--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:28:35 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0271/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -489.02 -492.21
2 -489.07 -494.44
--------------------------------------
TOTAL -489.05 -493.85
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900128 0.088853 0.350188 1.464683 0.863917 1349.44 1375.32 1.000
r(A<->C){all} 0.172074 0.021095 0.000014 0.467901 0.132118 357.67 359.77 1.001
r(A<->G){all} 0.175271 0.021052 0.000068 0.459692 0.137203 207.64 225.12 1.000
r(A<->T){all} 0.174066 0.021147 0.000056 0.460526 0.135433 155.93 231.43 1.003
r(C<->G){all} 0.171021 0.020471 0.000151 0.455174 0.136085 245.89 257.68 1.000
r(C<->T){all} 0.161538 0.018432 0.000021 0.428921 0.126245 301.88 328.38 1.002
r(G<->T){all} 0.146030 0.015709 0.000042 0.403690 0.110331 198.26 226.05 1.012
pi(A){all} 0.115912 0.000274 0.084297 0.149378 0.115745 1248.67 1374.83 1.000
pi(C){all} 0.276573 0.000526 0.232424 0.320675 0.275836 1386.36 1428.07 1.000
pi(G){all} 0.348058 0.000601 0.301757 0.397773 0.347183 1032.23 1122.93 1.000
pi(T){all} 0.259457 0.000519 0.218245 0.306431 0.258817 1367.61 1372.18 1.001
alpha{1,2} 0.413829 0.219987 0.000246 1.347485 0.248585 1158.63 1291.99 1.000
alpha{3} 0.455291 0.238589 0.000272 1.451697 0.290701 1162.86 1198.16 1.000
pinvar{all} 0.995544 0.000027 0.985214 0.999996 0.997183 1501.00 1501.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -473.952972
Model 2: PositiveSelection -473.952972
Model 0: one-ratio -473.952975
Model 7: beta -473.952965
Model 8: beta&w>1 -473.952973
Model 0 vs 1 5.999999984851456E-6
Model 2 vs 1 0.0
Model 8 vs 7 1.5999999959603883E-5
>C1
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C2
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C3
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C4
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C5
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C6
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=123
C1 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C2 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C3 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C4 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C5 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C6 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
**************************************************
C1 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C2 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C3 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C4 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C5 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C6 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
**************************************************
C1 TTAALFLGWRAVVELILRRRSTR
C2 TTAALFLGWRAVVELILRRRSTR
C3 TTAALFLGWRAVVELILRRRSTR
C4 TTAALFLGWRAVVELILRRRSTR
C5 TTAALFLGWRAVVELILRRRSTR
C6 TTAALFLGWRAVVELILRRRSTR
***********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3690]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3690]--->[3690]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.460 Mb, Max= 30.652 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C2 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C3 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C4 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C5 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
C6 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
**************************************************
C1 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C2 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C3 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C4 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C5 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
C6 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
**************************************************
C1 TTAALFLGWRAVVELILRRRSTR
C2 TTAALFLGWRAVVELILRRRSTR
C3 TTAALFLGWRAVVELILRRRSTR
C4 TTAALFLGWRAVVELILRRRSTR
C5 TTAALFLGWRAVVELILRRRSTR
C6 TTAALFLGWRAVVELILRRRSTR
***********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C2 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C3 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C4 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C5 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
C6 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
**************************************************
C1 GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C2 GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C3 GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C4 GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C5 GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
C6 GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
**************************************************
C1 TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C2 TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C3 TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C4 TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C5 TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
C6 TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
**************************************************
C1 GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C2 GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C3 GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C4 GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C5 GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
C6 GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
**************************************************
C1 CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C2 CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C3 CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C4 CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C5 CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
C6 CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
**************************************************
C1 AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C2 AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C3 AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C4 AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C5 AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
C6 AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
**************************************************
C1 ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C2 ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C3 ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C4 ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C5 ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
C6 ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
**************************************************
C1 GAGGCGTCGCTCAACGCGT
C2 GAGGCGTCGCTCAACGCGT
C3 GAGGCGTCGCTCAACGCGT
C4 GAGGCGTCGCTCAACGCGT
C5 GAGGCGTCGCTCAACGCGT
C6 GAGGCGTCGCTCAACGCGT
*******************
>C1
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C2
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C3
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C4
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C5
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C6
ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT
GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG
TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT
GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC
CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA
AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG
ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT
GAGGCGTCGCTCAACGCGT
>C1
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C2
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C3
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C4
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C5
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
>C6
MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
TTAALFLGWRAVVELILRRRSTR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 369 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579796844
Setting output file names to "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1961589369
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0539252201
Seed = 1598031998
Swapseed = 1579796844
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -825.839685 -- -24.965149
Chain 2 -- -825.839560 -- -24.965149
Chain 3 -- -825.839560 -- -24.965149
Chain 4 -- -825.839560 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -825.839685 -- -24.965149
Chain 2 -- -825.839685 -- -24.965149
Chain 3 -- -825.839685 -- -24.965149
Chain 4 -- -825.839685 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-825.840] (-825.840) (-825.840) (-825.840) * [-825.840] (-825.840) (-825.840) (-825.840)
500 -- (-516.210) (-506.460) (-508.865) [-509.359] * (-504.457) [-500.650] (-513.866) (-500.982) -- 0:00:00
1000 -- (-516.258) (-502.529) (-498.912) [-506.881] * (-501.325) (-507.352) [-501.854] (-495.645) -- 0:00:00
1500 -- (-500.814) (-500.302) (-495.511) [-500.206] * (-495.274) [-497.232] (-501.900) (-496.257) -- 0:00:00
2000 -- [-499.006] (-493.818) (-500.899) (-500.059) * (-498.786) [-498.848] (-500.513) (-497.863) -- 0:00:00
2500 -- (-505.704) (-497.667) (-496.557) [-498.237] * [-494.854] (-500.967) (-499.286) (-498.755) -- 0:00:00
3000 -- (-498.168) (-500.026) [-492.037] (-501.212) * (-509.883) [-497.678] (-498.273) (-507.077) -- 0:00:00
3500 -- (-503.467) (-499.670) [-492.872] (-496.152) * [-490.889] (-501.939) (-496.975) (-496.584) -- 0:00:00
4000 -- (-496.767) (-495.461) [-504.969] (-503.315) * (-500.845) (-499.352) [-496.088] (-497.731) -- 0:00:00
4500 -- [-499.107] (-498.312) (-501.102) (-500.053) * (-498.441) (-504.126) (-501.086) [-491.160] -- 0:00:00
5000 -- (-497.464) (-506.149) (-503.791) [-495.686] * (-507.091) (-506.417) (-504.756) [-500.518] -- 0:00:00
Average standard deviation of split frequencies: 0.085115
5500 -- [-497.107] (-505.045) (-498.804) (-503.226) * [-505.627] (-505.981) (-498.418) (-503.282) -- 0:00:00
6000 -- (-495.045) (-502.209) (-496.312) [-494.886] * (-501.296) (-503.189) [-497.120] (-499.029) -- 0:00:00
6500 -- (-501.175) (-498.455) [-497.933] (-502.718) * (-496.192) (-497.214) [-495.451] (-499.611) -- 0:00:00
7000 -- [-496.615] (-496.417) (-495.193) (-498.083) * (-503.478) (-495.348) [-494.543] (-494.517) -- 0:00:00
7500 -- (-495.999) (-500.928) [-498.427] (-508.071) * (-501.242) (-494.673) [-498.855] (-501.918) -- 0:00:00
