500 -- (-489.732) (-489.926) [-491.076] (-490.021) * (-491.186) (-488.969) (-489.727) [-487.741] -- 0:00:28
      520000 -- (-491.938) (-490.942) (-489.032) [-489.492] * (-489.347) (-488.866) [-488.765] (-488.451) -- 0:00:28

      Average standard deviation of split frequencies: 0.009839

      520500 -- [-490.812] (-487.848) (-490.955) (-491.713) * [-491.895] (-500.353) (-492.093) (-488.006) -- 0:00:28
      521000 -- (-487.838) (-488.244) [-488.939] (-488.499) * (-489.112) [-495.207] (-494.445) (-488.700) -- 0:00:28
      521500 -- (-489.172) [-489.698] (-488.249) (-489.810) * (-488.082) (-494.505) (-488.947) [-489.808] -- 0:00:28
      522000 -- (-488.991) (-488.688) (-488.405) [-488.885] * (-490.228) [-489.233] (-489.035) (-489.785) -- 0:00:28
      522500 -- (-491.407) [-488.762] (-489.454) (-487.423) * [-491.334] (-488.371) (-494.759) (-498.585) -- 0:00:28
      523000 -- [-488.315] (-490.579) (-488.032) (-487.409) * [-493.537] (-491.170) (-494.202) (-495.224) -- 0:00:28
      523500 -- [-489.400] (-492.293) (-489.526) (-488.201) * (-487.875) (-490.643) [-489.956] (-489.262) -- 0:00:28
      524000 -- [-488.252] (-490.685) (-488.078) (-490.626) * (-496.207) (-487.933) [-488.916] (-488.694) -- 0:00:28
      524500 -- [-488.856] (-489.392) (-489.763) (-488.328) * (-491.826) (-488.443) [-490.837] (-490.517) -- 0:00:28
      525000 -- (-490.163) (-489.592) (-488.261) [-489.885] * (-493.544) (-489.194) [-488.789] (-493.673) -- 0:00:28

      Average standard deviation of split frequencies: 0.009354

      525500 -- [-487.588] (-490.418) (-489.239) (-492.191) * (-492.091) [-492.329] (-488.292) (-489.384) -- 0:00:27
      526000 -- (-489.970) (-487.984) [-489.011] (-490.239) * (-489.797) (-493.099) [-488.435] (-488.746) -- 0:00:27
      526500 -- (-490.397) [-488.360] (-488.435) (-489.913) * [-488.558] (-490.868) (-488.807) (-489.419) -- 0:00:27
      527000 -- [-493.518] (-488.900) (-489.759) (-488.846) * (-488.375) [-488.510] (-489.622) (-489.008) -- 0:00:27
      527500 -- (-489.147) (-488.312) (-488.116) [-491.429] * (-494.703) [-487.431] (-492.515) (-488.601) -- 0:00:27
      528000 -- [-490.889] (-490.587) (-490.755) (-493.842) * (-493.314) (-488.336) (-491.852) [-490.439] -- 0:00:27
      528500 -- (-489.702) (-493.906) (-491.040) [-490.586] * (-495.270) (-490.499) [-492.550] (-488.481) -- 0:00:27
      529000 -- (-488.294) (-489.767) (-487.537) [-490.110] * [-491.209] (-489.300) (-492.936) (-492.736) -- 0:00:27
      529500 -- (-493.831) (-490.031) (-490.331) [-492.474] * [-491.650] (-491.125) (-490.737) (-490.248) -- 0:00:27
      530000 -- (-488.070) (-493.573) (-489.371) [-488.673] * [-488.930] (-488.252) (-488.083) (-490.784) -- 0:00:27

      Average standard deviation of split frequencies: 0.009549

      530500 -- (-489.380) (-493.569) [-488.221] (-490.026) * [-488.808] (-491.100) (-493.056) (-489.633) -- 0:00:27
      531000 -- (-490.384) (-489.647) (-494.604) [-489.793] * (-489.236) (-491.332) [-488.508] (-489.849) -- 0:00:27
      531500 -- (-490.222) (-489.194) [-489.478] (-490.513) * (-491.750) [-490.873] (-489.710) (-489.111) -- 0:00:27
      532000 -- [-490.866] (-491.766) (-490.837) (-488.906) * (-488.965) (-495.404) [-489.623] (-490.655) -- 0:00:27
      532500 -- (-489.167) [-489.282] (-491.191) (-489.647) * [-489.630] (-493.772) (-489.201) (-492.316) -- 0:00:27
      533000 -- (-489.560) (-490.755) (-488.378) [-488.665] * (-495.199) [-494.117] (-489.949) (-489.859) -- 0:00:27
      533500 -- (-489.517) (-490.942) (-489.645) [-490.124] * (-493.042) (-492.407) [-489.352] (-490.911) -- 0:00:27
      534000 -- (-490.430) (-489.034) [-489.428] (-488.983) * (-488.794) [-488.863] (-492.454) (-493.370) -- 0:00:27
      534500 -- (-489.862) (-489.804) [-488.769] (-488.096) * [-488.593] (-489.061) (-488.093) (-489.291) -- 0:00:27
      535000 -- (-488.452) (-488.045) [-489.671] (-489.097) * [-489.782] (-492.908) (-490.735) (-490.213) -- 0:00:27

      Average standard deviation of split frequencies: 0.009147

      535500 -- (-491.998) [-488.289] (-493.595) (-490.636) * (-492.050) [-487.476] (-488.146) (-489.629) -- 0:00:27
      536000 -- (-490.647) [-489.772] (-492.634) (-489.205) * (-489.646) [-488.352] (-488.034) (-489.194) -- 0:00:27
      536500 -- [-489.024] (-489.373) (-487.914) (-489.292) * (-488.363) [-488.564] (-490.334) (-489.444) -- 0:00:27
      537000 -- (-491.263) (-495.539) [-488.701] (-492.690) * (-488.766) (-489.805) (-488.590) [-492.057] -- 0:00:27
      537500 -- (-491.071) (-492.184) (-491.384) [-488.409] * (-495.060) (-492.258) [-492.763] (-491.118) -- 0:00:27
      538000 -- (-489.812) (-490.217) (-493.384) [-491.714] * [-492.351] (-489.382) (-492.825) (-493.128) -- 0:00:27
      538500 -- (-489.758) (-492.238) (-490.155) [-488.214] * (-489.922) (-491.441) [-490.617] (-488.661) -- 0:00:27
      539000 -- [-490.746] (-491.711) (-489.757) (-487.860) * (-493.645) [-491.408] (-490.198) (-491.005) -- 0:00:27
      539500 -- [-490.438] (-489.000) (-492.184) (-488.238) * (-489.709) [-490.583] (-489.691) (-493.205) -- 0:00:27
      540000 -- (-489.320) [-489.554] (-491.829) (-493.751) * (-490.238) [-492.025] (-489.576) (-489.453) -- 0:00:27

      Average standard deviation of split frequencies: 0.009010

      540500 -- (-491.596) (-488.785) (-489.215) [-489.278] * [-493.730] (-490.190) (-489.352) (-490.341) -- 0:00:27
      541000 -- (-491.242) [-490.622] (-497.323) (-487.942) * [-488.328] (-491.233) (-489.968) (-489.950) -- 0:00:27
      541500 -- (-488.802) [-490.081] (-498.828) (-489.138) * [-492.308] (-488.236) (-487.737) (-490.373) -- 0:00:27
      542000 -- (-490.882) (-490.150) [-493.888] (-489.931) * (-488.544) (-490.396) [-487.792] (-489.174) -- 0:00:27
      542500 -- (-493.660) (-489.309) (-491.531) [-490.406] * (-489.272) [-490.159] (-488.925) (-488.995) -- 0:00:26
      543000 -- (-493.062) (-488.261) (-492.501) [-488.190] * (-490.247) [-489.013] (-488.760) (-489.785) -- 0:00:26
      543500 -- [-490.680] (-498.532) (-493.160) (-488.892) * (-489.824) (-489.312) [-489.457] (-492.243) -- 0:00:26
      544000 -- [-490.773] (-490.141) (-487.800) (-490.091) * (-490.762) [-490.166] (-489.043) (-495.326) -- 0:00:26
      544500 -- (-490.643) (-491.571) [-489.084] (-492.045) * (-493.281) (-488.979) [-488.583] (-489.665) -- 0:00:26
      545000 -- (-492.069) (-487.960) (-491.570) [-487.925] * (-490.694) [-487.922] (-488.778) (-488.381) -- 0:00:26

      Average standard deviation of split frequencies: 0.009267

      545500 -- [-489.893] (-488.962) (-490.473) (-487.522) * (-491.887) (-490.069) (-493.202) [-492.959] -- 0:00:26
      546000 -- (-488.526) [-488.964] (-488.454) (-488.267) * (-488.534) (-489.940) [-488.980] (-490.170) -- 0:00:26
      546500 -- (-488.540) (-488.506) [-488.322] (-488.404) * (-490.375) [-490.465] (-488.446) (-489.463) -- 0:00:26
      547000 -- (-490.865) (-490.261) [-488.840] (-488.002) * (-488.118) (-488.701) (-488.331) [-492.208] -- 0:00:26
      547500 -- (-492.243) (-489.831) [-489.156] (-490.303) * [-488.199] (-489.944) (-491.072) (-490.851) -- 0:00:26
      548000 -- (-490.096) [-488.451] (-489.620) (-489.364) * (-489.605) [-492.295] (-490.432) (-489.770) -- 0:00:26
      548500 -- [-490.563] (-493.343) (-490.783) (-493.130) * (-488.221) [-490.127] (-492.490) (-489.208) -- 0:00:26
      549000 -- (-490.263) (-494.134) [-493.724] (-488.498) * [-489.009] (-490.598) (-492.869) (-487.964) -- 0:00:26
      549500 -- (-490.005) [-490.953] (-489.871) (-492.392) * (-491.216) [-490.758] (-489.481) (-490.726) -- 0:00:26
      550000 -- (-488.656) (-494.821) [-491.289] (-494.099) * [-488.910] (-488.749) (-491.998) (-487.846) -- 0:00:26