8000 -- (-497.491) (-502.531) [-498.432] (-497.979) * (-501.609) (-492.062) [-498.595] (-502.681) -- 0:00:00
8500 -- (-503.744) [-496.830] (-501.999) (-497.267) * [-494.563] (-498.395) (-505.557) (-499.006) -- 0:00:00
9000 -- (-494.015) (-500.259) [-497.919] (-501.004) * (-500.277) [-495.667] (-501.516) (-495.120) -- 0:00:00
9500 -- (-499.636) (-506.549) [-500.883] (-495.579) * (-502.501) (-501.513) (-501.829) [-499.122] -- 0:00:00
10000 -- [-493.951] (-500.389) (-499.545) (-501.748) * (-497.965) (-498.451) [-493.150] (-501.676) -- 0:00:00
Average standard deviation of split frequencies: 0.086284
10500 -- (-494.579) (-501.353) [-493.902] (-509.936) * (-498.907) [-495.166] (-498.638) (-500.375) -- 0:01:34
11000 -- (-497.622) (-503.000) (-502.682) [-496.994] * (-500.628) (-500.773) [-495.698] (-502.962) -- 0:01:29
11500 -- (-501.702) (-498.509) [-499.190] (-494.940) * (-504.310) (-509.737) (-505.146) [-501.617] -- 0:01:25
12000 -- (-496.039) (-494.069) [-496.334] (-499.667) * (-501.474) [-503.980] (-503.861) (-497.297) -- 0:01:22
12500 -- (-494.253) [-497.159] (-497.523) (-504.043) * (-498.692) (-502.258) [-496.307] (-500.694) -- 0:01:19
13000 -- [-492.392] (-496.224) (-500.972) (-519.888) * [-492.173] (-498.179) (-510.296) (-496.678) -- 0:01:15
13500 -- (-497.459) [-500.929] (-496.287) (-502.948) * (-496.168) (-497.550) (-500.043) [-494.429] -- 0:01:13
14000 -- (-499.912) [-494.566] (-500.532) (-500.719) * (-501.828) (-496.281) (-506.002) [-497.259] -- 0:01:10
14500 -- (-496.618) (-514.733) (-497.518) [-496.089] * (-500.279) [-497.790] (-507.227) (-502.326) -- 0:01:07
15000 -- (-495.902) (-512.713) [-496.556] (-488.469) * [-498.942] (-500.574) (-499.670) (-505.464) -- 0:01:05
Average standard deviation of split frequencies: 0.068746
15500 -- (-498.906) (-497.516) [-498.798] (-487.734) * [-501.072] (-497.835) (-499.540) (-501.697) -- 0:01:03
16000 -- (-499.987) [-491.311] (-501.021) (-495.061) * (-499.015) (-500.138) [-495.585] (-508.404) -- 0:01:01
16500 -- (-499.098) [-488.295] (-503.344) (-489.771) * (-511.310) (-494.870) (-503.925) [-500.817] -- 0:00:59
17000 -- (-500.039) [-488.794] (-497.998) (-488.892) * (-498.783) (-501.702) (-493.935) [-502.130] -- 0:00:57
17500 -- (-496.927) [-489.876] (-498.388) (-488.802) * (-495.501) (-502.412) [-498.293] (-503.184) -- 0:00:56
18000 -- (-503.964) [-490.176] (-502.553) (-492.871) * (-498.104) [-493.738] (-504.792) (-499.669) -- 0:00:54
18500 -- (-501.579) (-490.968) (-499.120) [-489.904] * [-499.893] (-497.972) (-507.906) (-500.192) -- 0:00:53
19000 -- (-500.970) (-491.307) (-498.853) [-493.189] * (-502.827) [-495.503] (-503.891) (-497.266) -- 0:00:51
19500 -- [-495.611] (-488.557) (-494.602) (-490.917) * (-498.716) (-502.296) (-513.138) [-496.169] -- 0:00:50
20000 -- (-497.165) [-490.239] (-500.254) (-491.095) * [-492.852] (-500.636) (-510.987) (-504.166) -- 0:00:49
Average standard deviation of split frequencies: 0.058450
20500 -- (-496.767) [-489.720] (-496.659) (-489.312) * (-497.216) [-496.914] (-509.671) (-497.651) -- 0:00:47
21000 -- [-499.360] (-490.535) (-497.371) (-489.782) * (-496.014) [-502.252] (-493.763) (-500.366) -- 0:00:46
21500 -- (-497.364) (-489.399) (-497.914) [-489.232] * [-498.632] (-508.052) (-492.812) (-503.373) -- 0:00:45
22000 -- (-501.026) [-489.164] (-499.615) (-488.952) * (-502.292) (-502.963) [-492.486] (-493.870) -- 0:00:44
22500 -- [-500.884] (-494.345) (-501.472) (-489.298) * (-502.994) (-500.624) (-489.844) [-501.739] -- 0:00:43
23000 -- (-490.352) (-488.726) [-494.112] (-490.664) * (-495.464) (-489.257) (-487.958) [-497.390] -- 0:00:42
23500 -- (-513.204) (-489.738) (-505.739) [-489.708] * (-502.899) (-488.820) [-490.325] (-506.504) -- 0:00:41
24000 -- (-493.296) (-491.275) (-499.895) [-489.338] * (-499.455) (-489.527) (-488.364) [-496.717] -- 0:00:40
24500 -- (-500.670) (-488.389) [-495.960] (-488.182) * (-497.111) [-489.458] (-490.924) (-505.195) -- 0:00:39
25000 -- [-502.190] (-490.955) (-496.367) (-487.736) * (-506.698) (-491.789) [-488.439] (-500.399) -- 0:00:39
Average standard deviation of split frequencies: 0.041207
25500 -- (-500.800) (-491.887) [-498.134] (-488.413) * (-503.813) (-491.724) [-488.764] (-497.385) -- 0:00:38
26000 -- (-499.188) (-489.418) [-493.381] (-497.103) * (-507.266) (-489.866) (-488.879) [-500.529] -- 0:00:37
26500 -- (-498.437) (-494.210) [-495.959] (-489.264) * (-502.109) (-492.276) [-488.457] (-497.323) -- 0:01:13
27000 -- [-498.085] (-496.679) (-506.153) (-494.261) * (-495.957) (-488.701) (-489.094) [-499.001] -- 0:01:12
27500 -- (-496.501) (-494.331) [-499.299] (-492.594) * (-494.645) (-489.236) (-489.074) [-498.862] -- 0:01:10
28000 -- (-500.423) [-488.726] (-507.370) (-489.327) * (-496.120) (-490.555) [-487.782] (-496.289) -- 0:01:09
28500 -- [-499.351] (-489.276) (-515.584) (-491.852) * (-493.487) (-489.496) (-491.269) [-501.338] -- 0:01:08
29000 -- (-494.710) (-489.170) (-496.898) [-489.859] * (-498.034) (-489.645) (-492.009) [-501.726] -- 0:01:06
29500 -- [-498.188] (-489.569) (-489.162) (-492.873) * (-494.606) (-494.002) [-488.542] (-518.359) -- 0:01:05
30000 -- (-500.038) (-490.195) (-489.616) [-487.983] * (-497.401) (-491.116) [-488.628] (-507.411) -- 0:01:04
Average standard deviation of split frequencies: 0.040526
30500 -- [-495.990] (-490.184) (-489.084) (-490.369) * [-498.984] (-491.455) (-487.575) (-501.276) -- 0:01:03
31000 -- (-504.482) (-488.043) [-489.295] (-488.127) * (-494.440) (-487.981) (-487.615) [-490.796] -- 0:01:02
31500 -- (-508.947) (-489.394) (-488.928) [-490.105] * (-496.193) [-487.663] (-490.208) (-489.865) -- 0:01:01
32000 -- (-496.545) [-488.995] (-491.546) (-490.433) * (-502.177) (-487.578) (-488.335) [-488.041] -- 0:01:00
32500 -- (-495.756) (-490.260) [-492.618] (-487.799) * (-502.723) (-492.833) (-488.204) [-490.873] -- 0:00:59
33000 -- (-501.178) (-489.502) (-488.127) [-489.502] * [-495.656] (-494.618) (-489.862) (-490.381) -- 0:00:58
33500 -- (-494.429) (-488.474) [-488.444] (-489.972) * [-498.671] (-489.111) (-492.198) (-488.697) -- 0:00:57
34000 -- (-504.704) (-490.735) [-487.986] (-490.748) * (-508.843) [-491.121] (-499.350) (-490.942) -- 0:00:56
34500 -- (-497.438) (-490.545) (-488.001) [-491.105] * (-501.393) [-488.099] (-490.051) (-488.381) -- 0:00:55
35000 -- (-498.392) (-489.749) (-487.706) [-489.771] * (-503.103) (-489.464) (-490.339) [-490.585] -- 0:00:55
Average standard deviation of split frequencies: 0.035838
35500 -- (-499.646) (-491.400) [-487.884] (-489.508) * [-499.270] (-490.905) (-493.372) (-488.706) -- 0:00:54
36000 -- (-499.705) (-490.114) [-490.469] (-489.144) * (-495.915) (-490.472) (-489.570) [-489.306] -- 0:00:53
36500 -- [-497.943] (-491.329) (-489.871) (-489.419) * (-492.399) [-489.218] (-487.675) (-490.402) -- 0:00:52
37000 -- (-500.166) (-491.913) [-489.296] (-490.179) * [-499.956] (-487.820) (-489.580) (-489.931) -- 0:00:52
37500 -- [-503.613] (-488.242) (-490.724) (-487.541) * [-500.844] (-489.518) (-490.586) (-488.263) -- 0:00:51
38000 -- (-501.585) (-489.697) [-488.599] (-488.381) * (-508.599) (-490.032) (-491.385) [-488.421] -- 0:00:50
38500 -- (-496.289) (-488.361) (-488.601) [-488.474] * (-498.573) [-490.208] (-488.927) (-488.926) -- 0:00:49
39000 -- (-500.671) (-492.531) [-489.097] (-487.909) * (-500.700) (-491.492) [-488.115] (-488.410) -- 0:00:49
39500 -- (-504.808) (-492.708) (-488.709) [-494.042] * [-498.520] (-491.450) (-489.179) (-489.509) -- 0:00:48
40000 -- (-501.656) [-489.906] (-489.200) (-491.624) * (-495.338) (-490.629) (-488.952) [-489.957] -- 0:00:48
Average standard deviation of split frequencies: 0.036606
40500 -- (-506.743) (-488.577) (-488.835) [-490.553] * (-496.024) (-489.693) (-490.263) [-489.850] -- 0:00:47
41000 -- [-495.386] (-488.396) (-489.061) (-490.652) * (-502.867) [-487.442] (-487.826) (-491.132) -- 0:00:46
41500 -- (-511.127) (-490.500) (-492.388) [-489.747] * (-498.352) (-489.065) [-491.053] (-491.035) -- 0:00:46
42000 -- [-493.180] (-488.766) (-490.536) (-489.239) * (-499.042) (-489.699) [-488.705] (-490.216) -- 0:00:45
42500 -- (-500.641) (-489.242) [-489.149] (-488.884) * (-501.698) (-491.919) (-495.486) [-489.351] -- 0:00:45
43000 -- [-497.341] (-491.250) (-488.186) (-491.524) * (-507.094) (-489.252) (-492.218) [-488.977] -- 0:01:06
43500 -- (-500.521) (-490.300) (-488.588) [-489.481] * [-495.542] (-491.449) (-488.603) (-490.683) -- 0:01:05
44000 -- [-500.790] (-492.118) (-490.043) (-488.744) * (-496.667) (-490.033) [-488.052] (-487.992) -- 0:01:05
44500 -- (-496.574) (-491.276) [-490.862] (-488.220) * (-500.475) (-489.250) (-489.114) [-489.764] -- 0:01:04
45000 -- (-494.737) (-489.458) (-488.673) [-491.118] * [-497.278] (-489.730) (-488.111) (-493.940) -- 0:01:03
Average standard deviation of split frequencies: 0.028304
45500 -- (-497.536) (-489.017) [-489.314] (-488.619) * (-501.860) (-488.399) (-490.992) [-491.688] -- 0:01:02
46000 -- (-508.263) (-490.102) [-489.781] (-488.062) * (-501.684) (-488.915) (-489.497) [-489.451] -- 0:01:02
46500 -- (-496.038) (-491.241) (-488.966) [-488.155] * [-501.071] (-489.449) (-492.788) (-488.299) -- 0:01:01
47000 -- (-511.955) [-490.767] (-490.172) (-488.047) * [-495.223] (-488.464) (-488.667) (-488.029) -- 0:01:00
47500 -- (-502.891) (-488.122) [-491.027] (-488.415) * [-496.711] (-490.499) (-489.050) (-488.984) -- 0:01:00
48000 -- (-498.591) (-491.230) (-488.785) [-489.769] * (-500.062) [-492.043] (-490.668) (-490.910) -- 0:00:59
48500 -- (-505.956) [-494.915] (-490.573) (-490.905) * (-497.069) (-490.063) (-494.125) [-489.764] -- 0:00:58
49000 -- (-496.272) (-491.281) (-489.754) [-488.583] * [-501.342] (-490.055) (-492.350) (-490.460) -- 0:00:58
49500 -- [-496.796] (-489.186) (-492.716) (-491.834) * (-500.335) (-490.367) (-491.172) [-494.836] -- 0:00:57
50000 -- (-499.295) [-488.755] (-493.670) (-488.481) * (-504.059) [-492.906] (-491.527) (-492.191) -- 0:00:57
Average standard deviation of split frequencies: 0.029773
50500 -- (-496.811) [-488.561] (-491.883) (-489.394) * (-498.708) [-490.279] (-492.131) (-489.810) -- 0:00:56
51000 -- [-502.642] (-490.009) (-488.948) (-491.083) * (-495.657) (-489.989) (-490.516) [-488.825] -- 0:00:55
51500 -- (-496.533) [-489.600] (-497.157) (-490.441) * (-507.758) (-489.710) (-491.967) [-488.517] -- 0:00:55
52000 -- [-500.050] (-489.215) (-491.871) (-492.035) * (-503.212) [-488.647] (-493.560) (-487.734) -- 0:00:54
52500 -- (-498.444) (-488.465) (-489.103) [-488.323] * (-509.680) [-489.541] (-490.868) (-491.388) -- 0:00:54
53000 -- (-499.939) (-492.169) (-488.920) [-487.763] * (-499.049) (-488.814) [-489.033] (-492.077) -- 0:00:53
53500 -- [-503.807] (-488.857) (-488.131) (-491.148) * [-490.268] (-488.657) (-490.271) (-491.575) -- 0:00:53