      Average standard deviation of split frequencies: 0.009577

      550500 -- (-493.188) (-490.609) [-488.261] (-488.204) * [-490.033] (-490.212) (-488.303) (-490.744) -- 0:00:26
      551000 -- (-488.197) (-493.215) (-489.418) [-488.088] * [-488.691] (-490.975) (-493.542) (-490.767) -- 0:00:26
      551500 -- (-493.284) [-488.647] (-490.274) (-487.882) * [-488.707] (-490.471) (-488.857) (-491.660) -- 0:00:26
      552000 -- (-489.676) [-488.474] (-490.530) (-491.238) * (-495.206) (-489.960) [-488.979] (-488.749) -- 0:00:26
      552500 -- (-490.076) (-489.574) [-497.313] (-490.552) * (-489.699) (-488.060) (-489.050) [-489.014] -- 0:00:26
      553000 -- (-491.044) (-489.938) (-490.900) [-488.724] * (-491.278) [-489.395] (-488.379) (-489.711) -- 0:00:26
      553500 -- (-490.054) (-492.090) (-491.007) [-488.638] * (-488.845) (-488.416) [-488.448] (-487.699) -- 0:00:26
      554000 -- (-490.943) [-489.899] (-489.837) (-488.120) * (-493.896) [-490.339] (-488.387) (-488.526) -- 0:00:26
      554500 -- (-489.540) [-490.120] (-487.825) (-490.836) * (-491.831) (-494.067) (-491.745) [-488.059] -- 0:00:26
      555000 -- (-491.516) (-490.232) (-487.872) [-489.996] * [-488.989] (-493.456) (-487.565) (-488.577) -- 0:00:26

      Average standard deviation of split frequencies: 0.009856

      555500 -- [-492.847] (-488.991) (-489.123) (-488.171) * [-489.247] (-487.634) (-488.754) (-491.678) -- 0:00:26
      556000 -- [-492.463] (-488.942) (-488.228) (-488.905) * (-490.166) [-488.387] (-491.808) (-490.283) -- 0:00:26
      556500 -- [-489.302] (-488.975) (-488.234) (-487.652) * (-489.105) (-488.160) [-489.343] (-489.334) -- 0:00:26
      557000 -- (-489.533) [-488.228] (-489.519) (-489.733) * (-487.964) [-487.721] (-490.598) (-491.921) -- 0:00:26
      557500 -- [-489.638] (-490.120) (-488.501) (-488.803) * (-489.128) (-491.151) [-490.788] (-490.485) -- 0:00:26
      558000 -- (-492.973) [-487.858] (-488.560) (-488.271) * (-491.936) [-487.945] (-492.107) (-494.240) -- 0:00:26
      558500 -- (-487.718) [-488.805] (-489.330) (-491.634) * (-488.662) [-487.427] (-493.382) (-490.165) -- 0:00:26
      559000 -- (-487.779) (-488.560) [-492.687] (-491.126) * (-488.312) [-491.095] (-487.641) (-493.722) -- 0:00:26
      559500 -- (-488.504) [-490.043] (-490.369) (-492.949) * (-488.726) (-490.449) [-490.735] (-490.103) -- 0:00:25
      560000 -- (-488.460) [-490.399] (-488.809) (-494.605) * (-491.184) (-488.040) (-491.011) [-492.764] -- 0:00:25

      Average standard deviation of split frequencies: 0.009921

      560500 -- (-488.300) (-489.750) [-491.269] (-494.857) * (-490.089) (-494.326) [-490.553] (-492.122) -- 0:00:25
      561000 -- (-490.826) [-491.587] (-489.328) (-490.982) * (-491.870) (-493.617) (-489.635) [-492.876] -- 0:00:25
      561500 -- [-490.712] (-491.397) (-488.842) (-488.178) * (-488.820) (-488.852) (-492.811) [-489.481] -- 0:00:25
      562000 -- (-494.954) (-491.476) (-488.808) [-491.678] * (-488.697) [-489.480] (-489.520) (-488.646) -- 0:00:25
      562500 -- (-491.400) (-490.784) (-488.791) [-488.864] * (-489.541) (-488.462) [-488.043] (-488.747) -- 0:00:25
      563000 -- (-488.690) (-489.746) [-490.013] (-493.235) * (-491.543) (-488.488) (-488.393) [-488.957] -- 0:00:25
      563500 -- (-489.974) [-489.058] (-489.669) (-491.902) * (-496.668) [-487.813] (-489.072) (-493.366) -- 0:00:25
      564000 -- [-489.722] (-490.010) (-489.840) (-491.750) * (-493.496) [-488.008] (-489.981) (-489.876) -- 0:00:25
      564500 -- [-488.987] (-490.998) (-488.841) (-490.070) * (-490.568) [-489.062] (-496.839) (-489.442) -- 0:00:25
      565000 -- (-489.909) (-489.852) (-491.561) [-490.265] * (-487.916) [-488.324] (-493.178) (-488.653) -- 0:00:25

      Average standard deviation of split frequencies: 0.009526

      565500 -- (-489.188) (-488.935) (-489.303) [-489.390] * [-488.531] (-488.112) (-490.045) (-494.868) -- 0:00:26
      566000 -- (-490.149) [-488.419] (-489.938) (-490.551) * (-490.612) (-490.690) (-494.478) [-490.582] -- 0:00:26
      566500 -- [-487.779] (-491.854) (-490.450) (-489.357) * (-488.859) [-491.251] (-488.913) (-488.783) -- 0:00:26
      567000 -- [-489.249] (-492.308) (-489.408) (-491.190) * (-489.341) (-488.056) [-491.042] (-488.553) -- 0:00:25
      567500 -- (-489.677) [-487.821] (-488.768) (-489.177) * (-489.859) (-489.073) (-490.321) [-489.091] -- 0:00:25
      568000 -- (-490.170) (-490.305) (-488.904) [-489.341] * (-491.769) [-488.767] (-490.294) (-489.153) -- 0:00:25
      568500 -- [-488.412] (-490.380) (-488.703) (-489.343) * [-492.065] (-488.906) (-489.643) (-493.186) -- 0:00:25
      569000 -- [-488.438] (-490.952) (-488.864) (-488.231) * (-491.319) (-495.785) [-488.355] (-490.183) -- 0:00:25
      569500 -- [-488.756] (-490.484) (-489.761) (-491.203) * (-489.230) (-490.733) [-488.319] (-488.477) -- 0:00:25
      570000 -- (-488.873) (-489.896) [-488.838] (-493.950) * [-490.388] (-490.285) (-490.732) (-490.721) -- 0:00:25

      Average standard deviation of split frequencies: 0.009345

      570500 -- [-489.898] (-488.006) (-489.035) (-489.436) * [-492.041] (-490.200) (-490.904) (-489.581) -- 0:00:25
      571000 -- [-490.389] (-488.547) (-491.317) (-491.957) * (-489.048) (-489.246) (-493.321) [-488.045] -- 0:00:25
      571500 -- (-491.200) (-488.091) [-492.629] (-488.903) * (-491.236) (-488.728) (-491.532) [-490.468] -- 0:00:25
      572000 -- [-488.174] (-489.941) (-489.259) (-490.313) * (-488.074) (-487.704) [-489.230] (-490.715) -- 0:00:25
      572500 -- (-491.481) [-488.041] (-489.266) (-489.670) * [-489.656] (-492.966) (-492.127) (-489.015) -- 0:00:25
      573000 -- (-491.306) (-489.954) [-489.978] (-490.319) * (-492.649) [-488.663] (-487.705) (-489.978) -- 0:00:25
      573500 -- (-491.789) (-490.597) (-489.363) [-487.675] * (-492.500) (-488.970) [-489.546] (-488.144) -- 0:00:25
      574000 -- (-493.966) [-487.744] (-488.845) (-492.271) * (-493.748) [-488.197] (-488.426) (-488.199) -- 0:00:25
      574500 -- [-488.962] (-489.836) (-488.042) (-494.481) * (-492.567) [-490.517] (-490.507) (-488.338) -- 0:00:25
      575000 -- (-492.504) (-489.767) (-488.236) [-487.555] * (-489.645) (-487.804) (-489.052) [-489.289] -- 0:00:25

      Average standard deviation of split frequencies: 0.008675

      575500 -- (-490.110) (-488.355) [-489.662] (-489.102) * [-491.425] (-488.459) (-495.474) (-491.258) -- 0:00:25
      576000 -- (-489.006) (-488.384) (-488.726) [-489.065] * (-489.761) (-487.590) (-496.052) [-488.938] -- 0:00:25
      576500 -- [-490.313] (-489.794) (-490.602) (-488.783) * (-490.573) [-489.718] (-493.695) (-488.306) -- 0:00:24
      577000 -- (-488.468) (-488.750) (-491.813) [-490.733] * [-490.234] (-491.936) (-492.722) (-488.518) -- 0:00:24
      577500 -- (-492.498) (-489.208) [-493.486] (-490.510) * (-492.803) (-489.203) [-487.768] (-488.421) -- 0:00:24
      578000 -- [-490.633] (-488.341) (-489.210) (-487.835) * (-494.560) (-491.812) (-487.939) [-490.083] -- 0:00:24
      578500 -- [-487.712] (-490.034) (-488.942) (-488.523) * (-491.067) (-492.271) [-488.131] (-489.544) -- 0:00:24
      579000 -- (-488.839) (-489.802) [-489.274] (-488.657) * [-487.977] (-491.544) (-490.048) (-490.215) -- 0:00:24
      579500 -- (-487.807) [-488.964] (-490.598) (-492.163) * [-489.082] (-490.351) (-489.145) (-488.512) -- 0:00:24
      580000 -- (-487.764) [-491.613] (-495.020) (-490.185) * (-496.899) [-488.887] (-488.212) (-493.322) -- 0:00:24