54000 -- (-498.991) (-488.276) [-489.265] (-492.362) * (-489.354) [-488.475] (-490.386) (-494.644) -- 0:00:52
54500 -- (-495.144) [-488.737] (-488.091) (-495.689) * (-490.306) (-490.745) [-490.040] (-487.990) -- 0:00:52
55000 -- (-503.527) [-489.478] (-489.040) (-490.598) * (-489.653) (-492.250) (-488.748) [-489.347] -- 0:00:51
Average standard deviation of split frequencies: 0.031196
55500 -- [-496.686] (-490.114) (-489.785) (-494.809) * (-489.136) (-489.923) (-490.931) [-489.939] -- 0:00:51
56000 -- [-494.757] (-490.105) (-489.365) (-491.396) * [-492.524] (-490.396) (-489.555) (-487.669) -- 0:00:50
56500 -- (-497.297) (-488.909) [-490.798] (-492.095) * [-489.678] (-491.483) (-488.872) (-489.114) -- 0:00:50
57000 -- [-498.995] (-490.054) (-491.280) (-492.984) * (-491.191) (-492.657) [-487.771] (-489.302) -- 0:00:49
57500 -- (-499.755) (-489.165) (-488.318) [-490.648] * (-488.857) [-492.471] (-489.090) (-491.145) -- 0:00:49
58000 -- (-499.570) [-490.252] (-488.750) (-491.975) * (-491.275) (-492.654) [-488.828] (-490.922) -- 0:00:48
58500 -- (-498.934) [-493.075] (-489.807) (-492.647) * (-490.903) [-488.533] (-488.316) (-492.455) -- 0:00:48
59000 -- (-496.558) (-490.783) (-490.986) [-489.962] * (-490.195) [-491.103] (-488.559) (-492.151) -- 0:00:47
59500 -- (-501.837) (-489.344) (-493.534) [-490.767] * [-490.083] (-488.102) (-487.747) (-493.223) -- 0:00:47
60000 -- [-499.541] (-491.286) (-490.980) (-492.829) * (-488.237) (-490.103) (-487.849) [-487.666] -- 0:00:47
Average standard deviation of split frequencies: 0.036521
60500 -- (-498.384) (-491.428) [-488.720] (-489.947) * (-487.938) [-493.700] (-490.270) (-492.359) -- 0:01:02
61000 -- (-503.939) (-491.497) (-491.959) [-489.177] * [-491.121] (-492.149) (-488.833) (-491.839) -- 0:01:01
61500 -- [-497.536] (-489.097) (-489.419) (-488.522) * (-489.826) [-489.879] (-487.684) (-493.148) -- 0:01:01
62000 -- (-496.673) (-487.592) [-488.259] (-489.454) * [-490.356] (-489.537) (-489.003) (-489.333) -- 0:01:00
62500 -- (-497.499) (-487.873) [-489.425] (-488.647) * (-489.124) [-489.840] (-490.436) (-488.602) -- 0:01:00
63000 -- (-500.286) [-492.160] (-490.128) (-491.155) * (-492.467) [-490.510] (-489.400) (-488.423) -- 0:00:59
63500 -- [-496.723] (-492.922) (-489.890) (-490.803) * (-488.056) (-492.487) (-490.186) [-488.114] -- 0:00:58
64000 -- (-495.128) [-490.251] (-489.038) (-490.055) * [-487.898] (-496.075) (-491.290) (-488.702) -- 0:00:58
64500 -- (-504.896) [-487.998] (-489.054) (-489.658) * (-488.470) [-490.371] (-492.550) (-494.441) -- 0:00:58
65000 -- (-497.869) [-490.063] (-489.300) (-492.143) * [-488.600] (-490.514) (-491.771) (-489.793) -- 0:00:57
Average standard deviation of split frequencies: 0.032311
65500 -- (-498.788) (-493.304) (-489.630) [-489.637] * (-489.160) [-490.245] (-492.164) (-497.142) -- 0:00:57
66000 -- (-500.688) (-490.834) (-490.283) [-491.509] * (-488.169) (-488.873) [-488.148] (-490.679) -- 0:00:56
66500 -- (-495.789) [-490.606] (-490.843) (-492.277) * (-488.122) [-491.899] (-488.412) (-491.561) -- 0:00:56
67000 -- (-500.842) [-490.231] (-488.330) (-490.924) * (-489.903) (-489.301) [-487.809] (-488.311) -- 0:00:55
67500 -- [-495.886] (-490.920) (-489.275) (-489.259) * (-489.953) (-488.820) (-487.835) [-493.116] -- 0:00:55
68000 -- (-492.690) [-490.272] (-495.007) (-490.154) * (-490.466) [-490.635] (-489.470) (-489.519) -- 0:00:54
68500 -- [-497.251] (-488.911) (-494.057) (-492.910) * (-491.605) [-487.917] (-494.988) (-490.126) -- 0:00:54
69000 -- (-492.241) (-489.909) [-489.801] (-492.496) * (-492.032) (-491.190) [-490.342] (-489.681) -- 0:00:53
69500 -- (-497.572) [-489.206] (-488.769) (-492.490) * (-490.620) [-489.358] (-492.315) (-490.010) -- 0:00:53
70000 -- [-495.207] (-489.540) (-490.082) (-490.378) * (-489.320) (-488.537) (-489.638) [-490.750] -- 0:00:53
Average standard deviation of split frequencies: 0.030495
70500 -- (-494.937) [-488.640] (-488.514) (-492.452) * [-488.160] (-490.587) (-489.229) (-490.592) -- 0:00:52
71000 -- (-506.316) [-490.927] (-489.450) (-488.977) * (-489.885) (-488.462) [-488.050] (-490.230) -- 0:00:52
71500 -- (-505.452) (-493.539) [-497.559] (-495.584) * [-490.409] (-488.567) (-492.524) (-488.792) -- 0:00:51
72000 -- (-497.979) [-490.435] (-493.745) (-493.319) * (-492.334) [-488.536] (-492.588) (-492.182) -- 0:00:51
72500 -- [-499.359] (-489.200) (-489.221) (-488.412) * [-489.937] (-492.218) (-491.893) (-491.192) -- 0:00:51
73000 -- (-511.507) [-490.336] (-490.017) (-488.544) * (-490.450) (-488.571) (-491.988) [-488.171] -- 0:00:50
73500 -- (-510.055) (-487.896) (-493.183) [-488.866] * (-489.049) (-489.759) (-493.603) [-488.433] -- 0:00:50
74000 -- (-499.648) (-488.492) [-492.104] (-488.423) * (-488.272) [-489.069] (-488.319) (-488.350) -- 0:00:50
74500 -- (-489.606) (-487.927) (-487.650) [-489.832] * [-488.191] (-491.637) (-491.117) (-489.197) -- 0:00:49
75000 -- [-490.399] (-492.351) (-487.890) (-492.502) * (-492.164) [-493.859] (-494.437) (-488.749) -- 0:00:49
Average standard deviation of split frequencies: 0.026051
75500 -- (-491.265) (-497.061) (-490.102) [-489.958] * (-490.078) (-492.837) [-488.685] (-490.674) -- 0:00:48
76000 -- [-490.111] (-493.705) (-488.111) (-492.832) * [-489.609] (-488.180) (-490.665) (-490.731) -- 0:00:48
76500 -- (-491.287) (-489.070) (-488.553) [-491.246] * (-487.841) (-487.993) [-492.736] (-488.972) -- 0:00:48
77000 -- (-492.122) [-489.686] (-488.090) (-487.660) * (-487.821) (-489.684) (-488.867) [-491.889] -- 0:00:47
77500 -- [-489.700] (-489.723) (-489.843) (-490.641) * (-488.033) [-489.389] (-488.688) (-489.773) -- 0:00:59
78000 -- [-488.250] (-490.076) (-489.455) (-491.239) * (-489.321) (-488.808) [-489.899] (-491.896) -- 0:00:59
78500 -- [-489.141] (-489.090) (-488.875) (-490.793) * [-491.748] (-491.066) (-487.869) (-489.192) -- 0:00:58
79000 -- (-491.213) (-488.394) [-490.907] (-491.751) * [-487.648] (-488.996) (-495.253) (-488.789) -- 0:00:58
79500 -- [-488.563] (-492.380) (-492.162) (-488.208) * [-489.712] (-492.239) (-493.618) (-489.489) -- 0:00:57
80000 -- [-488.319] (-490.078) (-490.691) (-489.218) * [-488.207] (-488.576) (-490.034) (-489.276) -- 0:00:57
Average standard deviation of split frequencies: 0.025129
80500 -- (-493.361) [-489.132] (-488.183) (-490.071) * [-488.623] (-490.547) (-487.898) (-489.803) -- 0:00:57
81000 -- (-489.327) [-488.438] (-489.594) (-489.536) * (-488.501) [-488.110] (-489.978) (-489.220) -- 0:00:56
81500 -- (-489.032) (-490.324) [-489.399] (-491.554) * (-488.761) [-489.469] (-493.096) (-488.077) -- 0:00:56
82000 -- (-487.782) (-491.470) (-490.478) [-490.306] * [-492.908] (-491.278) (-494.706) (-489.546) -- 0:00:55
82500 -- (-488.688) (-488.953) (-490.356) [-487.859] * (-489.962) [-490.889] (-489.098) (-489.410) -- 0:00:55
83000 -- (-489.373) (-489.559) (-488.740) [-488.866] * (-488.243) (-490.570) (-489.376) [-494.341] -- 0:00:55
83500 -- (-488.611) (-491.672) (-488.802) [-489.453] * [-488.997] (-490.220) (-488.714) (-494.123) -- 0:00:54
84000 -- (-488.437) [-494.479] (-490.976) (-488.816) * [-488.383] (-488.730) (-490.031) (-490.618) -- 0:00:54
84500 -- [-489.705] (-488.922) (-489.442) (-490.881) * (-491.656) (-488.489) [-491.242] (-491.500) -- 0:00:54
85000 -- (-493.417) [-489.722] (-490.523) (-491.073) * (-490.029) (-490.763) [-490.882] (-492.423) -- 0:00:53
Average standard deviation of split frequencies: 0.021926
85500 -- [-490.792] (-489.428) (-489.661) (-491.489) * (-488.993) (-491.583) [-488.842] (-487.779) -- 0:00:53
86000 -- (-494.741) [-488.941] (-488.675) (-490.905) * (-493.090) (-488.962) [-487.721] (-488.445) -- 0:00:53
86500 -- [-489.577] (-488.493) (-490.451) (-488.760) * (-490.187) (-487.780) [-493.927] (-492.811) -- 0:00:52
87000 -- [-489.587] (-489.542) (-489.930) (-488.790) * (-488.963) (-488.558) (-491.738) [-489.466] -- 0:00:52
87500 -- [-489.903] (-490.775) (-488.790) (-490.780) * [-490.237] (-491.236) (-489.369) (-489.136) -- 0:00:52
88000 -- [-493.636] (-491.082) (-491.608) (-488.337) * (-489.101) (-493.608) (-488.738) [-488.857] -- 0:00:51
88500 -- (-490.023) (-490.994) [-489.322] (-489.935) * [-491.808] (-490.963) (-490.122) (-488.286) -- 0:00:51
89000 -- (-489.142) (-488.013) (-492.473) [-489.452] * (-488.639) (-490.142) (-488.469) [-488.900] -- 0:00:51
89500 -- (-490.944) (-488.304) [-488.930] (-490.641) * (-489.975) (-487.651) [-489.436] (-489.696) -- 0:00:50
90000 -- (-497.095) (-488.882) (-490.286) [-489.469] * (-488.591) (-487.880) (-490.220) [-489.564] -- 0:00:50
Average standard deviation of split frequencies: 0.024759
90500 -- (-490.719) [-488.220] (-490.775) (-489.873) * (-497.326) [-491.950] (-492.988) (-487.980) -- 0:00:50
91000 -- (-488.090) (-489.349) (-491.378) [-491.745] * [-491.221] (-495.284) (-494.284) (-488.144) -- 0:00:49
91500 -- (-489.936) (-489.477) (-494.184) [-488.198] * (-488.794) (-489.710) (-489.006) [-487.986] -- 0:00:49
92000 -- (-492.052) [-489.552] (-492.158) (-490.835) * [-489.117] (-488.721) (-489.873) (-488.644) -- 0:00:49
92500 -- (-491.711) (-487.852) (-492.652) [-491.442] * (-489.688) [-489.795] (-490.553) (-492.213) -- 0:00:49
93000 -- [-488.426] (-488.901) (-490.604) (-489.452) * (-489.546) (-492.692) [-491.475] (-489.945) -- 0:00:48
93500 -- (-491.049) (-488.665) [-491.299] (-489.314) * (-491.099) [-489.181] (-489.988) (-489.300) -- 0:00:48
94000 -- [-487.938] (-489.640) (-489.175) (-490.820) * (-489.025) [-490.264] (-488.137) (-491.444) -- 0:00:57
94500 -- [-489.716] (-489.155) (-488.545) (-488.690) * (-489.544) [-488.117] (-490.234) (-491.361) -- 0:00:57
95000 -- [-488.246] (-490.604) (-490.664) (-490.532) * (-488.172) [-488.264] (-491.920) (-491.088) -- 0:00:57
Average standard deviation of split frequencies: 0.027499
95500 -- (-489.590) [-493.573] (-488.574) (-490.625) * [-488.506] (-489.167) (-490.193) (-488.568) -- 0:00:56
96000 -- (-491.625) [-499.841] (-489.487) (-489.118) * (-488.358) (-490.397) [-490.920] (-488.712) -- 0:00:56
96500 -- (-492.602) [-491.078] (-490.244) (-495.821) * [-489.946] (-488.219) (-489.569) (-487.819) -- 0:00:56
97000 -- [-491.540] (-488.698) (-490.432) (-495.193) * (-490.156) (-493.028) [-488.576] (-488.217) -- 0:00:55
97500 -- (-493.813) (-493.021) [-490.921] (-487.821) * (-488.732) [-489.194] (-489.298) (-488.637) -- 0:00:55
98000 -- (-493.857) (-490.573) (-492.018) [-488.033] * (-491.795) (-490.362) [-489.018] (-490.833) -- 0:00:55
98500 -- (-491.403) (-491.945) (-488.711) [-489.562] * [-487.460] (-492.274) (-489.267) (-487.722) -- 0:00:54
99000 -- (-489.280) [-487.744] (-492.123) (-492.317) * (-492.211) [-488.661] (-491.674) (-487.961) -- 0:00:54
99500 -- (-489.306) (-494.647) [-487.881] (-487.902) * (-492.994) (-490.815) [-489.051] (-491.845) -- 0:00:54