      Average standard deviation of split frequencies: 0.008829

      580500 -- [-488.331] (-488.810) (-489.523) (-491.892) * (-490.269) (-493.061) [-489.910] (-491.779) -- 0:00:24
      581000 -- (-488.124) (-495.053) [-489.573] (-489.210) * (-488.940) (-488.052) (-488.671) [-490.400] -- 0:00:24
      581500 -- [-489.504] (-495.590) (-488.511) (-489.116) * [-489.297] (-489.150) (-491.931) (-488.185) -- 0:00:25
      582000 -- (-489.597) (-490.425) [-493.119] (-491.828) * (-489.802) (-495.521) [-488.497] (-491.638) -- 0:00:25
      582500 -- [-490.577] (-490.120) (-489.257) (-490.537) * [-501.556] (-490.430) (-489.922) (-490.497) -- 0:00:25
      583000 -- (-488.452) [-488.890] (-487.939) (-487.959) * [-490.151] (-490.393) (-489.321) (-493.045) -- 0:00:25
      583500 -- (-488.381) [-489.433] (-490.483) (-489.277) * (-489.989) (-487.685) [-490.096] (-496.238) -- 0:00:24
      584000 -- (-488.159) (-487.677) (-492.360) [-487.425] * (-488.228) [-488.253] (-488.589) (-487.833) -- 0:00:24
      584500 -- [-489.967] (-488.063) (-492.191) (-488.879) * [-490.532] (-489.490) (-489.630) (-489.348) -- 0:00:24
      585000 -- (-489.403) [-493.212] (-490.191) (-490.888) * [-489.723] (-488.439) (-494.384) (-489.934) -- 0:00:24

      Average standard deviation of split frequencies: 0.008497

      585500 -- (-489.356) (-489.485) (-498.502) [-491.158] * (-487.857) (-489.543) (-493.524) [-489.371] -- 0:00:24
      586000 -- (-489.156) (-490.844) (-501.340) [-489.761] * (-490.501) (-489.268) (-489.436) [-488.774] -- 0:00:24
      586500 -- (-491.902) (-489.291) [-491.055] (-490.346) * (-488.446) (-488.778) (-488.617) [-490.708] -- 0:00:24
      587000 -- [-489.891] (-489.851) (-489.843) (-488.602) * (-488.557) (-488.224) [-489.837] (-489.307) -- 0:00:24
      587500 -- [-488.128] (-488.523) (-489.810) (-488.898) * (-489.063) (-490.069) [-487.385] (-487.856) -- 0:00:24
      588000 -- (-489.521) [-488.085] (-488.531) (-491.355) * [-489.545] (-490.531) (-487.559) (-490.893) -- 0:00:24
      588500 -- [-487.971] (-488.855) (-488.687) (-491.146) * (-488.518) (-490.664) [-492.354] (-493.311) -- 0:00:24
      589000 -- (-488.851) (-490.083) [-488.299] (-490.075) * (-488.829) (-489.378) [-488.890] (-488.542) -- 0:00:24
      589500 -- [-488.285] (-487.976) (-488.650) (-489.210) * (-489.536) [-488.850] (-490.443) (-488.385) -- 0:00:24
      590000 -- [-488.468] (-492.771) (-488.273) (-491.924) * (-490.951) (-488.110) (-489.987) [-490.619] -- 0:00:24

      Average standard deviation of split frequencies: 0.008920

      590500 -- (-489.697) [-488.872] (-491.991) (-492.824) * (-496.634) (-492.001) [-490.290] (-489.450) -- 0:00:24
      591000 -- (-491.313) (-487.720) (-493.946) [-489.112] * [-492.298] (-489.118) (-488.352) (-491.096) -- 0:00:24
      591500 -- [-489.331] (-488.444) (-488.287) (-489.289) * (-492.722) (-487.864) (-496.947) [-488.448] -- 0:00:24
      592000 -- (-487.705) [-487.881] (-489.418) (-489.628) * (-491.355) [-489.335] (-488.479) (-491.072) -- 0:00:24
      592500 -- (-488.102) [-488.159] (-490.010) (-489.825) * (-492.287) (-488.713) [-489.387] (-490.198) -- 0:00:24
      593000 -- (-490.322) (-487.907) (-488.474) [-489.846] * (-489.266) (-491.096) (-489.493) [-490.169] -- 0:00:24
      593500 -- (-489.360) (-490.127) (-491.653) [-489.959] * (-491.211) (-491.178) [-491.130] (-488.902) -- 0:00:23
      594000 -- (-488.305) [-489.718] (-493.141) (-492.003) * (-489.636) [-491.176] (-493.570) (-490.482) -- 0:00:23
      594500 -- (-489.227) [-490.920] (-490.773) (-491.033) * (-488.707) (-488.058) [-489.592] (-493.382) -- 0:00:23
      595000 -- (-494.312) (-488.230) [-487.744] (-491.201) * [-488.571] (-492.422) (-493.961) (-488.602) -- 0:00:23

      Average standard deviation of split frequencies: 0.009073

      595500 -- (-491.653) (-489.282) (-489.078) [-493.801] * [-488.648] (-489.221) (-490.488) (-490.045) -- 0:00:23
      596000 -- (-489.716) [-490.369] (-491.382) (-488.573) * (-488.963) (-489.498) (-491.562) [-488.766] -- 0:00:23
      596500 -- (-492.241) [-489.803] (-487.602) (-489.606) * (-493.710) (-488.436) (-488.905) [-489.329] -- 0:00:23
      597000 -- (-488.650) (-489.532) [-488.889] (-490.039) * [-490.626] (-491.749) (-491.650) (-489.063) -- 0:00:23
      597500 -- (-491.215) [-489.886] (-489.986) (-488.657) * [-491.699] (-490.853) (-493.635) (-491.206) -- 0:00:23
      598000 -- (-491.342) (-488.320) [-489.595] (-488.191) * [-489.724] (-490.846) (-488.824) (-488.728) -- 0:00:23
      598500 -- [-490.738] (-488.100) (-490.168) (-491.681) * (-489.410) [-493.690] (-490.694) (-487.899) -- 0:00:24
      599000 -- (-488.602) (-489.349) [-487.686] (-488.447) * (-488.229) (-489.510) [-490.421] (-488.083) -- 0:00:24
      599500 -- [-488.922] (-490.922) (-488.431) (-491.952) * [-491.582] (-488.546) (-492.742) (-489.360) -- 0:00:24
      600000 -- (-489.403) [-488.533] (-493.819) (-488.361) * (-493.980) [-489.013] (-487.598) (-489.043) -- 0:00:24

      Average standard deviation of split frequencies: 0.009464

      600500 -- [-488.997] (-492.137) (-488.197) (-489.560) * (-490.373) (-492.118) [-490.891] (-494.411) -- 0:00:23
      601000 -- (-492.911) (-491.824) [-488.579] (-490.690) * (-491.880) (-488.514) [-488.454] (-492.927) -- 0:00:23
      601500 -- (-493.966) [-489.753] (-489.164) (-490.967) * [-491.496] (-489.049) (-488.826) (-489.675) -- 0:00:23
      602000 -- (-490.609) [-490.622] (-489.217) (-489.137) * (-488.020) (-488.330) [-489.065] (-489.555) -- 0:00:23
      602500 -- (-493.490) (-488.272) [-488.095] (-489.940) * [-488.173] (-492.276) (-488.752) (-491.970) -- 0:00:23
      603000 -- (-489.952) (-492.143) [-491.322] (-489.257) * (-489.331) (-489.599) [-489.158] (-493.265) -- 0:00:23
      603500 -- (-497.578) [-490.149] (-488.232) (-488.659) * (-491.492) (-492.091) [-491.352] (-494.138) -- 0:00:23
      604000 -- (-491.106) (-490.965) (-488.481) [-488.867] * (-488.505) (-492.360) [-491.789] (-491.119) -- 0:00:23
      604500 -- (-488.298) (-491.748) (-487.661) [-489.122] * (-488.437) [-488.481] (-493.190) (-488.161) -- 0:00:23
      605000 -- (-489.055) (-491.590) [-491.134] (-488.267) * (-488.628) (-489.517) [-490.106] (-490.275) -- 0:00:23

      Average standard deviation of split frequencies: 0.009197

      605500 -- [-491.010] (-488.342) (-488.047) (-488.364) * (-491.608) (-489.020) [-490.813] (-492.453) -- 0:00:23
      606000 -- (-487.793) (-491.804) (-489.782) [-488.541] * (-487.738) (-489.245) [-489.894] (-488.366) -- 0:00:23
      606500 -- (-488.629) (-491.093) [-488.810] (-491.753) * (-489.540) (-488.702) [-488.796] (-488.295) -- 0:00:23
      607000 -- [-489.255] (-488.470) (-488.186) (-489.267) * [-489.829] (-488.227) (-488.801) (-487.829) -- 0:00:23
      607500 -- [-489.702] (-487.991) (-492.080) (-492.730) * [-489.793] (-488.327) (-488.806) (-488.512) -- 0:00:23
      608000 -- [-491.662] (-491.426) (-492.470) (-495.133) * [-488.420] (-488.551) (-487.830) (-493.032) -- 0:00:23
      608500 -- (-490.889) [-493.066] (-489.799) (-490.685) * [-491.393] (-491.404) (-490.155) (-489.455) -- 0:00:23
      609000 -- [-488.680] (-491.325) (-488.510) (-488.902) * [-490.558] (-492.311) (-491.942) (-494.513) -- 0:00:23
      609500 -- (-490.070) [-491.935] (-489.048) (-488.270) * (-493.470) [-493.188] (-490.232) (-492.915) -- 0:00:23
      610000 -- (-492.284) (-492.587) [-488.738] (-487.528) * (-490.633) [-489.409] (-491.861) (-489.678) -- 0:00:23

      Average standard deviation of split frequencies: 0.009400

      610500 -- (-488.977) (-488.786) [-489.710] (-492.352) * (-488.542) (-489.026) (-490.700) [-489.825] -- 0:00:22
      611000 -- (-491.656) [-488.616] (-495.160) (-490.177) * (-488.901) (-489.022) (-489.789) [-490.955] -- 0:00:22
      611500 -- (-490.393) (-489.731) [-489.841] (-488.723) * (-487.703) (-489.182) (-493.675) [-492.623] -- 0:00:22
      612000 -- (-489.607) [-492.417] (-494.833) (-492.063) * [-488.787] (-490.067) (-491.321) (-490.565) -- 0:00:22
      612500 -- (-488.664) (-488.133) (-488.824) [-490.135] * (-490.919) (-491.591) (-490.302) [-488.923] -- 0:00:22
      613000 -- [-489.075] (-491.093) (-489.304) (-490.378) * (-491.255) (-492.028) (-489.332) [-489.626] -- 0:00:22
      613500 -- (-490.213) (-492.260) (-487.942) [-488.989] * (-491.222) (-488.388) [-490.243] (-489.923) -- 0:00:22
      614000 -- (-488.618) (-489.006) (-489.697) [-488.164] * [-489.576] (-492.389) (-490.828) (-492.593) -- 0:00:22
      614500 -- (-488.904) (-489.267) [-490.065] (-489.909) * (-491.127) (-488.987) [-489.822] (-489.060) -- 0:00:22
      615000 -- (-491.831) (-490.395) (-487.948) [-491.584] * (-488.449) (-493.953) (-488.812) [-489.046] -- 0:00:22

      Average standard deviation of split frequencies: 0.009422

      615500 -- (-493.223) (-490.289) (-488.138) [-488.608] * (-488.545) [-490.505] (-489.955) (-490.122) -- 0:00:23
      616000 -- [-488.011] (-489.701) (-487.723) (-487.945) * (-491.727) (-496.012) (-489.451) [-488.046] -- 0:00:23
      616500 -- [-490.748] (-492.355) (-491.194) (-489.239) * (-488.372) [-489.342] (-493.007) (-489.540) -- 0:00:23
      617000 -- [-489.385] (-489.371) (-490.307) (-493.977) * (-488.741) (-491.813) (-489.373) [-489.904] -- 0:00:22
      617500 -- (-491.079) (-492.147) (-488.928) [-490.639] * (-489.538) (-489.358) [-489.577] (-488.929) -- 0:00:22
      618000 -- [-491.267] (-491.124) (-488.819) (-489.531) * (-489.423) [-490.992] (-491.153) (-488.315) -- 0:00:22
      618500 -- (-489.352) (-488.937) [-488.808] (-495.611) * [-488.330] (-490.045) (-490.612) (-489.981) -- 0:00:22
      619000 -- (-488.388) (-488.859) (-490.600) [-490.120] * (-491.527) (-489.220) (-491.411) [-490.425] -- 0:00:22
      619500 -- [-489.151] (-488.859) (-489.342) (-490.558) * [-491.463] (-488.897) (-488.182) (-489.901) -- 0:00:22
      620000 -- (-494.679) (-489.023) [-490.171] (-491.719) * (-491.335) [-492.658] (-488.811) (-489.959) -- 0:00:22

      Average standard deviation of split frequencies: 0.009541

      620500 -- [-493.343] (-488.510) (-491.157) (-488.997) * [-488.621] (-490.826) (-490.330) (-489.343) -- 0:00:22
      621000 -- (-493.485) [-488.913] (-487.907) (-491.075) * [-488.462] (-493.198) (-488.397) (-487.857) -- 0:00:22
      621500 -- (-489.691) (-491.705) [-487.507] (-490.092) * [-493.334] (-490.196) (-491.540) (-488.852) -- 0:00:22
      622000 -- (-488.608) (-490.294) [-487.826] (-490.410) * (-491.149) (-488.631) [-489.743] (-488.532) -- 0:00:22
      622500 -- (-488.619) [-488.516] (-490.979) (-492.335) * (-490.471) [-488.472] (-491.069) (-488.561) -- 0:00:22
      623000 -- (-489.872) (-489.477) [-488.646] (-490.482) * (-488.468) (-489.228) (-489.512) [-490.123] -- 0:00:22
      623500 -- (-491.504) (-489.840) (-491.104) [-490.725] * (-488.916) (-489.739) [-489.687] (-487.818) -- 0:00:22
      624000 -- (-490.010) (-487.582) [-488.045] (-492.796) * (-492.447) (-493.087) [-488.108] (-490.108) -- 0:00:22
      624500 -- (-491.148) [-488.247] (-487.660) (-490.512) * [-488.724] (-489.988) (-488.862) (-490.164) -- 0:00:22
      625000 -- [-492.839] (-491.686) (-488.868) (-490.670) * [-488.809] (-490.545) (-496.216) (-493.768) -- 0:00:22

      Average standard deviation of split frequencies: 0.009319

      625500 -- (-492.706) (-487.980) [-490.487] (-491.411) * (-493.221) (-490.346) [-493.340] (-489.749) -- 0:00:22
      626000 -- (-500.156) (-490.815) (-488.080) [-488.279] * [-492.477] (-497.554) (-490.137) (-493.604) -- 0:00:22
      626500 -- (-489.941) [-492.664] (-489.294) (-488.144) * (-499.375) (-493.369) [-491.174] (-492.256) -- 0:00:22
      627000 -- [-487.642] (-489.205) (-488.700) (-490.060) * (-499.485) (-490.287) [-492.184] (-488.345) -- 0:00:22
      627500 -- [-488.626] (-491.258) (-489.579) (-488.662) * [-490.292] (-488.802) (-488.938) (-488.078) -- 0:00:21
      628000 -- (-488.128) (-492.005) [-487.891] (-489.482) * (-491.788) [-490.048] (-491.540) (-490.360) -- 0:00:21
      628500 -- [-487.614] (-491.646) (-487.446) (-488.442) * (-490.458) (-491.521) (-491.638) [-490.096] -- 0:00:21
      629000 -- (-489.132) (-488.289) (-488.116) [-488.324] * [-489.360] (-488.412) (-489.252) (-489.816) -- 0:00:21
      629500 -- [-490.040] (-488.207) (-489.291) (-489.281) * (-493.004) [-488.547] (-489.774) (-490.138) -- 0:00:21
      630000 -- (-490.084) [-487.968] (-487.699) (-489.089) * (-489.676) (-488.973) (-487.628) [-489.146] -- 0:00:21

      Average standard deviation of split frequencies: 0.008409

      630500 -- (-489.272) (-488.370) [-488.439] (-488.220) * (-492.133) (-493.957) (-488.544) [-490.177] -- 0:00:21
      631000 -- (-488.840) (-491.283) [-489.892] (-490.010) * [-492.691] (-490.170) (-488.048) (-489.578) -- 0:00:21
      631500 -- (-489.304) (-491.609) [-492.064] (-490.937) * [-488.696] (-489.776) (-489.655) (-488.349) -- 0:00:21
      632000 -- (-488.981) (-489.513) [-491.035] (-490.765) * [-489.508] (-488.164) (-491.925) (-488.405) -- 0:00:21
      632500 -- (-489.960) (-491.158) [-489.707] (-490.601) * (-491.956) (-489.104) [-489.468] (-488.072) -- 0:00:22
      633000 -- (-488.466) (-490.958) [-488.247] (-488.985) * (-491.679) (-490.162) (-490.013) [-488.955] -- 0:00:22
      633500 -- (-487.508) (-490.566) [-490.344] (-490.507) * (-492.108) [-489.060] (-490.068) (-489.992) -- 0:00:21
      634000 -- [-489.486] (-493.537) (-491.412) (-489.894) * [-490.559] (-488.548) (-488.028) (-490.989) -- 0:00:21
      634500 -- (-491.859) (-489.539) [-488.628] (-489.206) * (-493.596) (-488.535) [-488.355] (-489.680) -- 0:00:21
      635000 -- [-491.451] (-489.418) (-490.011) (-490.332) * (-493.022) (-488.498) [-488.981] (-490.915) -- 0:00:21

      Average standard deviation of split frequencies: 0.007875

      635500 -- (-491.813) (-489.741) (-489.541) [-493.823] * (-493.048) (-492.241) (-487.638) [-488.652] -- 0:00:21
      636000 -- [-489.408] (-490.584) (-489.470) (-491.339) * (-489.870) (-489.184) [-488.721] (-491.891) -- 0:00:21
      636500 -- (-490.339) (-487.741) [-490.452] (-488.652) * (-489.737) [-488.489] (-491.087) (-489.319) -- 0:00:21
      637000 -- (-487.815) [-487.925] (-489.124) (-489.770) * [-491.309] (-488.620) (-489.459) (-491.727) -- 0:00:21
      637500 -- [-489.737] (-487.798) (-490.394) (-490.435) * (-490.925) [-490.201] (-488.436) (-495.102) -- 0:00:21
      638000 -- (-488.474) [-487.829] (-489.643) (-488.918) * (-492.440) (-490.620) [-489.067] (-489.637) -- 0:00:21
      638500 -- [-489.702] (-487.831) (-490.296) (-489.719) * (-492.250) (-489.853) [-488.521] (-490.213) -- 0:00:21
      639000 -- (-491.425) [-488.583] (-488.323) (-493.921) * (-490.946) (-488.668) (-493.899) [-489.864] -- 0:00:21
      639500 -- (-489.847) [-490.536] (-488.032) (-489.778) * (-488.598) [-488.083] (-491.268) (-489.023) -- 0:00:21
      640000 -- (-488.132) [-487.984] (-490.191) (-487.678) * (-489.258) (-488.271) (-490.416) [-488.682] -- 0:00:21