100000 -- (-488.632) [-490.127] (-489.582) (-488.327) * (-491.090) (-490.290) (-493.003) [-491.514] -- 0:00:54
Average standard deviation of split frequencies: 0.024585
100500 -- (-490.493) (-491.191) (-489.640) [-488.876] * (-491.273) [-490.124] (-489.703) (-490.558) -- 0:00:53
101000 -- [-491.925] (-490.776) (-490.414) (-488.158) * [-491.645] (-494.483) (-489.167) (-494.687) -- 0:00:53
101500 -- (-490.252) (-490.357) [-487.821] (-487.958) * [-488.435] (-488.751) (-492.992) (-488.740) -- 0:00:53
102000 -- (-495.941) (-490.761) (-488.933) [-487.902] * (-492.096) (-491.393) (-492.100) [-490.873] -- 0:00:52
102500 -- (-493.386) (-491.463) [-488.455] (-489.801) * (-491.746) [-489.925] (-489.135) (-490.241) -- 0:00:52
103000 -- (-492.638) (-490.501) (-490.435) [-490.436] * [-491.554] (-489.059) (-488.106) (-488.265) -- 0:00:52
103500 -- (-488.637) [-490.966] (-488.668) (-493.468) * (-488.463) (-491.439) (-488.260) [-488.577] -- 0:00:51
104000 -- [-488.879] (-489.104) (-488.657) (-493.961) * (-488.696) [-490.897] (-488.250) (-488.843) -- 0:00:51
104500 -- (-489.104) (-487.974) [-488.055] (-491.254) * (-490.801) (-491.971) (-488.390) [-490.237] -- 0:00:51
105000 -- (-487.705) (-490.743) [-488.098] (-490.674) * [-491.340] (-489.035) (-488.394) (-491.373) -- 0:00:51
Average standard deviation of split frequencies: 0.024015
105500 -- (-487.409) (-491.151) [-488.404] (-491.134) * (-493.046) (-488.672) [-491.849] (-495.684) -- 0:00:50
106000 -- [-488.630] (-490.863) (-488.986) (-488.696) * (-490.670) [-489.396] (-495.074) (-489.993) -- 0:00:50
106500 -- (-487.910) (-492.666) [-489.223] (-490.688) * [-490.948] (-489.620) (-490.068) (-488.383) -- 0:00:50
107000 -- [-488.533] (-492.867) (-488.748) (-490.876) * (-488.976) (-488.793) (-490.764) [-487.666] -- 0:00:50
107500 -- [-489.627] (-490.952) (-489.747) (-490.092) * [-489.428] (-488.312) (-488.135) (-489.956) -- 0:00:49
108000 -- (-491.095) (-490.541) [-489.396] (-494.033) * [-491.191] (-491.076) (-490.128) (-493.011) -- 0:00:49
108500 -- (-494.262) (-490.518) [-491.099] (-493.719) * [-488.711] (-489.003) (-497.418) (-490.782) -- 0:00:49
109000 -- (-488.944) (-490.475) [-491.877] (-490.458) * [-487.806] (-489.223) (-493.959) (-487.780) -- 0:00:49
109500 -- (-490.774) (-489.952) [-492.684] (-490.507) * (-492.397) [-487.700] (-488.051) (-490.038) -- 0:00:48
110000 -- [-489.165] (-490.895) (-490.068) (-489.575) * (-493.643) (-489.257) (-487.427) [-487.803] -- 0:00:48
Average standard deviation of split frequencies: 0.023002
110500 -- (-487.859) [-488.346] (-492.171) (-487.734) * (-489.498) [-489.072] (-489.564) (-490.453) -- 0:00:48
111000 -- (-489.273) (-488.100) [-491.215] (-489.303) * [-489.170] (-491.719) (-491.820) (-489.170) -- 0:00:56
111500 -- (-489.079) (-490.950) [-490.068] (-492.649) * [-488.564] (-494.960) (-491.410) (-488.320) -- 0:00:55
112000 -- [-488.468] (-490.176) (-489.627) (-490.521) * (-489.404) (-491.967) (-490.427) [-488.900] -- 0:00:55
112500 -- (-488.307) (-488.358) (-490.687) [-492.185] * (-489.947) [-488.861] (-492.081) (-490.689) -- 0:00:55
113000 -- (-488.095) (-494.823) (-488.927) [-491.301] * (-489.259) [-490.471] (-489.470) (-488.645) -- 0:00:54
113500 -- (-489.866) (-487.873) [-490.370] (-491.738) * (-490.901) [-491.614] (-489.679) (-489.198) -- 0:00:54
114000 -- [-488.129] (-489.371) (-489.506) (-493.147) * (-489.402) (-489.744) (-487.846) [-488.709] -- 0:00:54
114500 -- (-492.198) [-492.698] (-489.686) (-490.736) * [-489.246] (-491.732) (-489.556) (-489.878) -- 0:00:54
115000 -- (-487.975) (-492.081) (-489.155) [-489.681] * (-492.967) [-488.917] (-488.745) (-491.883) -- 0:00:53
Average standard deviation of split frequencies: 0.022061
115500 -- (-487.772) (-489.602) (-489.017) [-490.317] * (-489.239) (-490.966) [-492.286] (-488.205) -- 0:00:53
116000 -- (-489.549) [-488.917] (-488.888) (-489.537) * (-491.711) (-489.759) (-487.877) [-489.037] -- 0:00:53
116500 -- (-496.156) (-489.717) [-489.551] (-491.001) * [-489.706] (-490.183) (-489.701) (-488.506) -- 0:00:53
117000 -- (-492.587) [-490.887] (-490.461) (-489.409) * [-492.824] (-497.491) (-487.960) (-492.807) -- 0:00:52
117500 -- (-491.085) (-493.365) [-492.625] (-490.684) * (-495.691) (-488.102) [-490.367] (-488.356) -- 0:00:52
118000 -- (-491.029) [-489.908] (-493.330) (-490.380) * (-492.139) [-487.958] (-489.502) (-489.775) -- 0:00:52
118500 -- [-489.572] (-491.962) (-489.235) (-490.057) * [-488.756] (-497.269) (-487.630) (-494.099) -- 0:00:52
119000 -- (-489.111) (-490.886) (-490.766) [-489.786] * [-489.208] (-489.490) (-488.500) (-493.590) -- 0:00:51
119500 -- (-491.425) [-488.135] (-488.726) (-489.921) * (-489.440) (-490.092) (-488.889) [-491.729] -- 0:00:51
120000 -- (-488.171) [-488.572] (-487.968) (-490.181) * (-489.146) (-498.381) [-487.465] (-490.121) -- 0:00:51
Average standard deviation of split frequencies: 0.022823
120500 -- (-487.921) (-488.058) [-489.323] (-489.338) * [-488.061] (-489.923) (-488.171) (-489.758) -- 0:00:51
121000 -- (-489.733) (-489.514) [-488.765] (-489.832) * (-489.991) (-489.915) (-487.602) [-488.892] -- 0:00:50
121500 -- (-487.770) (-490.994) [-488.922] (-488.310) * (-488.315) (-490.523) (-490.263) [-488.963] -- 0:00:50
122000 -- [-490.392] (-490.036) (-488.915) (-488.202) * (-489.858) (-491.990) (-490.482) [-488.139] -- 0:00:50
122500 -- (-488.138) (-490.571) (-490.711) [-489.759] * (-490.486) (-491.013) (-493.047) [-489.570] -- 0:00:50
123000 -- [-489.555] (-490.640) (-492.965) (-491.676) * (-488.616) (-489.878) (-492.692) [-490.072] -- 0:00:49
123500 -- [-493.407] (-488.419) (-489.975) (-488.712) * [-488.209] (-489.909) (-489.687) (-494.135) -- 0:00:49
124000 -- (-492.890) [-489.365] (-487.587) (-487.483) * (-489.119) (-488.587) (-488.263) [-488.490] -- 0:00:49
124500 -- (-490.209) (-489.612) (-488.625) [-492.423] * (-487.671) [-488.916] (-491.154) (-488.362) -- 0:00:49
125000 -- [-493.309] (-487.872) (-491.710) (-491.058) * (-487.986) (-488.952) (-489.721) [-487.984] -- 0:00:49
Average standard deviation of split frequencies: 0.022618
125500 -- [-490.105] (-488.693) (-490.096) (-488.925) * [-489.015] (-490.090) (-489.459) (-489.741) -- 0:00:48
126000 -- [-487.981] (-491.711) (-488.814) (-491.156) * [-488.708] (-490.725) (-488.959) (-489.594) -- 0:00:48
126500 -- (-492.813) (-490.614) (-489.784) [-490.134] * (-489.232) (-491.022) (-487.709) [-488.663] -- 0:00:48
127000 -- (-493.444) (-488.682) (-490.133) [-488.998] * (-489.437) (-489.963) (-491.521) [-491.844] -- 0:00:48
127500 -- (-489.833) (-489.794) (-490.352) [-488.070] * (-489.129) [-490.856] (-492.776) (-490.863) -- 0:00:47
128000 -- (-494.390) [-493.235] (-491.111) (-489.668) * (-489.036) [-489.933] (-491.121) (-492.182) -- 0:00:47
128500 -- [-487.470] (-490.535) (-489.732) (-490.224) * [-490.393] (-490.365) (-490.340) (-493.276) -- 0:00:54
129000 -- (-488.140) (-491.382) [-491.171] (-490.824) * (-489.779) (-488.518) [-488.978] (-491.589) -- 0:00:54
129500 -- (-489.618) (-488.993) [-487.898] (-488.734) * (-489.580) [-489.681] (-490.230) (-488.800) -- 0:00:53
130000 -- (-492.331) (-490.544) (-490.262) [-489.098] * (-490.496) (-490.408) [-488.811] (-488.665) -- 0:00:53
Average standard deviation of split frequencies: 0.020564
130500 -- (-490.254) (-491.564) [-489.638] (-489.069) * (-492.847) (-490.862) (-488.389) [-488.373] -- 0:00:53
131000 -- (-492.374) (-489.095) (-490.088) [-490.414] * (-491.804) (-488.698) (-491.974) [-490.424] -- 0:00:53
131500 -- (-490.350) (-490.052) [-489.615] (-491.384) * (-494.630) (-488.490) (-495.901) [-489.778] -- 0:00:52
132000 -- (-489.797) (-490.734) [-490.632] (-492.020) * (-491.330) [-489.102] (-493.338) (-488.968) -- 0:00:52
132500 -- [-487.908] (-488.421) (-489.208) (-493.572) * (-490.573) [-488.753] (-490.554) (-488.690) -- 0:00:52
133000 -- (-488.586) (-489.183) (-488.360) [-491.063] * (-492.055) (-490.493) (-490.687) [-489.479] -- 0:00:52
133500 -- [-488.325] (-491.296) (-487.486) (-491.335) * [-491.970] (-490.086) (-492.505) (-492.136) -- 0:00:51
134000 -- (-489.641) (-491.129) (-487.579) [-488.235] * [-489.481] (-490.829) (-487.922) (-491.778) -- 0:00:51
134500 -- (-491.309) (-487.790) [-487.813] (-487.647) * (-498.519) (-488.311) [-487.848] (-493.760) -- 0:00:51
135000 -- [-488.340] (-489.060) (-490.393) (-487.812) * [-490.654] (-488.575) (-490.660) (-492.008) -- 0:00:51
Average standard deviation of split frequencies: 0.019703
135500 -- [-491.959] (-490.370) (-489.589) (-493.998) * (-498.229) [-492.288] (-492.446) (-490.934) -- 0:00:51
136000 -- (-489.328) (-489.066) (-491.877) [-492.281] * (-491.023) (-487.970) [-488.767] (-489.797) -- 0:00:50
136500 -- (-490.911) (-488.650) (-492.172) [-494.409] * (-488.935) (-490.503) [-490.517] (-490.916) -- 0:00:50
137000 -- (-488.273) (-493.230) [-488.089] (-491.591) * [-489.358] (-490.786) (-488.366) (-489.894) -- 0:00:50
137500 -- (-492.354) [-489.578] (-489.903) (-489.448) * [-488.676] (-491.966) (-491.103) (-490.421) -- 0:00:50
138000 -- (-492.514) [-491.047] (-489.295) (-490.209) * (-489.260) (-489.150) [-490.861] (-490.847) -- 0:00:49
138500 -- (-488.579) [-490.052] (-490.114) (-490.112) * (-489.973) [-488.949] (-492.330) (-489.649) -- 0:00:49
139000 -- (-489.170) [-488.177] (-489.632) (-488.631) * (-494.080) (-488.828) (-495.004) [-490.571] -- 0:00:49
139500 -- [-490.501] (-489.799) (-492.359) (-489.160) * (-489.711) [-489.436] (-490.440) (-492.583) -- 0:00:49
140000 -- (-491.865) (-489.702) [-487.826] (-489.426) * [-489.250] (-488.611) (-488.084) (-489.963) -- 0:00:49
Average standard deviation of split frequencies: 0.022453
140500 -- (-490.844) (-489.137) (-489.979) [-489.990] * [-489.727] (-489.052) (-487.916) (-491.690) -- 0:00:48
141000 -- (-492.140) (-491.455) [-489.977] (-488.463) * (-491.037) (-488.728) (-494.138) [-491.914] -- 0:00:48
141500 -- (-489.484) (-489.514) [-488.063] (-490.782) * (-491.737) (-489.405) (-489.970) [-488.323] -- 0:00:48
142000 -- (-495.690) (-490.401) (-488.661) [-488.103] * (-490.291) (-489.688) (-489.994) [-489.366] -- 0:00:48
142500 -- [-495.796] (-492.218) (-491.195) (-489.326) * (-489.383) (-487.987) [-488.841] (-492.632) -- 0:00:48
143000 -- (-493.669) (-493.427) [-489.613] (-488.900) * [-491.599] (-487.987) (-489.058) (-493.446) -- 0:00:47
143500 -- (-490.859) (-494.481) [-493.079] (-488.526) * [-491.205] (-492.065) (-490.481) (-488.240) -- 0:00:47
144000 -- [-487.492] (-489.090) (-490.442) (-490.441) * (-488.692) (-492.938) (-489.675) [-491.792] -- 0:00:47
144500 -- (-489.740) [-487.526] (-493.338) (-490.888) * (-494.215) (-489.289) [-487.617] (-489.117) -- 0:00:47
145000 -- [-493.385] (-488.994) (-492.545) (-488.343) * (-489.713) (-488.595) [-488.234] (-492.910) -- 0:00:47