      Average standard deviation of split frequencies: 0.008186

      640500 -- (-489.179) [-491.503] (-490.951) (-490.622) * (-488.774) [-489.038] (-490.850) (-490.641) -- 0:00:21
      641000 -- [-490.024] (-489.834) (-492.194) (-490.595) * (-489.218) (-492.878) (-488.563) [-489.783] -- 0:00:21
      641500 -- (-491.192) (-489.219) (-488.025) [-487.737] * [-490.308] (-490.689) (-491.911) (-488.159) -- 0:00:21
      642000 -- (-492.521) (-488.213) [-491.998] (-488.007) * (-488.841) (-489.407) [-492.783] (-488.843) -- 0:00:21
      642500 -- [-493.855] (-489.639) (-494.761) (-488.924) * [-492.706] (-488.928) (-487.419) (-488.727) -- 0:00:21
      643000 -- [-488.946] (-489.956) (-493.578) (-489.999) * (-489.676) [-489.353] (-490.828) (-490.796) -- 0:00:21
      643500 -- (-488.467) (-493.525) [-490.546] (-491.131) * (-489.147) (-489.026) [-490.375] (-491.474) -- 0:00:21
      644000 -- (-489.621) [-490.956] (-492.479) (-490.440) * (-491.819) (-489.584) [-489.321] (-488.810) -- 0:00:21
      644500 -- (-489.722) [-490.369] (-488.443) (-488.136) * [-491.410] (-490.065) (-497.727) (-490.193) -- 0:00:20
      645000 -- (-489.311) (-491.043) (-488.596) [-490.894] * [-489.435] (-489.601) (-494.974) (-491.942) -- 0:00:20

      Average standard deviation of split frequencies: 0.008027

      645500 -- (-489.527) [-487.447] (-491.545) (-488.518) * (-488.701) (-489.797) (-493.367) [-488.317] -- 0:00:20
      646000 -- [-488.136] (-487.447) (-487.714) (-489.890) * (-493.470) (-490.925) (-491.839) [-489.965] -- 0:00:20
      646500 -- (-489.580) (-490.805) (-488.354) [-489.804] * [-491.312] (-490.392) (-488.858) (-496.387) -- 0:00:20
      647000 -- (-488.428) (-490.914) (-490.152) [-495.986] * (-493.193) (-490.478) [-491.337] (-490.062) -- 0:00:20
      647500 -- (-489.252) (-488.430) (-488.417) [-491.203] * [-491.361] (-490.111) (-490.186) (-491.041) -- 0:00:20
      648000 -- (-491.899) [-489.925] (-488.735) (-489.824) * (-499.376) (-490.472) [-490.040] (-491.678) -- 0:00:20
      648500 -- [-488.806] (-491.087) (-488.638) (-490.119) * (-492.605) (-492.130) [-489.998] (-498.536) -- 0:00:20
      649000 -- (-489.856) [-489.985] (-493.223) (-492.047) * [-489.692] (-495.054) (-491.313) (-491.798) -- 0:00:20
      649500 -- (-490.013) [-488.038] (-490.446) (-492.582) * (-491.016) (-489.615) [-488.873] (-488.997) -- 0:00:21
      650000 -- (-492.837) (-491.313) [-490.955] (-488.669) * [-487.874] (-494.936) (-496.147) (-488.477) -- 0:00:21

      Average standard deviation of split frequencies: 0.007743

      650500 -- (-488.958) (-494.867) [-488.117] (-489.454) * [-489.115] (-488.556) (-491.583) (-488.329) -- 0:00:20
      651000 -- (-491.048) [-492.139] (-491.959) (-492.185) * (-489.882) (-489.570) (-490.687) [-488.177] -- 0:00:20
      651500 -- (-488.778) (-490.299) [-488.701] (-490.815) * [-492.622] (-491.681) (-489.669) (-490.840) -- 0:00:20
      652000 -- (-494.272) [-490.961] (-490.937) (-488.626) * (-492.838) (-488.648) (-489.794) [-494.083] -- 0:00:20
      652500 -- [-489.551] (-490.291) (-491.177) (-488.187) * (-495.598) (-488.641) (-489.276) [-489.183] -- 0:00:20
      653000 -- [-490.710] (-488.423) (-491.898) (-489.489) * (-493.133) (-491.520) (-490.211) [-491.632] -- 0:00:20
      653500 -- (-489.599) (-487.677) [-488.329] (-488.650) * (-491.174) (-489.243) (-490.593) [-492.673] -- 0:00:20
      654000 -- (-492.271) (-490.974) (-492.529) [-490.398] * (-491.317) (-491.374) (-489.032) [-488.651] -- 0:00:20
      654500 -- (-497.100) [-491.551] (-489.472) (-491.052) * (-491.330) (-488.300) [-488.945] (-490.744) -- 0:00:20
      655000 -- (-494.773) (-490.767) (-490.971) [-490.376] * [-490.019] (-491.228) (-492.154) (-488.035) -- 0:00:20

      Average standard deviation of split frequencies: 0.007815

      655500 -- (-488.623) (-490.215) (-488.197) [-488.681] * (-489.945) (-492.477) [-491.052] (-491.367) -- 0:00:20
      656000 -- (-487.951) (-490.117) [-488.527] (-491.203) * [-489.412] (-488.848) (-490.690) (-489.782) -- 0:00:20
      656500 -- [-488.580] (-497.393) (-491.925) (-490.608) * [-489.703] (-488.243) (-489.140) (-489.604) -- 0:00:20
      657000 -- (-490.502) [-490.547] (-491.683) (-489.848) * (-491.845) (-493.197) [-489.677] (-487.778) -- 0:00:20
      657500 -- (-489.407) [-490.972] (-488.388) (-492.037) * (-492.757) (-493.406) (-490.519) [-488.192] -- 0:00:20
      658000 -- (-489.517) (-491.965) [-487.856] (-494.541) * (-488.811) [-490.296] (-490.725) (-490.998) -- 0:00:20
      658500 -- [-489.731] (-491.922) (-491.235) (-497.198) * (-488.699) (-490.905) [-488.482] (-491.989) -- 0:00:20
      659000 -- (-491.605) (-488.010) (-487.945) [-489.338] * (-490.211) (-491.169) (-491.413) [-489.349] -- 0:00:20
      659500 -- (-491.277) [-488.366] (-488.441) (-488.859) * (-489.919) [-487.834] (-490.122) (-488.055) -- 0:00:20
      660000 -- (-490.126) [-489.370] (-488.859) (-490.943) * (-490.562) (-488.728) (-488.597) [-490.915] -- 0:00:20

      Average standard deviation of split frequencies: 0.007468

      660500 -- (-497.101) (-489.816) [-490.345] (-491.021) * [-489.150] (-489.369) (-490.192) (-491.607) -- 0:00:20
      661000 -- (-491.494) (-489.521) (-489.375) [-492.133] * [-489.692] (-492.135) (-491.833) (-490.751) -- 0:00:20
      661500 -- (-489.343) (-490.101) (-491.598) [-489.032] * (-489.346) (-489.081) (-491.926) [-489.317] -- 0:00:19
      662000 -- [-490.005] (-488.479) (-492.952) (-492.123) * (-488.651) (-489.264) [-490.344] (-489.441) -- 0:00:19
      662500 -- (-488.689) (-492.845) [-489.162] (-493.253) * (-491.759) [-489.380] (-494.320) (-489.352) -- 0:00:19
      663000 -- (-490.244) (-490.448) [-487.735] (-493.899) * (-490.885) (-490.187) [-493.431] (-493.227) -- 0:00:19
      663500 -- (-488.873) [-489.767] (-488.694) (-491.308) * [-489.632] (-488.233) (-489.590) (-489.780) -- 0:00:19
      664000 -- (-489.166) (-488.380) (-489.303) [-490.935] * (-488.124) [-488.986] (-488.314) (-490.927) -- 0:00:19
      664500 -- [-487.704] (-489.112) (-488.651) (-494.815) * (-488.021) (-491.118) (-488.329) [-488.931] -- 0:00:19
      665000 -- [-489.788] (-488.551) (-488.150) (-489.762) * (-492.869) (-488.405) (-488.607) [-494.225] -- 0:00:19

      Average standard deviation of split frequencies: 0.007597

      665500 -- (-490.226) (-492.405) (-489.976) [-489.864] * (-498.316) (-487.879) [-488.452] (-491.323) -- 0:00:19
      666000 -- (-490.185) (-496.079) [-489.246] (-488.078) * (-497.099) (-489.838) [-490.026] (-489.110) -- 0:00:19
      666500 -- [-493.239] (-492.482) (-488.828) (-489.330) * (-502.035) (-489.141) [-490.921] (-489.430) -- 0:00:20
      667000 -- (-491.721) (-490.023) (-493.360) [-489.013] * (-491.751) [-489.776] (-490.842) (-489.239) -- 0:00:19
      667500 -- (-488.361) (-490.283) [-489.100] (-488.031) * (-489.972) (-492.870) (-489.728) [-491.694] -- 0:00:19
      668000 -- (-491.345) (-488.621) (-488.781) [-493.870] * (-491.224) (-491.208) (-490.094) [-490.862] -- 0:00:19
      668500 -- (-487.810) (-488.395) [-488.954] (-492.125) * (-489.663) (-491.062) [-488.310] (-488.999) -- 0:00:19
      669000 -- (-489.380) (-488.056) (-490.935) [-492.162] * (-489.817) (-488.804) [-490.688] (-488.844) -- 0:00:19
      669500 -- (-488.363) (-488.433) (-490.732) [-489.805] * (-489.434) (-491.479) [-489.487] (-488.840) -- 0:00:19
      670000 -- (-489.563) [-488.040] (-492.979) (-488.548) * [-490.911] (-487.645) (-490.809) (-490.347) -- 0:00:19

      Average standard deviation of split frequencies: 0.007732

      670500 -- (-491.364) (-489.852) [-489.936] (-488.104) * (-497.424) (-489.666) [-493.105] (-492.630) -- 0:00:19
      671000 -- (-488.145) [-490.001] (-490.370) (-490.025) * (-490.677) (-488.809) (-489.451) [-489.247] -- 0:00:19
      671500 -- (-490.599) (-491.600) (-491.425) [-488.249] * [-487.758] (-489.748) (-491.794) (-492.884) -- 0:00:19
      672000 -- (-488.817) (-491.573) (-490.114) [-490.345] * (-489.251) (-493.073) (-490.158) [-490.043] -- 0:00:19
      672500 -- [-490.729] (-488.503) (-487.816) (-488.414) * (-490.505) [-491.031] (-489.764) (-494.817) -- 0:00:19
      673000 -- [-490.763] (-493.352) (-488.085) (-489.481) * (-487.673) (-489.360) (-490.662) [-493.776] -- 0:00:19
      673500 -- (-491.571) (-489.796) [-490.595] (-489.768) * [-489.258] (-487.738) (-488.494) (-491.002) -- 0:00:19
      674000 -- (-492.957) (-493.812) (-492.079) [-489.601] * (-490.112) (-487.450) [-488.546] (-489.899) -- 0:00:19
      674500 -- (-491.807) (-492.466) [-492.331] (-490.160) * (-490.471) [-488.034] (-488.405) (-489.143) -- 0:00:19
      675000 -- (-489.624) [-489.182] (-488.260) (-489.557) * (-491.317) (-488.552) (-489.041) [-489.156] -- 0:00:19

      Average standard deviation of split frequencies: 0.007857

      675500 -- (-488.406) (-490.173) (-489.146) [-488.933] * (-488.299) (-489.667) (-489.829) [-490.619] -- 0:00:19
      676000 -- (-491.547) (-490.041) (-487.806) [-489.998] * (-491.309) (-490.654) (-490.585) [-490.500] -- 0:00:19
      676500 -- (-487.737) (-489.365) [-487.824] (-491.076) * [-488.682] (-489.417) (-489.072) (-489.078) -- 0:00:19
      677000 -- [-491.259] (-490.916) (-488.427) (-490.584) * (-488.705) (-490.973) (-487.910) [-489.241] -- 0:00:19
      677500 -- (-490.758) (-489.926) [-489.221] (-490.459) * (-490.237) (-490.570) (-493.713) [-487.721] -- 0:00:19
      678000 -- (-488.459) (-489.628) [-490.164] (-489.397) * (-491.267) [-490.325] (-491.318) (-488.263) -- 0:00:18
      678500 -- [-490.159] (-488.671) (-490.018) (-493.517) * (-490.574) (-488.615) (-488.721) [-491.984] -- 0:00:18
      679000 -- [-489.178] (-490.704) (-490.385) (-489.503) * [-489.310] (-493.034) (-493.337) (-492.784) -- 0:00:18
      679500 -- (-489.983) (-490.601) [-488.986] (-492.075) * (-489.130) (-491.645) (-493.059) [-488.375] -- 0:00:18
      680000 -- (-491.339) (-492.146) (-489.495) [-492.978] * (-490.936) (-493.497) [-491.032] (-488.798) -- 0:00:18

      Average standard deviation of split frequencies: 0.008126

      680500 -- (-489.734) [-487.841] (-489.321) (-487.740) * (-489.734) [-493.840] (-489.309) (-491.773) -- 0:00:18
      681000 -- (-489.705) (-489.145) [-488.106] (-492.563) * (-491.559) [-489.330] (-489.468) (-490.162) -- 0:00:18
      681500 -- (-488.845) (-489.157) (-492.788) [-490.095] * (-489.864) (-490.015) (-489.388) [-490.752] -- 0:00:18
      682000 -- (-488.702) (-490.043) (-489.440) [-488.045] * (-493.118) [-488.232] (-494.187) (-489.307) -- 0:00:18
      682500 -- (-488.975) (-495.561) [-487.642] (-490.609) * (-488.322) [-487.619] (-489.360) (-489.410) -- 0:00:18
      683000 -- (-489.169) (-489.945) (-488.251) [-489.846] * (-490.473) (-488.798) (-488.220) [-492.146] -- 0:00:18
      683500 -- (-489.351) [-489.663] (-489.384) (-488.626) * (-489.088) (-489.114) [-490.499] (-489.246) -- 0:00:18
      684000 -- (-490.533) [-489.445] (-490.117) (-488.412) * (-490.179) (-489.950) (-490.781) [-490.375] -- 0:00:18
      684500 -- (-490.763) (-490.272) (-490.339) [-488.744] * (-489.016) (-491.899) (-490.592) [-489.153] -- 0:00:18
      685000 -- (-488.958) (-490.138) [-491.027] (-491.340) * (-491.935) (-488.068) (-495.379) [-488.466] -- 0:00:18

      Average standard deviation of split frequencies: 0.007971

      685500 -- (-487.793) [-487.611] (-488.218) (-491.398) * [-489.241] (-489.178) (-492.094) (-488.960) -- 0:00:18
      686000 -- (-490.855) [-487.371] (-490.335) (-489.344) * (-489.513) [-491.818] (-492.625) (-496.453) -- 0:00:18
      686500 -- (-489.119) (-490.635) (-491.277) [-488.306] * (-488.306) [-489.730] (-488.918) (-495.367) -- 0:00:18
      687000 -- (-489.102) (-491.234) (-491.170) [-488.984] * (-490.420) [-488.500] (-488.279) (-495.250) -- 0:00:18
      687500 -- [-488.050] (-487.937) (-488.025) (-489.203) * (-490.091) (-490.761) (-487.367) [-490.165] -- 0:00:18
      688000 -- [-487.908] (-489.075) (-489.485) (-489.255) * (-493.332) [-489.986] (-488.434) (-491.178) -- 0:00:18
      688500 -- (-489.550) (-489.786) (-489.920) [-489.082] * (-490.950) (-493.085) [-488.650] (-490.875) -- 0:00:18
      689000 -- [-490.139] (-491.301) (-491.542) (-489.558) * (-490.721) (-489.395) [-488.381] (-493.508) -- 0:00:18
      689500 -- (-490.858) (-491.251) [-492.440] (-494.321) * (-490.989) (-488.684) (-493.066) [-491.977] -- 0:00:18
      690000 -- [-488.515] (-492.160) (-491.841) (-487.807) * (-493.514) [-490.170] (-488.397) (-489.166) -- 0:00:18

      Average standard deviation of split frequencies: 0.007144

      690500 -- (-489.569) (-489.387) [-493.159] (-491.776) * (-496.251) [-488.326] (-491.375) (-489.418) -- 0:00:18
      691000 -- [-487.711] (-494.854) (-491.374) (-489.352) * (-490.400) (-489.695) (-493.002) [-488.338] -- 0:00:18
      691500 -- (-487.993) [-492.263] (-488.742) (-490.460) * [-491.119] (-489.730) (-489.110) (-489.571) -- 0:00:18
      692000 -- (-488.917) (-491.899) [-490.020] (-488.110) * (-491.849) [-489.397] (-491.822) (-492.540) -- 0:00:18
      692500 -- [-490.345] (-488.206) (-491.546) (-489.167) * (-492.937) [-488.801] (-489.368) (-493.329) -- 0:00:18
      693000 -- (-488.448) [-490.279] (-491.416) (-492.522) * [-493.826] (-487.816) (-488.030) (-494.311) -- 0:00:18
      693500 -- (-488.389) (-488.557) (-489.722) [-488.323] * (-491.240) [-487.810] (-488.945) (-490.272) -- 0:00:18
      694000 -- (-488.036) (-491.781) (-488.332) [-487.596] * (-494.397) (-488.111) (-491.203) [-488.196] -- 0:00:18
      694500 -- (-491.025) [-487.900] (-489.464) (-488.272) * [-488.418] (-488.010) (-490.020) (-489.791) -- 0:00:18
      695000 -- (-491.412) [-489.604] (-490.138) (-494.017) * (-489.318) [-488.790] (-489.984) (-488.705) -- 0:00:17

      Average standard deviation of split frequencies: 0.007360

      695500 -- [-488.212] (-488.365) (-488.913) (-488.452) * (-489.400) (-489.134) [-491.082] (-489.976) -- 0:00:17
      696000 -- [-488.154] (-491.053) (-489.270) (-488.559) * (-488.160) [-489.153] (-494.314) (-489.193) -- 0:00:17
      696500 -- (-490.188) (-492.681) [-488.928] (-489.186) * (-491.184) [-491.637] (-491.502) (-492.271) -- 0:00:17
      697000 -- [-489.128] (-489.549) (-495.215) (-487.996) * (-488.170) [-491.104] (-487.901) (-492.254) -- 0:00:17
      697500 -- (-490.589) [-488.610] (-490.262) (-488.677) * (-490.902) (-489.269) [-488.421] (-489.448) -- 0:00:17
      698000 -- (-491.081) [-488.402] (-492.718) (-490.641) * [-490.521] (-489.035) (-488.028) (-489.018) -- 0:00:17
      698500 -- (-491.242) (-488.503) [-491.961] (-489.100) * [-490.772] (-488.660) (-488.975) (-488.099) -- 0:00:17
      699000 -- (-490.294) (-488.497) [-491.282] (-489.028) * [-491.241] (-490.384) (-489.304) (-487.892) -- 0:00:17
      699500 -- (-487.675) (-489.296) [-490.167] (-490.817) * (-491.251) (-490.345) (-495.013) [-488.317] -- 0:00:17
      700000 -- (-487.405) [-489.950] (-489.271) (-489.674) * (-491.736) [-489.077] (-491.057) (-488.694) -- 0:00:17