Average standard deviation of split frequencies: 0.022117
145500 -- (-490.986) [-488.557] (-488.312) (-492.550) * (-489.056) [-489.903] (-489.294) (-488.346) -- 0:00:52
146000 -- (-491.194) (-492.212) [-490.462] (-488.956) * [-488.256] (-487.847) (-488.480) (-489.182) -- 0:00:52
146500 -- (-493.367) (-489.365) (-490.910) [-488.250] * (-489.961) (-490.725) (-488.484) [-491.406] -- 0:00:52
147000 -- (-492.195) (-496.854) [-488.330] (-489.465) * (-490.665) [-490.218] (-489.437) (-491.614) -- 0:00:52
147500 -- [-489.584] (-492.460) (-489.791) (-489.750) * (-493.020) [-488.571] (-489.047) (-487.919) -- 0:00:52
148000 -- (-488.897) (-492.357) (-491.553) [-489.076] * (-492.481) [-490.824] (-488.263) (-488.061) -- 0:00:51
148500 -- (-489.860) (-493.041) (-490.411) [-488.284] * [-489.627] (-489.164) (-490.179) (-490.652) -- 0:00:51
149000 -- (-488.265) [-489.911] (-491.803) (-494.357) * (-487.740) [-489.967] (-489.099) (-491.493) -- 0:00:51
149500 -- (-488.785) [-488.422] (-491.591) (-490.691) * (-488.891) [-492.088] (-488.602) (-492.374) -- 0:00:51
150000 -- [-490.589] (-492.523) (-490.305) (-489.126) * [-489.084] (-492.423) (-490.501) (-490.134) -- 0:00:51
Average standard deviation of split frequencies: 0.021432
150500 -- (-490.847) (-493.167) (-490.294) [-487.963] * [-490.738] (-488.156) (-492.699) (-491.430) -- 0:00:50
151000 -- (-493.949) (-494.957) [-488.712] (-489.632) * (-489.183) (-488.798) [-488.289] (-487.883) -- 0:00:50
151500 -- (-492.549) (-492.357) (-487.617) [-488.440] * [-495.161] (-489.818) (-488.789) (-489.980) -- 0:00:50
152000 -- (-491.539) [-489.848] (-488.391) (-488.034) * (-490.734) (-488.787) [-488.590] (-494.398) -- 0:00:50
152500 -- (-490.086) (-493.432) [-489.653] (-490.374) * (-489.812) (-489.448) [-489.739] (-490.257) -- 0:00:50
153000 -- (-491.804) [-489.597] (-488.469) (-489.596) * (-489.168) (-489.832) (-490.229) [-487.710] -- 0:00:49
153500 -- [-491.601] (-490.848) (-489.239) (-489.308) * (-489.391) (-490.025) [-490.116] (-490.152) -- 0:00:49
154000 -- (-491.680) (-488.932) [-488.497] (-488.861) * (-489.722) (-492.059) (-490.604) [-491.471] -- 0:00:49
154500 -- [-490.559] (-488.945) (-490.329) (-488.752) * (-491.596) (-489.116) (-492.826) [-488.148] -- 0:00:49
155000 -- (-493.462) (-489.445) (-490.843) [-487.769] * [-489.884] (-487.909) (-489.137) (-487.594) -- 0:00:49
Average standard deviation of split frequencies: 0.017124
155500 -- (-490.420) (-489.514) [-493.658] (-489.620) * (-488.583) (-492.452) [-489.647] (-489.206) -- 0:00:48
156000 -- (-495.536) [-489.349] (-491.598) (-493.559) * (-488.079) [-490.952] (-490.085) (-489.197) -- 0:00:48
156500 -- [-490.126] (-489.556) (-491.681) (-488.277) * (-487.705) [-491.503] (-491.271) (-491.846) -- 0:00:48
157000 -- [-489.046] (-488.702) (-489.181) (-489.849) * (-491.820) [-490.123] (-489.133) (-490.344) -- 0:00:48
157500 -- (-488.556) (-492.215) (-492.441) [-490.682] * (-490.010) [-494.586] (-495.244) (-491.324) -- 0:00:48
158000 -- (-488.757) (-490.156) [-490.184] (-488.707) * (-489.518) [-492.122] (-494.822) (-491.459) -- 0:00:47
158500 -- (-488.633) [-489.194] (-490.980) (-489.617) * [-489.539] (-490.048) (-490.476) (-488.288) -- 0:00:47
159000 -- (-488.601) (-487.901) (-490.237) [-490.087] * (-490.671) [-488.725] (-488.954) (-495.177) -- 0:00:47
159500 -- (-492.273) (-488.561) (-491.167) [-487.832] * (-490.159) (-490.486) (-489.942) [-493.259] -- 0:00:47
160000 -- (-490.027) (-490.806) [-488.354] (-488.013) * [-489.514] (-488.546) (-489.874) (-489.147) -- 0:00:47
Average standard deviation of split frequencies: 0.016741
160500 -- (-488.916) (-490.317) [-490.352] (-487.838) * [-489.831] (-493.478) (-490.784) (-489.263) -- 0:00:47
161000 -- (-489.032) (-489.706) [-489.989] (-489.710) * (-491.895) (-489.018) [-490.622] (-489.067) -- 0:00:46
161500 -- (-490.630) (-493.758) [-490.058] (-487.723) * (-491.354) [-489.325] (-489.567) (-490.424) -- 0:00:46
162000 -- (-490.597) (-488.708) [-496.833] (-488.341) * (-491.004) (-491.411) [-489.230] (-490.129) -- 0:00:51
162500 -- (-489.139) (-488.169) [-489.381] (-489.007) * (-496.109) (-488.984) (-491.142) [-487.950] -- 0:00:51
163000 -- (-490.428) [-487.534] (-490.674) (-490.899) * [-491.675] (-488.494) (-490.466) (-488.046) -- 0:00:51
163500 -- (-488.559) (-490.348) [-489.315] (-490.217) * (-489.080) (-491.381) (-488.717) [-488.660] -- 0:00:51
164000 -- (-487.694) (-490.524) [-490.194] (-490.880) * (-488.347) [-488.860] (-490.040) (-493.044) -- 0:00:50
164500 -- [-489.670] (-491.333) (-492.971) (-488.691) * [-487.695] (-489.438) (-490.390) (-490.706) -- 0:00:50
165000 -- [-488.254] (-490.993) (-488.242) (-488.632) * (-488.084) (-488.966) [-489.124] (-489.247) -- 0:00:50
Average standard deviation of split frequencies: 0.014514
165500 -- (-494.890) [-491.353] (-488.359) (-489.812) * (-489.029) (-488.898) [-494.839] (-493.855) -- 0:00:50
166000 -- (-489.205) (-488.811) [-487.933] (-490.210) * [-489.171] (-491.488) (-488.318) (-487.498) -- 0:00:50
166500 -- (-493.549) [-490.525] (-488.705) (-489.925) * (-488.902) (-490.263) (-488.247) [-487.998] -- 0:00:50
167000 -- (-488.562) (-489.908) [-488.557] (-488.505) * (-488.369) [-488.677] (-493.645) (-489.371) -- 0:00:49
167500 -- (-492.487) (-495.113) (-491.320) [-489.739] * (-489.755) [-489.690] (-490.152) (-489.646) -- 0:00:49
168000 -- [-490.425] (-492.221) (-488.565) (-489.452) * (-490.239) [-488.080] (-495.843) (-488.130) -- 0:00:49
168500 -- (-491.603) (-496.531) [-490.039] (-489.800) * [-490.954] (-488.808) (-491.620) (-488.776) -- 0:00:49
169000 -- [-487.680] (-488.138) (-488.765) (-489.803) * (-490.749) (-490.210) (-492.830) [-491.026] -- 0:00:49
169500 -- (-487.818) (-489.291) (-488.598) [-490.399] * (-497.946) [-491.080] (-492.251) (-490.226) -- 0:00:48
170000 -- (-487.416) (-488.745) [-490.415] (-489.274) * [-489.654] (-489.891) (-489.053) (-491.360) -- 0:00:48
Average standard deviation of split frequencies: 0.015410
170500 -- (-488.976) (-488.604) [-488.111] (-492.696) * [-489.268] (-489.171) (-490.596) (-490.382) -- 0:00:48
171000 -- (-490.378) [-488.893] (-491.546) (-488.402) * (-489.398) (-489.712) [-489.746] (-491.339) -- 0:00:48
171500 -- (-489.312) [-492.033] (-487.985) (-488.235) * (-489.860) (-491.585) [-489.018] (-488.327) -- 0:00:48
172000 -- (-488.938) (-488.826) (-487.823) [-488.827] * [-487.626] (-494.056) (-487.926) (-493.140) -- 0:00:48
172500 -- [-489.300] (-491.037) (-488.548) (-490.224) * [-488.551] (-490.175) (-489.354) (-491.892) -- 0:00:47
173000 -- [-488.127] (-489.824) (-488.243) (-490.897) * (-488.465) [-490.377] (-491.525) (-489.263) -- 0:00:47
173500 -- (-489.166) [-488.029] (-489.179) (-490.021) * (-487.765) [-489.871] (-488.959) (-488.481) -- 0:00:47
174000 -- [-490.606] (-487.863) (-488.117) (-491.467) * (-493.389) [-489.289] (-489.150) (-489.856) -- 0:00:47
174500 -- [-492.664] (-487.820) (-494.898) (-489.891) * (-495.408) (-492.100) (-490.175) [-487.743] -- 0:00:47
175000 -- (-488.284) [-488.313] (-494.941) (-495.020) * (-488.078) [-489.302] (-491.655) (-489.621) -- 0:00:47
Average standard deviation of split frequencies: 0.014802
175500 -- (-489.759) [-489.139] (-489.266) (-488.316) * (-488.504) [-491.798] (-489.548) (-489.683) -- 0:00:46
176000 -- (-488.138) [-490.362] (-489.548) (-492.656) * (-493.878) (-491.526) (-491.690) [-491.387] -- 0:00:46
176500 -- (-489.061) [-488.620] (-489.066) (-489.113) * (-491.197) [-490.283] (-490.148) (-490.593) -- 0:00:46
177000 -- (-489.562) (-491.229) [-488.311] (-488.329) * [-488.613] (-488.497) (-492.333) (-498.255) -- 0:00:46
177500 -- (-489.622) [-489.462] (-490.627) (-488.008) * [-491.561] (-488.401) (-492.342) (-491.796) -- 0:00:46
178000 -- (-488.558) (-489.981) [-488.752] (-488.126) * (-492.903) [-488.462] (-488.770) (-487.886) -- 0:00:46
178500 -- (-489.087) [-491.884] (-492.600) (-487.607) * (-489.090) (-491.730) [-489.978] (-488.934) -- 0:00:46
179000 -- (-491.137) (-487.447) (-488.731) [-488.749] * (-491.883) (-492.906) [-490.866] (-491.562) -- 0:00:45
179500 -- (-490.843) (-489.473) [-489.133] (-493.597) * (-491.680) [-491.220] (-489.934) (-488.729) -- 0:00:50
180000 -- (-489.608) (-489.972) [-487.800] (-490.424) * (-492.818) (-496.268) (-489.930) [-488.928] -- 0:00:50
Average standard deviation of split frequencies: 0.015793
180500 -- [-488.507] (-491.287) (-490.342) (-495.404) * [-489.403] (-494.283) (-490.043) (-487.996) -- 0:00:49
181000 -- (-489.962) (-488.792) (-490.030) [-491.946] * (-487.440) (-489.657) [-488.092] (-491.419) -- 0:00:49
181500 -- [-492.985] (-488.729) (-490.379) (-491.146) * (-488.714) (-490.454) (-488.660) [-492.932] -- 0:00:49
182000 -- [-490.884] (-490.998) (-490.055) (-490.407) * (-488.547) (-490.115) [-488.353] (-491.133) -- 0:00:49
182500 -- [-492.188] (-490.491) (-492.507) (-487.530) * (-488.716) (-489.601) [-489.469] (-490.269) -- 0:00:49
183000 -- (-488.724) (-490.516) (-492.396) [-487.854] * (-490.144) (-488.890) [-487.720] (-492.951) -- 0:00:49
183500 -- (-487.710) [-489.212] (-488.760) (-487.754) * (-491.901) [-487.881] (-488.443) (-491.235) -- 0:00:48
184000 -- (-490.361) [-488.382] (-490.212) (-489.843) * (-490.863) [-488.958] (-492.428) (-492.467) -- 0:00:48
184500 -- [-490.041] (-491.967) (-488.350) (-492.382) * (-492.967) (-492.639) [-491.040] (-490.392) -- 0:00:48
185000 -- (-491.245) (-488.511) (-494.726) [-490.266] * (-489.559) (-491.717) [-491.887] (-490.996) -- 0:00:48
Average standard deviation of split frequencies: 0.017207
185500 -- (-488.766) (-488.324) [-489.723] (-491.817) * [-488.185] (-489.928) (-488.651) (-488.717) -- 0:00:48
186000 -- (-488.431) (-490.679) [-488.265] (-491.679) * [-491.297] (-489.759) (-491.476) (-488.792) -- 0:00:48
186500 -- (-490.312) (-489.266) (-489.186) [-491.381] * (-487.707) (-488.334) [-488.636] (-488.836) -- 0:00:47
187000 -- (-491.751) (-493.012) (-489.103) [-491.048] * (-488.438) [-488.974] (-489.922) (-492.303) -- 0:00:47
187500 -- (-489.760) (-488.231) (-489.014) [-491.292] * (-489.105) [-489.714] (-491.272) (-490.162) -- 0:00:47
188000 -- (-494.485) (-489.727) (-488.171) [-488.689] * (-489.147) [-488.298] (-489.848) (-488.340) -- 0:00:47
188500 -- (-492.105) (-490.999) [-491.166] (-488.353) * [-490.259] (-488.051) (-489.320) (-490.375) -- 0:00:47
189000 -- (-489.550) [-490.449] (-491.130) (-491.699) * (-489.307) (-488.051) (-488.790) [-490.204] -- 0:00:47
189500 -- (-488.472) (-488.327) (-489.353) [-492.077] * (-488.542) (-488.525) (-488.894) [-488.052] -- 0:00:47
190000 -- [-491.309] (-491.246) (-488.704) (-487.979) * (-487.842) [-487.622] (-488.832) (-491.760) -- 0:00:46
Average standard deviation of split frequencies: 0.017169