      Average standard deviation of split frequencies: 0.007715

      700500 -- (-488.533) (-489.889) [-488.562] (-488.995) * (-488.359) (-488.517) [-490.093] (-489.880) -- 0:00:17
      701000 -- (-494.547) [-489.650] (-489.171) (-487.903) * [-489.034] (-487.840) (-487.863) (-487.840) -- 0:00:17
      701500 -- (-493.154) (-489.934) (-489.165) [-488.575] * [-489.536] (-490.688) (-489.667) (-488.784) -- 0:00:17
      702000 -- (-490.203) (-490.333) (-492.920) [-488.448] * [-489.165] (-489.787) (-490.796) (-488.470) -- 0:00:17
      702500 -- (-492.757) (-494.493) [-488.374] (-488.673) * (-489.796) [-491.910] (-494.123) (-489.231) -- 0:00:17
      703000 -- [-490.188] (-490.153) (-489.117) (-488.188) * (-488.069) [-487.981] (-488.852) (-493.256) -- 0:00:17
      703500 -- [-492.878] (-492.135) (-494.445) (-488.912) * (-488.856) (-489.623) [-487.867] (-490.335) -- 0:00:17
      704000 -- (-488.987) [-488.004] (-491.601) (-488.234) * (-489.164) [-488.254] (-489.087) (-488.140) -- 0:00:17
      704500 -- (-488.997) (-487.825) (-489.751) [-490.751] * (-488.695) (-488.757) [-490.411] (-488.488) -- 0:00:17
      705000 -- (-492.209) [-493.248] (-491.110) (-489.434) * (-491.493) (-488.306) [-489.956] (-487.555) -- 0:00:17

      Average standard deviation of split frequencies: 0.007523

      705500 -- [-488.983] (-491.531) (-489.397) (-488.124) * (-492.578) (-489.423) [-492.865] (-489.010) -- 0:00:17
      706000 -- (-495.709) (-489.008) (-493.491) [-489.402] * (-491.938) [-490.638] (-490.082) (-489.599) -- 0:00:17
      706500 -- [-489.169] (-489.803) (-490.066) (-491.265) * (-490.999) [-489.579] (-489.215) (-489.043) -- 0:00:17
      707000 -- (-488.979) (-489.852) (-491.893) [-489.670] * (-493.136) [-488.431] (-488.241) (-489.353) -- 0:00:17
      707500 -- (-487.990) [-495.002] (-491.139) (-490.612) * (-488.371) (-489.098) (-491.752) [-487.624] -- 0:00:17
      708000 -- (-490.992) (-492.262) (-489.155) [-487.620] * (-490.630) [-487.910] (-488.738) (-489.941) -- 0:00:17
      708500 -- (-488.619) (-490.524) [-489.099] (-487.618) * (-492.116) (-491.819) (-487.818) [-488.266] -- 0:00:17
      709000 -- (-489.227) (-488.650) (-488.464) [-491.022] * (-491.147) [-490.555] (-489.927) (-489.328) -- 0:00:17
      709500 -- [-488.901] (-491.472) (-488.718) (-490.344) * (-488.902) [-488.153] (-493.845) (-489.397) -- 0:00:17
      710000 -- (-489.980) [-490.372] (-489.217) (-491.061) * (-487.914) (-489.016) (-493.024) [-489.160] -- 0:00:17

      Average standard deviation of split frequencies: 0.007208

      710500 -- (-488.640) (-490.056) [-487.391] (-490.588) * [-491.489] (-490.828) (-492.033) (-489.550) -- 0:00:17
      711000 -- [-487.909] (-493.098) (-487.924) (-488.349) * [-492.166] (-489.176) (-490.323) (-488.927) -- 0:00:17
      711500 -- (-489.177) [-487.879] (-491.297) (-488.044) * (-495.464) [-491.840] (-489.597) (-491.181) -- 0:00:17
      712000 -- (-490.208) (-488.097) [-489.343] (-490.063) * (-491.234) (-493.754) (-491.563) [-492.973] -- 0:00:16
      712500 -- (-488.974) [-490.310] (-488.398) (-489.128) * (-491.762) [-489.646] (-487.999) (-488.403) -- 0:00:16
      713000 -- (-489.957) (-490.891) [-492.963] (-488.572) * (-488.060) [-489.129] (-488.711) (-489.746) -- 0:00:16
      713500 -- (-493.198) (-490.872) (-493.347) [-489.099] * (-489.310) [-490.433] (-491.907) (-488.192) -- 0:00:16
      714000 -- [-489.440] (-487.944) (-497.153) (-490.034) * (-490.387) [-491.250] (-490.316) (-489.498) -- 0:00:16
      714500 -- (-489.164) [-489.725] (-491.503) (-490.930) * [-491.517] (-488.665) (-490.859) (-492.909) -- 0:00:16
      715000 -- [-488.780] (-489.301) (-489.343) (-488.233) * [-488.590] (-488.912) (-489.176) (-491.194) -- 0:00:16

      Average standard deviation of split frequencies: 0.006803

      715500 -- [-487.798] (-490.638) (-489.846) (-489.273) * [-489.514] (-489.895) (-489.895) (-489.432) -- 0:00:16
      716000 -- [-488.795] (-488.717) (-490.461) (-490.357) * [-489.882] (-489.312) (-492.123) (-489.993) -- 0:00:16
      716500 -- (-488.591) [-489.047] (-488.334) (-489.947) * [-488.792] (-489.700) (-487.572) (-489.510) -- 0:00:16
      717000 -- (-489.098) (-487.948) [-488.890] (-491.387) * (-489.312) [-488.664] (-488.759) (-489.258) -- 0:00:16
      717500 -- (-491.123) (-489.763) [-489.633] (-492.329) * (-488.962) [-488.931] (-490.212) (-490.085) -- 0:00:16
      718000 -- (-493.659) (-489.957) (-490.113) [-488.120] * (-488.089) (-489.090) [-488.462] (-488.407) -- 0:00:16
      718500 -- (-489.982) (-491.442) (-490.098) [-489.693] * (-488.089) [-490.534] (-493.995) (-489.186) -- 0:00:16
      719000 -- (-487.594) [-493.592] (-490.348) (-490.266) * (-491.318) [-490.168] (-491.104) (-492.655) -- 0:00:16
      719500 -- [-488.341] (-496.044) (-492.927) (-488.082) * (-490.482) (-490.462) [-489.603] (-490.790) -- 0:00:16
      720000 -- [-488.780] (-494.283) (-488.150) (-488.808) * [-490.681] (-496.690) (-489.946) (-495.430) -- 0:00:16

      Average standard deviation of split frequencies: 0.006672

      720500 -- (-489.153) (-488.513) (-489.299) [-489.016] * [-488.302] (-491.686) (-488.586) (-489.753) -- 0:00:16
      721000 -- [-488.612] (-489.894) (-489.719) (-487.472) * (-488.949) [-488.248] (-490.266) (-489.689) -- 0:00:16
      721500 -- (-489.697) (-488.914) [-487.865] (-491.142) * [-488.355] (-493.108) (-488.953) (-488.335) -- 0:00:16
      722000 -- (-490.556) [-491.100] (-492.325) (-488.613) * (-488.576) (-490.769) [-488.588] (-489.231) -- 0:00:16
      722500 -- (-489.138) (-488.734) (-489.344) [-487.503] * (-492.017) (-489.111) (-488.821) [-490.803] -- 0:00:16
      723000 -- [-490.425] (-490.731) (-490.418) (-489.250) * (-489.743) [-490.849] (-488.399) (-488.154) -- 0:00:16
      723500 -- (-489.840) (-488.130) [-491.483] (-494.157) * (-487.862) [-489.736] (-489.339) (-489.926) -- 0:00:16
      724000 -- [-489.749] (-488.072) (-491.244) (-492.437) * (-488.503) [-490.141] (-489.689) (-489.290) -- 0:00:16
      724500 -- (-488.467) [-489.121] (-491.753) (-489.885) * (-488.173) (-489.735) [-491.712] (-489.199) -- 0:00:16
      725000 -- (-489.421) [-488.603] (-493.253) (-495.186) * (-488.168) [-489.706] (-491.076) (-490.404) -- 0:00:16

      Average standard deviation of split frequencies: 0.006623

      725500 -- (-490.045) (-492.760) (-490.160) [-489.962] * (-488.023) (-488.259) [-490.321] (-490.091) -- 0:00:16
      726000 -- (-493.302) (-490.883) (-489.756) [-491.824] * (-492.616) (-488.929) [-487.543] (-487.285) -- 0:00:16
      726500 -- [-489.796] (-489.437) (-489.278) (-489.561) * (-490.426) (-488.604) [-487.541] (-490.448) -- 0:00:16
      727000 -- (-489.099) [-488.524] (-491.797) (-491.223) * (-490.207) (-490.692) [-487.574] (-488.813) -- 0:00:16
      727500 -- (-488.929) (-489.025) (-488.680) [-488.461] * (-489.759) (-491.911) (-488.098) [-493.386] -- 0:00:16
      728000 -- (-491.843) (-488.571) (-490.064) [-492.999] * (-492.565) (-491.554) (-491.600) [-489.651] -- 0:00:16
      728500 -- (-488.565) (-488.746) (-488.396) [-488.283] * (-488.197) (-490.511) (-489.786) [-488.276] -- 0:00:16
      729000 -- (-492.255) (-489.687) (-488.567) [-488.456] * (-488.171) (-491.138) [-490.436] (-489.083) -- 0:00:15
      729500 -- (-489.742) [-490.167] (-489.833) (-489.787) * (-489.995) [-487.886] (-488.403) (-489.865) -- 0:00:15
      730000 -- (-488.520) (-491.038) [-488.944] (-488.022) * [-489.475] (-489.865) (-488.286) (-489.446) -- 0:00:15