190500 -- (-490.190) (-489.276) [-491.537] (-488.553) * [-487.888] (-489.490) (-490.402) (-494.664) -- 0:00:46
191000 -- (-491.551) (-489.081) (-492.199) [-489.437] * [-487.425] (-489.396) (-492.349) (-490.715) -- 0:00:46
191500 -- (-493.999) (-488.411) (-489.830) [-488.586] * (-488.222) (-493.209) [-491.300] (-488.414) -- 0:00:46
192000 -- (-492.604) (-489.721) (-490.207) [-490.870] * (-488.908) (-490.584) (-490.195) [-491.125] -- 0:00:46
192500 -- (-490.118) [-488.874] (-491.144) (-492.612) * (-488.941) (-489.562) (-488.084) [-491.835] -- 0:00:46
193000 -- [-490.299] (-487.720) (-496.965) (-488.179) * [-488.221] (-489.931) (-490.137) (-489.666) -- 0:00:45
193500 -- (-489.970) [-488.879] (-489.042) (-489.826) * (-490.749) [-494.691] (-490.189) (-490.921) -- 0:00:45
194000 -- (-489.441) (-487.881) [-487.908] (-490.157) * [-489.192] (-490.986) (-494.398) (-491.392) -- 0:00:45
194500 -- (-489.152) [-488.135] (-488.426) (-490.379) * (-489.386) (-493.462) (-490.471) [-494.007] -- 0:00:45
195000 -- [-490.635] (-488.821) (-487.839) (-493.021) * (-492.220) (-490.242) (-488.903) [-491.556] -- 0:00:45
Average standard deviation of split frequencies: 0.015901
195500 -- (-490.888) [-489.183] (-492.005) (-491.017) * (-490.435) [-489.532] (-491.272) (-491.140) -- 0:00:45
196000 -- (-489.595) [-489.734] (-490.240) (-489.151) * (-489.975) (-489.312) (-490.069) [-488.225] -- 0:00:45
196500 -- (-489.469) (-489.025) [-489.616] (-491.005) * (-489.450) (-489.010) (-491.420) [-488.627] -- 0:00:49
197000 -- (-491.458) [-490.638] (-487.914) (-490.217) * (-487.981) (-491.954) (-490.050) [-490.157] -- 0:00:48
197500 -- (-497.323) (-491.326) (-492.071) [-488.853] * [-491.634] (-490.462) (-492.958) (-488.973) -- 0:00:48
198000 -- (-494.006) (-490.753) [-491.655] (-490.125) * (-488.674) (-489.628) [-491.398] (-489.877) -- 0:00:48
198500 -- [-489.580] (-490.319) (-488.237) (-489.668) * (-489.989) (-487.838) [-491.766] (-491.739) -- 0:00:48
199000 -- (-488.287) [-493.620] (-489.648) (-489.222) * [-489.476] (-488.016) (-489.511) (-492.781) -- 0:00:48
199500 -- (-495.091) (-489.923) [-490.781] (-490.094) * [-493.108] (-488.525) (-489.307) (-488.643) -- 0:00:48
200000 -- [-489.937] (-490.338) (-490.943) (-491.505) * (-488.676) (-488.071) (-495.151) [-491.519] -- 0:00:48
Average standard deviation of split frequencies: 0.015922
200500 -- [-490.204] (-490.726) (-491.355) (-489.580) * (-490.906) (-489.285) [-492.448] (-489.354) -- 0:00:47
201000 -- (-490.724) [-490.609] (-492.475) (-490.029) * (-492.537) (-488.300) (-496.860) [-489.982] -- 0:00:47
201500 -- (-490.464) (-490.252) [-489.910] (-487.745) * [-490.062] (-490.880) (-488.674) (-488.240) -- 0:00:47
202000 -- [-490.484] (-489.455) (-488.812) (-492.936) * (-490.508) (-490.268) [-488.453] (-490.916) -- 0:00:47
202500 -- (-489.084) (-488.184) (-489.156) [-493.207] * [-487.635] (-493.309) (-494.261) (-490.419) -- 0:00:47
203000 -- (-489.309) (-489.062) (-494.192) [-490.477] * (-490.476) (-492.139) (-493.842) [-491.612] -- 0:00:47
203500 -- (-491.223) (-489.176) [-490.521] (-488.908) * [-490.258] (-492.421) (-493.140) (-490.590) -- 0:00:46
204000 -- (-493.216) [-489.302] (-489.178) (-489.049) * (-488.899) [-490.490] (-494.713) (-490.521) -- 0:00:46
204500 -- (-488.994) (-488.144) (-490.119) [-491.592] * (-492.673) (-495.500) (-489.577) [-488.905] -- 0:00:46
205000 -- (-487.551) (-490.182) [-490.606] (-489.986) * [-489.368] (-491.703) (-488.137) (-492.469) -- 0:00:46
Average standard deviation of split frequencies: 0.015383
205500 -- (-487.764) [-491.809] (-490.923) (-488.319) * [-488.206] (-490.175) (-490.422) (-488.903) -- 0:00:46
206000 -- (-489.182) [-490.512] (-489.309) (-488.662) * (-489.597) (-491.275) [-491.188] (-488.678) -- 0:00:46
206500 -- (-491.160) [-490.767] (-488.721) (-488.419) * (-493.198) (-489.573) [-489.689] (-488.730) -- 0:00:46
207000 -- (-488.712) (-492.403) [-489.585] (-489.381) * (-488.846) (-493.452) [-490.003] (-489.614) -- 0:00:45
207500 -- (-489.278) [-489.473] (-487.906) (-495.306) * [-487.985] (-489.880) (-489.280) (-488.547) -- 0:00:45
208000 -- (-487.772) (-489.460) [-487.856] (-495.559) * [-488.638] (-488.526) (-487.630) (-489.183) -- 0:00:45
208500 -- (-488.614) [-488.539] (-491.679) (-491.581) * (-488.744) (-490.156) [-493.365] (-487.943) -- 0:00:45
209000 -- [-488.755] (-491.055) (-491.378) (-493.032) * (-488.020) (-492.433) (-489.249) [-488.337] -- 0:00:45
209500 -- (-490.816) (-488.310) [-493.521] (-490.459) * (-492.117) (-489.490) (-490.514) [-488.523] -- 0:00:45
210000 -- [-489.031] (-487.750) (-488.386) (-489.973) * [-492.855] (-491.706) (-490.035) (-489.874) -- 0:00:45
Average standard deviation of split frequencies: 0.016161
210500 -- (-488.487) (-489.447) (-489.373) [-488.922] * (-490.528) (-496.473) (-488.549) [-488.125] -- 0:00:45
211000 -- (-488.136) (-488.408) (-489.259) [-488.024] * (-492.365) (-492.099) (-488.340) [-489.104] -- 0:00:44
211500 -- (-488.176) (-497.400) [-489.666] (-490.796) * [-492.202] (-488.633) (-491.487) (-488.167) -- 0:00:44
212000 -- (-490.071) [-488.724] (-489.534) (-489.673) * [-487.938] (-490.206) (-488.033) (-488.124) -- 0:00:44
212500 -- (-488.979) [-489.405] (-491.337) (-490.675) * (-489.101) (-489.696) [-488.532] (-490.767) -- 0:00:44
213000 -- (-489.367) (-489.363) [-492.295] (-489.410) * (-490.804) (-490.874) [-495.259] (-488.023) -- 0:00:48
213500 -- (-490.491) (-491.107) [-489.330] (-490.063) * (-492.104) [-491.947] (-487.815) (-491.684) -- 0:00:47
214000 -- [-490.639] (-489.571) (-487.926) (-489.463) * (-488.941) [-487.931] (-488.854) (-493.158) -- 0:00:47
214500 -- [-488.505] (-494.496) (-490.361) (-490.467) * (-488.522) (-489.662) (-488.457) [-488.597] -- 0:00:47
215000 -- [-491.742] (-491.035) (-488.387) (-488.890) * (-492.451) (-495.658) [-488.432] (-490.829) -- 0:00:47
Average standard deviation of split frequencies: 0.015047
215500 -- (-489.489) (-488.836) [-495.054] (-488.242) * (-489.793) [-493.420] (-488.670) (-489.375) -- 0:00:47
216000 -- (-492.500) (-490.920) (-492.385) [-492.661] * (-490.310) (-495.794) [-489.503] (-490.394) -- 0:00:47
216500 -- [-494.202] (-490.985) (-491.280) (-492.082) * (-491.726) (-489.606) [-488.543] (-489.361) -- 0:00:47
217000 -- (-493.496) [-489.003] (-491.010) (-488.951) * [-490.200] (-489.926) (-488.192) (-490.886) -- 0:00:46
217500 -- (-493.765) (-489.071) (-487.913) [-490.677] * [-488.310] (-493.903) (-492.123) (-492.240) -- 0:00:46
218000 -- [-489.112] (-494.565) (-488.778) (-492.105) * (-488.426) (-488.061) (-489.405) [-494.286] -- 0:00:46
218500 -- [-489.872] (-488.465) (-489.952) (-489.608) * (-489.284) [-491.409] (-491.791) (-489.029) -- 0:00:46
219000 -- (-488.864) (-487.871) [-493.686] (-489.239) * [-491.778] (-490.175) (-491.168) (-489.580) -- 0:00:46
219500 -- [-489.109] (-490.523) (-491.591) (-489.592) * (-489.580) (-489.684) [-489.724] (-489.662) -- 0:00:46
220000 -- [-489.933] (-489.816) (-488.911) (-489.939) * (-490.966) (-488.559) (-488.973) [-489.744] -- 0:00:46
Average standard deviation of split frequencies: 0.013949
220500 -- (-488.548) (-487.898) [-489.569] (-488.845) * (-488.866) (-491.861) (-487.693) [-488.468] -- 0:00:45
221000 -- (-491.571) (-489.438) (-487.683) [-490.558] * (-490.473) (-492.680) [-487.316] (-491.110) -- 0:00:45
221500 -- (-492.549) (-490.456) (-489.328) [-493.795] * (-488.769) (-489.610) [-490.483] (-489.821) -- 0:00:45
222000 -- (-491.050) (-487.880) (-492.033) [-488.064] * [-488.462] (-490.885) (-493.018) (-490.522) -- 0:00:45
222500 -- (-487.937) [-488.746] (-489.899) (-492.672) * (-488.326) (-488.445) [-489.870] (-490.362) -- 0:00:45
223000 -- (-489.539) (-489.800) [-489.416] (-493.866) * (-489.299) [-491.060] (-488.913) (-489.824) -- 0:00:45
223500 -- (-488.649) (-488.536) [-489.806] (-488.354) * (-490.813) (-489.984) (-489.660) [-489.663] -- 0:00:45
224000 -- (-491.165) (-492.723) [-490.378] (-491.309) * (-490.817) (-488.494) [-489.194] (-493.911) -- 0:00:45
224500 -- (-491.652) [-493.256] (-494.984) (-489.867) * (-489.160) [-491.413] (-489.829) (-492.308) -- 0:00:44
225000 -- (-488.527) (-489.146) (-494.903) [-490.659] * (-489.375) [-490.240] (-488.871) (-491.986) -- 0:00:44
Average standard deviation of split frequencies: 0.014821
225500 -- (-491.683) (-487.826) (-490.153) [-490.475] * (-494.847) (-488.968) (-489.945) [-489.415] -- 0:00:44
226000 -- (-489.964) (-491.709) (-489.476) [-489.784] * (-490.768) [-488.643] (-490.717) (-494.065) -- 0:00:44
226500 -- (-488.623) [-490.445] (-487.963) (-489.704) * (-490.171) (-491.220) (-487.953) [-492.241] -- 0:00:44
227000 -- (-491.845) (-491.992) [-488.289] (-488.140) * (-490.295) [-490.039] (-492.797) (-491.570) -- 0:00:44
227500 -- (-489.959) (-489.341) (-492.131) [-494.157] * (-488.852) [-490.882] (-496.758) (-489.589) -- 0:00:44
228000 -- (-487.973) (-488.628) [-489.913] (-495.648) * [-488.652] (-490.271) (-492.456) (-487.605) -- 0:00:44
228500 -- (-488.695) (-488.828) (-489.111) [-489.056] * (-490.661) (-492.788) (-492.437) [-489.909] -- 0:00:43
229000 -- (-487.821) [-489.512] (-488.414) (-492.137) * [-487.856] (-490.406) (-488.485) (-490.726) -- 0:00:43
229500 -- (-492.527) (-489.500) [-490.625] (-490.799) * (-489.893) (-495.182) [-491.706] (-490.240) -- 0:00:43
230000 -- [-492.886] (-491.408) (-490.950) (-493.801) * [-490.397] (-488.647) (-493.997) (-491.168) -- 0:00:43
Average standard deviation of split frequencies: 0.014843
230500 -- (-492.634) (-490.615) [-489.296] (-492.989) * (-487.868) (-492.401) (-493.032) [-492.515] -- 0:00:46
231000 -- (-493.034) (-490.737) [-491.085] (-494.636) * [-489.004] (-488.685) (-490.180) (-489.401) -- 0:00:46
231500 -- (-487.860) (-490.150) [-488.977] (-489.742) * (-489.681) (-491.087) (-487.812) [-489.683] -- 0:00:46
232000 -- (-490.581) (-490.842) [-489.828] (-490.186) * (-493.218) (-488.516) [-489.050] (-489.737) -- 0:00:46
232500 -- (-489.057) [-488.365] (-492.254) (-489.325) * (-490.844) [-491.726] (-490.612) (-488.449) -- 0:00:46
233000 -- (-489.400) (-492.210) [-488.960] (-491.583) * (-489.215) (-491.104) [-489.744] (-489.643) -- 0:00:46
233500 -- (-494.041) (-489.856) [-490.126] (-488.173) * (-494.632) (-489.373) (-490.294) [-490.084] -- 0:00:45
234000 -- (-489.006) [-487.592] (-491.056) (-489.490) * (-493.874) [-488.928] (-488.048) (-498.446) -- 0:00:45
234500 -- (-488.312) (-488.227) (-493.108) [-490.212] * (-494.852) (-488.517) (-487.928) [-490.906] -- 0:00:45
235000 -- (-493.353) (-488.292) (-488.730) [-490.588] * (-492.125) [-488.892] (-492.206) (-488.748) -- 0:00:45
Average standard deviation of split frequencies: 0.014093
235500 -- (-488.276) (-489.586) (-489.377) [-488.982] * (-496.497) (-491.375) [-488.651] (-490.439) -- 0:00:45
236000 -- (-489.214) (-488.396) (-490.981) [-489.215] * (-488.470) (-490.179) [-488.361] (-495.249) -- 0:00:45
236500 -- (-488.220) (-488.628) [-488.337] (-490.439) * (-489.471) (-493.117) [-488.769] (-491.861) -- 0:00:45
237000 -- (-495.848) (-497.180) [-489.696] (-490.931) * (-493.005) (-491.119) (-488.457) [-488.432] -- 0:00:45
237500 -- (-494.846) [-489.078] (-488.481) (-491.284) * [-491.890] (-490.083) (-487.482) (-489.647) -- 0:00:44
238000 -- [-487.928] (-489.338) (-489.972) (-488.836) * [-489.746] (-490.002) (-489.009) (-490.444) -- 0:00:44
238500 -- (-488.396) (-495.279) [-491.659] (-488.845) * (-489.940) (-489.011) (-489.075) [-488.629] -- 0:00:44
239000 -- [-487.987] (-495.853) (-489.580) (-488.907) * (-489.080) (-489.482) (-490.647) [-494.615] -- 0:00:44
239500 -- (-488.822) (-494.615) [-487.783] (-491.863) * (-491.565) [-491.465] (-491.898) (-489.902) -- 0:00:44
240000 -- (-488.245) [-488.025] (-489.074) (-492.996) * (-491.549) (-490.056) [-490.863] (-490.608) -- 0:00:44
Average standard deviation of split frequencies: 0.013494
240500 -- (-492.727) (-488.170) (-489.462) [-489.504] * (-490.263) [-488.419] (-489.241) (-490.096) -- 0:00:44
241000 -- [-491.524] (-490.290) (-488.596) (-488.666) * (-489.188) (-487.769) (-489.422) [-488.130] -- 0:00:44
241500 -- [-489.994] (-490.094) (-487.688) (-490.618) * (-488.029) (-494.935) (-491.715) [-488.627] -- 0:00:43
242000 -- (-490.129) (-489.355) [-489.014] (-490.966) * (-489.589) (-489.067) (-490.535) [-490.532] -- 0:00:43
242500 -- [-492.241] (-488.862) (-488.426) (-491.101) * (-490.890) [-492.269] (-488.985) (-490.272) -- 0:00:43
243000 -- (-490.327) (-489.413) [-490.236] (-490.543) * [-487.952] (-491.998) (-489.362) (-490.293) -- 0:00:43
243500 -- [-488.692] (-489.465) (-490.589) (-490.203) * [-490.915] (-490.179) (-487.921) (-487.919) -- 0:00:43
244000 -- (-490.535) (-489.830) (-490.640) [-488.473] * (-489.032) [-487.891] (-489.839) (-488.266) -- 0:00:43
244500 -- [-489.616] (-488.322) (-487.858) (-488.736) * (-493.239) [-488.823] (-490.579) (-488.950) -- 0:00:43
245000 -- [-487.927] (-488.742) (-488.952) (-493.913) * (-494.187) (-489.205) (-495.877) [-489.955] -- 0:00:43
Average standard deviation of split frequencies: 0.012988
245500 -- (-492.784) (-488.035) [-490.102] (-489.504) * (-492.754) (-488.047) (-491.885) [-489.587] -- 0:00:43
246000 -- (-494.288) (-487.780) (-488.735) [-488.194] * (-488.321) [-488.579] (-489.060) (-491.064) -- 0:00:42
246500 -- (-490.422) (-491.431) [-488.662] (-491.198) * (-489.965) [-488.571] (-491.922) (-490.211) -- 0:00:42
247000 -- (-489.212) (-495.241) (-490.504) [-488.743] * (-490.046) (-488.726) (-491.994) [-489.034] -- 0:00:42
247500 -- (-489.479) (-491.848) (-489.503) [-490.108] * [-489.780] (-488.021) (-492.477) (-491.807) -- 0:00:45
248000 -- (-489.122) (-489.059) [-494.086] (-489.141) * (-489.194) (-489.687) (-491.619) [-488.511] -- 0:00:45
248500 -- [-489.065] (-488.244) (-491.537) (-488.875) * (-489.318) (-490.115) [-491.087] (-490.478) -- 0:00:45
249000 -- (-490.489) [-487.774] (-488.360) (-490.578) * (-490.686) (-491.086) [-488.863] (-490.508) -- 0:00:45
249500 -- (-490.449) (-488.949) (-488.642) [-490.559] * [-491.264] (-494.821) (-492.697) (-490.842) -- 0:00:45
250000 -- (-487.395) (-489.455) [-489.399] (-491.225) * (-497.656) (-494.505) [-491.849] (-491.832) -- 0:00:45
Average standard deviation of split frequencies: 0.012867
250500 -- (-487.394) (-491.810) (-488.364) [-488.254] * (-490.999) (-490.082) (-490.105) [-488.299] -- 0:00:44
251000 -- (-491.580) (-489.629) (-487.804) [-488.223] * (-488.137) (-490.093) [-489.171] (-487.929) -- 0:00:44
251500 -- (-492.640) (-492.807) [-490.056] (-489.199) * (-488.466) (-489.371) (-493.873) [-492.502] -- 0:00:44
252000 -- (-492.049) [-490.669] (-489.024) (-489.708) * (-488.074) [-488.400] (-492.324) (-496.362) -- 0:00:44
252500 -- (-488.772) (-492.350) (-489.614) [-492.306] * (-491.218) (-491.417) (-492.084) [-490.870] -- 0:00:44
253000 -- (-487.840) [-489.291] (-489.350) (-488.968) * (-488.069) (-491.446) (-493.191) [-489.574] -- 0:00:44
253500 -- (-491.809) [-491.761] (-492.922) (-490.736) * (-493.449) (-491.816) (-490.994) [-489.314] -- 0:00:44
254000 -- (-493.128) [-490.025] (-490.120) (-489.775) * [-487.537] (-487.790) (-491.384) (-488.364) -- 0:00:44
254500 -- (-488.424) [-489.344] (-490.798) (-491.619) * (-490.573) (-488.888) [-489.751] (-492.186) -- 0:00:43
255000 -- (-487.636) (-489.062) (-490.828) [-489.334] * (-488.181) (-488.012) [-489.821] (-490.570) -- 0:00:43
Average standard deviation of split frequencies: 0.012565
255500 -- [-488.070] (-489.442) (-488.967) (-489.081) * (-489.849) [-488.515] (-490.022) (-489.713) -- 0:00:43
256000 -- (-489.941) (-492.278) [-488.105] (-489.758) * [-488.380] (-489.491) (-490.048) (-490.442) -- 0:00:43
256500 -- (-491.278) [-489.596] (-493.638) (-490.331) * [-488.139] (-494.691) (-490.077) (-491.187) -- 0:00:43
257000 -- (-488.297) (-489.833) [-495.761] (-492.021) * [-488.335] (-488.183) (-488.930) (-489.414) -- 0:00:43
257500 -- (-488.210) (-488.011) [-489.606] (-495.039) * [-489.604] (-488.651) (-495.057) (-489.653) -- 0:00:43
258000 -- (-489.288) (-491.547) (-491.226) [-489.094] * (-492.821) (-488.828) [-490.005] (-489.923) -- 0:00:43
258500 -- [-488.804] (-490.469) (-489.854) (-487.937) * (-488.478) (-489.150) (-493.362) [-487.856] -- 0:00:43
259000 -- (-490.724) (-489.004) (-487.929) [-489.491] * (-491.221) [-493.244] (-491.571) (-492.830) -- 0:00:42
259500 -- (-489.551) [-487.588] (-491.308) (-487.990) * (-490.592) (-493.806) (-489.053) [-489.056] -- 0:00:42
260000 -- (-492.066) (-488.577) (-490.198) [-489.419] * (-489.319) [-489.913] (-490.657) (-488.634) -- 0:00:42
Average standard deviation of split frequencies: 0.012446
260500 -- (-488.764) (-488.635) (-487.903) [-489.938] * [-490.079] (-491.732) (-489.190) (-494.282) -- 0:00:42
261000 -- [-491.238] (-490.075) (-488.554) (-491.757) * [-488.186] (-491.816) (-492.000) (-492.985) -- 0:00:42
261500 -- (-489.336) (-488.637) [-489.058] (-490.405) * (-488.938) (-493.199) (-488.955) [-492.126] -- 0:00:42
262000 -- [-493.225] (-491.526) (-491.818) (-489.699) * [-489.030] (-490.009) (-491.297) (-490.029) -- 0:00:42
262500 -- (-494.248) (-493.880) [-490.597] (-492.038) * (-491.888) (-491.168) (-493.051) [-489.617] -- 0:00:42
263000 -- (-490.166) [-489.872] (-488.102) (-487.948) * (-488.495) (-489.137) [-488.575] (-491.362) -- 0:00:42
263500 -- (-490.787) (-492.904) (-492.370) [-489.585] * [-489.202] (-496.067) (-495.912) (-488.893) -- 0:00:41
264000 -- (-489.330) [-490.834] (-488.843) (-489.478) * (-490.642) [-490.200] (-489.286) (-492.157) -- 0:00:41
264500 -- [-490.024] (-490.373) (-491.505) (-488.382) * (-491.393) [-489.786] (-491.269) (-489.476) -- 0:00:44
265000 -- (-491.453) [-489.071] (-491.403) (-491.335) * [-488.316] (-489.926) (-490.634) (-490.623) -- 0:00:44
Average standard deviation of split frequencies: 0.012499
265500 -- [-488.387] (-490.327) (-490.370) (-491.896) * [-491.508] (-488.605) (-492.182) (-490.080) -- 0:00:44
266000 -- (-488.076) (-489.266) [-488.145] (-491.266) * (-488.907) (-488.645) (-491.621) [-490.621] -- 0:00:44
266500 -- (-489.724) (-491.590) [-488.884] (-490.641) * (-491.072) (-490.126) (-488.320) [-491.240] -- 0:00:44
267000 -- (-492.743) (-491.620) [-490.542] (-492.397) * (-489.246) (-491.201) [-491.233] (-490.908) -- 0:00:43
267500 -- [-490.735] (-490.093) (-489.681) (-490.868) * [-487.741] (-489.058) (-490.763) (-488.678) -- 0:00:43
268000 -- [-488.079] (-488.388) (-493.548) (-488.332) * (-491.784) (-490.150) (-489.416) [-494.510] -- 0:00:43
268500 -- (-490.871) [-491.086] (-492.916) (-488.628) * [-490.474] (-490.857) (-488.970) (-489.665) -- 0:00:43
269000 -- (-489.510) (-496.128) [-488.902] (-489.751) * (-489.116) (-492.994) [-488.356] (-497.793) -- 0:00:43
269500 -- (-495.326) (-492.339) [-490.905] (-488.732) * (-488.378) (-487.836) [-489.136] (-488.101) -- 0:00:43
270000 -- (-490.086) [-489.863] (-489.090) (-489.580) * (-490.222) (-488.032) (-489.668) [-490.213] -- 0:00:43
Average standard deviation of split frequencies: 0.012100
270500 -- (-491.681) (-490.593) (-488.742) [-488.183] * (-488.681) (-487.527) [-488.748] (-488.430) -- 0:00:43
271000 -- (-489.840) (-489.013) [-487.776] (-496.949) * (-489.876) (-487.927) [-491.080] (-490.605) -- 0:00:43
271500 -- (-488.880) (-490.191) [-490.158] (-490.582) * (-490.392) (-488.461) (-490.770) [-489.986] -- 0:00:42
272000 -- (-488.714) (-489.047) (-489.150) [-488.799] * (-488.873) [-488.080] (-490.716) (-490.259) -- 0:00:42
272500 -- (-491.840) [-488.952] (-491.021) (-491.211) * [-489.429] (-488.750) (-490.530) (-491.481) -- 0:00:42
273000 -- (-490.597) [-492.055] (-490.117) (-488.856) * (-488.495) [-489.782] (-489.643) (-489.047) -- 0:00:42
273500 -- (-488.737) (-490.421) (-491.242) [-489.491] * (-488.922) [-487.923] (-492.194) (-491.096) -- 0:00:42
274000 -- [-488.513] (-488.512) (-496.060) (-488.475) * (-489.386) [-491.298] (-494.248) (-490.006) -- 0:00:42
274500 -- [-489.917] (-487.823) (-492.879) (-488.657) * (-496.382) (-491.814) (-489.629) [-488.883] -- 0:00:42
275000 -- (-489.541) (-490.424) [-491.292] (-490.872) * (-493.061) [-488.499] (-488.368) (-491.684) -- 0:00:42
Average standard deviation of split frequencies: 0.011766
275500 -- (-490.643) (-489.585) [-493.504] (-488.780) * [-487.821] (-487.900) (-491.598) (-488.673) -- 0:00:42
276000 -- (-489.474) (-488.060) [-491.452] (-487.851) * (-490.807) (-488.474) [-488.784] (-492.062) -- 0:00:41
276500 -- (-492.191) (-490.280) (-492.108) [-488.817] * (-492.572) (-490.132) (-491.779) [-488.747] -- 0:00:41
277000 -- (-490.104) (-489.545) (-490.940) [-489.665] * (-489.315) (-489.200) [-490.470] (-487.755) -- 0:00:41
277500 -- (-496.343) (-491.231) [-490.918] (-488.691) * (-488.636) (-488.955) [-488.135] (-487.714) -- 0:00:41
278000 -- [-490.940] (-492.719) (-488.680) (-488.713) * (-490.164) (-488.420) (-490.001) [-488.897] -- 0:00:41
278500 -- [-488.596] (-489.138) (-489.007) (-494.416) * (-489.321) (-490.294) [-489.845] (-490.973) -- 0:00:41
279000 -- [-488.292] (-490.590) (-488.478) (-492.148) * (-488.601) (-490.583) [-487.890] (-493.911) -- 0:00:41
279500 -- (-492.034) (-490.715) [-487.626] (-489.936) * [-491.250] (-488.840) (-487.672) (-488.036) -- 0:00:41
280000 -- [-490.698] (-490.004) (-491.238) (-488.182) * (-491.088) [-492.402] (-488.802) (-491.550) -- 0:00:41
Average standard deviation of split frequencies: 0.014056
280500 -- [-489.118] (-490.463) (-492.431) (-491.814) * [-487.915] (-490.003) (-490.133) (-489.157) -- 0:00:41
281000 -- (-489.331) (-487.640) [-488.208] (-492.599) * [-489.310] (-488.211) (-490.764) (-491.469) -- 0:00:40