      Average standard deviation of split frequencies: 0.006194

      730500 -- [-487.873] (-488.955) (-488.883) (-489.917) * (-493.253) (-491.717) (-488.419) [-490.405] -- 0:00:15
      731000 -- (-492.774) [-488.039] (-493.070) (-488.180) * [-488.792] (-490.122) (-487.764) (-490.479) -- 0:00:15
      731500 -- [-489.458] (-488.593) (-492.931) (-495.197) * (-490.128) [-489.766] (-487.698) (-489.308) -- 0:00:15
      732000 -- (-487.316) (-491.397) [-489.329] (-487.658) * (-491.502) (-487.654) (-488.531) [-490.153] -- 0:00:15
      732500 -- (-489.489) [-493.188] (-490.243) (-487.830) * (-491.003) (-492.273) (-489.858) [-488.315] -- 0:00:15
      733000 -- (-491.222) [-491.905] (-491.957) (-492.018) * (-491.812) (-493.823) (-488.352) [-489.893] -- 0:00:15
      733500 -- [-489.452] (-493.356) (-488.047) (-493.758) * (-490.438) (-495.815) (-488.487) [-492.031] -- 0:00:15
      734000 -- (-488.955) (-488.019) [-489.631] (-489.009) * [-489.582] (-488.412) (-488.280) (-491.098) -- 0:00:15
      734500 -- (-489.021) (-496.008) [-488.913] (-489.302) * (-489.348) (-487.979) [-490.872] (-492.093) -- 0:00:15
      735000 -- (-489.041) (-492.297) [-488.455] (-490.940) * (-493.385) (-489.112) [-487.653] (-493.716) -- 0:00:15

      Average standard deviation of split frequencies: 0.006320

      735500 -- (-489.105) (-488.073) (-490.538) [-489.734] * [-491.423] (-492.246) (-487.791) (-493.199) -- 0:00:15
      736000 -- (-489.968) (-489.674) (-494.935) [-488.110] * [-489.240] (-488.464) (-489.036) (-491.021) -- 0:00:15
      736500 -- (-488.787) [-488.639] (-490.056) (-487.865) * (-488.673) (-492.685) (-488.990) [-490.399] -- 0:00:15
      737000 -- (-488.115) [-488.497] (-490.259) (-490.489) * (-488.455) [-489.987] (-487.715) (-494.866) -- 0:00:15
      737500 -- [-488.956] (-489.875) (-490.938) (-490.781) * [-488.388] (-490.409) (-489.479) (-494.263) -- 0:00:15
      738000 -- [-488.304] (-490.440) (-488.834) (-492.237) * (-490.404) [-489.530] (-492.330) (-495.008) -- 0:00:15
      738500 -- (-487.894) (-489.807) (-491.782) [-490.474] * [-490.983] (-491.162) (-488.300) (-489.818) -- 0:00:15
      739000 -- [-488.186] (-489.891) (-488.489) (-487.936) * (-489.490) (-491.258) [-488.036] (-491.475) -- 0:00:15
      739500 -- (-489.708) (-488.004) (-494.012) [-488.182] * [-489.230] (-489.781) (-487.750) (-489.404) -- 0:00:15
      740000 -- (-493.392) (-492.846) [-489.130] (-489.130) * [-488.903] (-488.378) (-488.530) (-489.372) -- 0:00:15

      Average standard deviation of split frequencies: 0.005474

      740500 -- (-489.647) (-488.955) [-489.864] (-490.460) * [-488.202] (-490.670) (-489.933) (-488.361) -- 0:00:15
      741000 -- (-490.087) (-488.895) [-492.991] (-487.617) * (-488.239) [-489.736] (-488.505) (-491.498) -- 0:00:15
      741500 -- (-488.940) (-488.307) (-491.334) [-488.016] * (-488.642) (-489.200) (-488.492) [-492.651] -- 0:00:15
      742000 -- [-489.745] (-489.824) (-491.388) (-489.728) * (-488.891) (-491.588) [-489.011] (-493.001) -- 0:00:15
      742500 -- (-490.065) (-490.067) (-490.430) [-490.639] * (-490.244) [-489.433] (-488.668) (-493.380) -- 0:00:15
      743000 -- (-492.828) (-490.806) (-489.472) [-488.695] * (-487.830) (-490.351) [-488.123] (-489.286) -- 0:00:15
      743500 -- [-490.042] (-491.710) (-490.393) (-489.437) * [-489.617] (-491.522) (-487.896) (-488.635) -- 0:00:15
      744000 -- (-494.577) (-493.297) [-490.528] (-494.115) * [-490.894] (-488.510) (-487.936) (-491.405) -- 0:00:15
      744500 -- (-488.125) (-492.161) (-490.064) [-491.287] * (-489.637) (-488.014) (-492.230) [-489.687] -- 0:00:15
      745000 -- [-489.319] (-488.958) (-490.497) (-488.292) * (-494.322) (-489.749) (-489.371) [-488.812] -- 0:00:15

      Average standard deviation of split frequencies: 0.005898

      745500 -- (-490.469) (-488.377) (-490.728) [-490.530] * (-492.513) (-493.733) (-489.041) [-489.291] -- 0:00:15
      746000 -- (-487.891) (-488.663) [-488.631] (-489.749) * (-490.370) [-490.364] (-487.662) (-493.065) -- 0:00:14
      746500 -- (-488.328) (-487.712) (-488.253) [-490.660] * [-489.761] (-489.811) (-489.533) (-493.905) -- 0:00:14
      747000 -- (-488.676) [-488.946] (-489.603) (-490.915) * (-492.495) (-489.691) [-494.189] (-489.187) -- 0:00:14
      747500 -- (-489.369) (-487.728) [-492.798] (-489.787) * (-493.004) (-491.474) (-489.837) [-488.346] -- 0:00:14
      748000 -- [-489.230] (-488.529) (-492.955) (-491.753) * (-490.629) [-487.824] (-491.585) (-489.889) -- 0:00:14
      748500 -- [-488.872] (-488.254) (-492.438) (-499.145) * (-489.080) (-487.860) (-495.069) [-492.346] -- 0:00:14
      749000 -- (-489.897) (-487.733) (-493.002) [-489.477] * (-489.453) (-488.910) [-489.380] (-488.097) -- 0:00:14
      749500 -- (-489.382) (-487.775) [-489.243] (-489.058) * (-491.382) (-490.813) [-487.795] (-488.314) -- 0:00:14
      750000 -- (-491.056) (-489.601) (-490.410) [-488.759] * (-490.885) [-490.272] (-489.481) (-489.473) -- 0:00:14

      Average standard deviation of split frequencies: 0.006029

      750500 -- (-490.618) (-487.869) (-491.692) [-491.098] * (-490.386) [-491.501] (-489.452) (-491.761) -- 0:00:14
      751000 -- (-491.782) (-490.061) [-489.193] (-489.426) * (-493.681) (-491.719) (-490.440) [-492.967] -- 0:00:14
      751500 -- (-491.639) (-489.055) [-488.667] (-488.233) * [-491.802] (-492.104) (-489.247) (-490.435) -- 0:00:14
      752000 -- (-490.805) (-490.165) (-488.646) [-490.892] * [-488.301] (-489.395) (-488.466) (-489.366) -- 0:00:14
      752500 -- [-490.382] (-490.054) (-490.560) (-491.534) * [-490.652] (-489.541) (-496.461) (-490.491) -- 0:00:14
      753000 -- (-488.994) (-491.105) (-489.542) [-496.610] * (-488.191) (-487.767) [-493.119] (-492.054) -- 0:00:14
      753500 -- (-488.733) (-490.259) [-492.826] (-489.433) * (-489.930) (-488.736) (-489.270) [-489.670] -- 0:00:14
      754000 -- (-491.581) [-490.144] (-490.961) (-488.808) * (-489.046) (-490.642) (-489.160) [-490.657] -- 0:00:14
      754500 -- [-489.042] (-488.519) (-490.982) (-489.131) * [-489.954] (-489.005) (-488.487) (-489.951) -- 0:00:14
      755000 -- (-489.886) [-488.581] (-493.567) (-487.782) * (-488.112) (-490.039) [-490.586] (-489.968) -- 0:00:14

      Average standard deviation of split frequencies: 0.006319

      755500 -- (-490.335) (-490.560) (-494.097) [-488.164] * (-490.151) [-488.865] (-489.840) (-490.489) -- 0:00:14
      756000 -- (-489.475) (-491.575) [-489.814] (-489.363) * (-488.666) (-489.400) (-488.907) [-488.006] -- 0:00:14
      756500 -- (-492.010) [-492.194] (-489.340) (-492.040) * (-488.967) (-489.348) (-488.195) [-490.367] -- 0:00:14
      757000 -- (-489.237) (-489.085) (-490.715) [-489.173] * (-488.153) (-487.749) (-488.358) [-492.164] -- 0:00:14
      757500 -- [-490.385] (-488.431) (-490.647) (-488.149) * (-490.611) (-490.788) (-488.161) [-489.584] -- 0:00:14
      758000 -- [-488.309] (-489.075) (-490.632) (-490.861) * (-488.682) (-490.474) (-490.566) [-488.325] -- 0:00:14
      758500 -- [-488.235] (-487.726) (-491.558) (-491.717) * (-496.940) (-490.697) (-488.967) [-488.262] -- 0:00:14
      759000 -- (-489.163) [-488.969] (-491.023) (-489.571) * [-494.138] (-489.010) (-490.769) (-488.878) -- 0:00:14
      759500 -- [-488.862] (-489.908) (-489.525) (-492.217) * (-490.271) (-489.325) (-490.199) [-488.962] -- 0:00:14
      760000 -- (-487.824) [-488.333] (-489.366) (-492.580) * [-490.857] (-489.247) (-488.497) (-487.877) -- 0:00:14

      Average standard deviation of split frequencies: 0.006693

      760500 -- (-490.750) [-491.863] (-491.643) (-491.917) * (-490.275) (-490.086) (-488.981) [-487.776] -- 0:00:14
      761000 -- (-490.608) (-490.610) [-490.829] (-488.428) * (-491.154) [-489.015] (-489.413) (-489.322) -- 0:00:14
      761500 -- [-488.462] (-489.060)