281500 -- [-487.974] (-487.937) (-489.099) (-490.410) * (-489.403) (-489.884) (-491.588) [-488.082] -- 0:00:43
282000 -- (-491.694) [-490.107] (-490.263) (-487.905) * (-488.775) (-491.110) [-489.114] (-488.438) -- 0:00:43
282500 -- (-488.353) (-490.742) [-488.957] (-489.276) * [-488.163] (-488.579) (-488.499) (-493.345) -- 0:00:43
283000 -- (-489.936) (-489.106) [-490.605] (-487.644) * [-489.510] (-487.597) (-488.978) (-491.362) -- 0:00:43
283500 -- [-490.575] (-491.816) (-489.446) (-488.899) * (-489.633) [-487.486] (-489.398) (-491.194) -- 0:00:42
284000 -- (-490.758) [-492.355] (-490.755) (-491.895) * [-488.743] (-488.321) (-490.071) (-488.574) -- 0:00:42
284500 -- (-491.383) [-491.653] (-487.798) (-491.801) * (-490.713) (-490.949) (-490.804) [-487.878] -- 0:00:42
285000 -- (-487.816) (-489.804) (-491.470) [-489.735] * (-491.197) (-487.538) (-491.359) [-487.942] -- 0:00:42
Average standard deviation of split frequencies: 0.013269
285500 -- (-490.745) [-489.803] (-491.470) (-491.594) * (-491.002) (-490.255) (-488.428) [-491.571] -- 0:00:42
286000 -- (-488.863) [-489.140] (-489.234) (-491.655) * (-487.957) [-489.314] (-490.459) (-492.587) -- 0:00:42
286500 -- [-488.400] (-487.948) (-489.901) (-491.765) * (-491.975) (-492.118) [-493.045] (-492.385) -- 0:00:42
287000 -- (-493.833) (-487.775) [-488.668] (-490.427) * (-492.744) (-488.990) (-490.089) [-488.026] -- 0:00:42
287500 -- [-495.721] (-492.076) (-489.193) (-490.354) * (-489.906) [-491.266] (-492.075) (-488.647) -- 0:00:42
288000 -- [-487.697] (-491.113) (-488.920) (-488.712) * (-488.533) [-488.246] (-488.182) (-491.356) -- 0:00:42
288500 -- (-487.608) [-489.893] (-489.809) (-489.567) * [-487.980] (-488.301) (-490.638) (-491.156) -- 0:00:41
289000 -- (-490.817) (-489.566) (-488.889) [-489.305] * [-487.782] (-490.219) (-488.898) (-490.357) -- 0:00:41
289500 -- (-488.410) (-487.860) [-488.815] (-493.880) * [-489.103] (-488.235) (-490.033) (-491.404) -- 0:00:41
290000 -- (-490.043) [-491.768] (-488.907) (-491.369) * (-496.182) (-494.620) [-489.959] (-490.511) -- 0:00:41
Average standard deviation of split frequencies: 0.012731
290500 -- (-490.775) (-489.412) (-490.504) [-488.421] * (-493.360) (-491.457) (-489.461) [-490.360] -- 0:00:41
291000 -- (-488.271) (-489.057) (-490.927) [-487.835] * [-489.767] (-490.647) (-489.269) (-489.891) -- 0:00:41
291500 -- (-489.404) [-489.294] (-489.845) (-490.974) * (-489.210) (-490.965) [-490.451] (-495.032) -- 0:00:41
292000 -- (-489.998) [-489.830] (-488.677) (-490.771) * (-489.602) (-494.562) (-494.623) [-493.840] -- 0:00:41
292500 -- [-490.913] (-489.457) (-488.647) (-489.015) * [-490.105] (-490.917) (-492.141) (-490.745) -- 0:00:41
293000 -- (-490.467) (-494.356) [-490.279] (-493.057) * (-489.160) [-491.369] (-491.854) (-490.871) -- 0:00:41
293500 -- (-488.158) (-493.511) [-490.478] (-493.419) * (-491.186) [-489.580] (-489.240) (-490.195) -- 0:00:40
294000 -- (-492.351) [-490.252] (-492.441) (-492.674) * [-490.017] (-491.830) (-487.611) (-490.471) -- 0:00:40
294500 -- (-490.116) (-488.610) (-489.913) [-491.565] * (-490.882) (-488.961) [-489.875] (-488.591) -- 0:00:40
295000 -- [-489.976] (-494.220) (-490.673) (-489.723) * (-490.053) [-488.811] (-490.702) (-494.863) -- 0:00:40
Average standard deviation of split frequencies: 0.013183
295500 -- [-491.712] (-489.958) (-491.265) (-489.326) * (-490.795) [-487.883] (-490.617) (-493.036) -- 0:00:40
296000 -- [-491.122] (-489.327) (-491.999) (-491.093) * (-488.904) (-491.688) (-489.604) [-490.824] -- 0:00:40
296500 -- (-491.684) [-488.974] (-488.881) (-490.421) * [-489.149] (-488.908) (-488.819) (-489.979) -- 0:00:40
297000 -- (-489.605) (-490.844) (-490.919) [-491.875] * (-488.396) (-490.661) (-487.574) [-489.508] -- 0:00:40
297500 -- (-489.831) (-490.523) (-493.059) [-489.883] * [-488.556] (-488.508) (-488.685) (-492.227) -- 0:00:40
298000 -- (-489.750) (-489.669) [-489.041] (-490.230) * (-491.480) [-488.610] (-490.949) (-492.143) -- 0:00:40
298500 -- (-491.042) (-491.769) (-488.420) [-490.128] * (-490.798) (-488.989) (-489.644) [-490.618] -- 0:00:42
299000 -- (-488.798) (-489.285) [-491.453] (-489.517) * (-491.100) [-490.212] (-487.549) (-490.446) -- 0:00:42
299500 -- [-487.618] (-496.233) (-491.391) (-488.738) * (-490.566) (-487.681) (-488.248) [-489.424] -- 0:00:42
300000 -- (-487.941) (-496.485) [-489.063] (-491.442) * (-487.866) (-487.971) (-489.601) [-489.104] -- 0:00:42
Average standard deviation of split frequencies: 0.013698
300500 -- [-490.694] (-498.617) (-490.513) (-488.140) * (-489.739) (-488.011) (-489.602) [-493.683] -- 0:00:41
301000 -- (-490.928) [-489.361] (-490.437) (-488.018) * (-490.009) (-488.683) (-489.023) [-489.421] -- 0:00:41
301500 -- (-488.408) (-488.804) [-488.541] (-488.682) * (-488.671) (-494.062) (-490.424) [-489.648] -- 0:00:41
302000 -- (-490.530) [-488.816] (-490.859) (-489.246) * (-488.384) [-490.208] (-487.508) (-491.855) -- 0:00:41
302500 -- [-488.648] (-490.980) (-489.676) (-488.605) * (-489.338) [-488.160] (-491.096) (-488.880) -- 0:00:41
303000 -- (-488.623) (-488.604) (-490.236) [-489.164] * (-489.916) (-490.342) [-489.723] (-490.020) -- 0:00:41
303500 -- [-489.794] (-488.439) (-491.333) (-491.202) * (-491.177) (-490.260) [-488.523] (-489.931) -- 0:00:41
304000 -- (-488.752) [-489.809] (-488.966) (-489.377) * (-489.163) (-489.683) (-491.074) [-489.540] -- 0:00:41
304500 -- (-488.550) [-488.302] (-489.399) (-489.274) * [-488.602] (-488.892) (-490.384) (-499.273) -- 0:00:41
305000 -- (-489.567) (-491.970) [-488.447] (-488.074) * (-493.578) [-489.049] (-489.903) (-495.633) -- 0:00:41
Average standard deviation of split frequencies: 0.012632
305500 -- (-490.827) (-495.504) [-489.978] (-488.645) * (-490.369) (-489.202) [-489.957] (-490.827) -- 0:00:40
306000 -- (-492.710) [-493.838] (-491.378) (-489.571) * (-490.574) (-489.786) (-488.659) [-491.958] -- 0:00:40
306500 -- (-495.814) [-493.295] (-493.008) (-490.158) * (-491.338) (-489.887) (-488.291) [-491.865] -- 0:00:40
307000 -- (-492.117) (-490.742) (-490.053) [-489.500] * [-489.846] (-487.779) (-489.184) (-490.243) -- 0:00:40
307500 -- (-489.510) (-489.945) [-488.572] (-491.118) * (-491.043) [-490.884] (-487.573) (-488.162) -- 0:00:40
308000 -- (-490.045) [-490.063] (-490.575) (-490.548) * [-488.801] (-490.353) (-489.396) (-492.871) -- 0:00:40
308500 -- (-489.701) (-490.923) (-488.220) [-489.761] * (-487.570) (-493.654) (-491.799) [-488.996] -- 0:00:40
309000 -- [-491.018] (-491.512) (-489.780) (-496.856) * [-488.706] (-490.227) (-491.786) (-495.893) -- 0:00:40
309500 -- (-493.376) [-490.128] (-488.960) (-491.151) * (-494.221) (-491.066) (-493.809) [-489.578] -- 0:00:40
310000 -- (-487.780) [-494.681] (-489.462) (-490.759) * (-491.826) [-488.544] (-495.161) (-490.624) -- 0:00:40
Average standard deviation of split frequencies: 0.012139
310500 -- (-488.490) (-487.982) [-488.220] (-490.374) * (-488.828) [-489.252] (-490.764) (-489.950) -- 0:00:39
311000 -- (-488.743) (-487.977) (-488.709) [-490.872] * (-492.867) [-487.907] (-491.242) (-488.841) -- 0:00:39
311500 -- (-488.693) [-490.497] (-488.380) (-488.552) * (-491.545) [-488.021] (-492.750) (-493.052) -- 0:00:39
312000 -- (-488.354) (-488.269) (-489.155) [-488.845] * (-491.796) [-488.100] (-491.334) (-489.457) -- 0:00:39
312500 -- (-487.949) [-490.511] (-488.958) (-490.695) * (-489.157) (-489.629) (-487.905) [-489.215] -- 0:00:39
313000 -- (-492.479) [-489.558] (-489.922) (-495.420) * (-489.921) (-489.513) (-487.941) [-491.965] -- 0:00:39
313500 -- [-488.997] (-494.623) (-490.751) (-490.121) * (-488.159) (-487.842) (-488.985) [-489.421] -- 0:00:39
314000 -- (-488.457) (-493.950) [-491.578] (-489.131) * (-491.493) [-491.023] (-490.723) (-488.420) -- 0:00:39
314500 -- (-490.108) (-491.088) (-489.068) [-488.902] * (-487.841) [-488.046] (-488.796) (-492.038) -- 0:00:39
315000 -- (-490.038) (-490.063) (-489.199) [-491.042] * (-488.747) [-492.027] (-489.582) (-489.441) -- 0:00:41
Average standard deviation of split frequencies: 0.011282
315500 -- (-489.387) (-493.104) (-493.633) [-488.273] * (-491.673) (-488.981) (-488.296) [-488.465] -- 0:00:41
316000 -- (-491.303) (-491.833) [-488.963] (-488.656) * [-491.802] (-488.558) (-491.831) (-488.641) -- 0:00:41
316500 -- (-490.607) [-493.020] (-491.684) (-488.347) * (-488.477) (-491.812) [-490.862] (-490.114) -- 0:00:41
317000 -- (-492.577) (-494.107) [-489.083] (-489.280) * [-488.389] (-490.745) (-492.343) (-497.479) -- 0:00:40
317500 -- (-496.621) [-489.394] (-488.028) (-488.359) * (-488.315) (-490.407) [-489.346] (-492.305) -- 0:00:40
318000 -- (-492.868) (-493.679) (-488.308) [-489.198] * (-491.175) (-488.273) [-488.046] (-491.621) -- 0:00:40
318500 -- (-489.276) (-493.038) (-489.591) [-488.828] * (-489.980) [-489.502] (-493.851) (-488.477) -- 0:00:40
319000 -- (-487.939) (-489.549) (-489.849) [-489.129] * [-489.802] (-489.381) (-492.672) (-491.631) -- 0:00:40
319500 -- [-488.502] (-488.323) (-490.566) (-490.064) * (-490.913) (-490.044) [-488.083] (-488.607) -- 0:00:40
320000 -- (-488.049) (-488.041) (-487.721) [-489.491] * (-490.524) (-487.985) (-489.334) [-490.546] -- 0:00:40
Average standard deviation of split frequencies: 0.011501
320500 -- (-488.653) (-487.592) (-489.578) [-489.250] * (-487.958) (-493.535) [-489.108] (-489.663) -- 0:00:40
321000 -- [-489.664] (-489.525) (-491.515) (-493.163) * [-487.985] (-491.802) (-488.426) (-490.361) -- 0:00:40
321500 -- [-489.577] (-488.092) (-488.448) (-489.189) * (-489.103) (-491.509) [-491.562] (-492.233) -- 0:00:40
322000 -- (-488.464) (-491.713) (-488.495) [-489.546] * [-489.120] (-489.543) (-489.087) (-488.820) -- 0:00:40
322500 -- (-491.960) (-495.743) (-489.347) [-494.362] * (-491.628) [-487.673] (-489.397) (-488.241) -- 0:00:39
323000 -- (-489.636) (-490.702) [-488.853] (-493.278) * (-489.755) [-489.555] (-488.056) (-490.962) -- 0:00:39
323500 -- (-489.210) (-491.162) (-493.641) [-490.989] * (-489.154) (-489.374) (-488.515) [-490.630] -- 0:00:39
324000 -- (-495.369) [-489.381] (-492.153) (-493.146) * (-488.594) (-489.964) [-491.350] (-488.817) -- 0:00:39
324500 -- (-489.080) [-488.871] (-489.941) (-491.249) * (-489.465) (-489.843) [-493.117] (-491.717) -- 0:00:39
325000 -- (-495.332) (-488.550) [-487.829] (-490.535) * (-489.771) (-491.211) (-489.552) [-489.307] -- 0:00:39
Average standard deviation of split frequencies: 0.010773
325500 -- (-490.006) (-487.829) (-491.658) [-488.676] * (-488.446) (-490.267) [-490.700] (-489.503) -- 0:00:39
326000 -- (-491.383) (-488.154) [-489.255] (-488.236) * (-490.011) (-488.626) (-491.224) [-489.946] -- 0:00:39
326500 -- [-489.439] (-488.534) (-489.193) (-488.641) * (-490.053) (-490.096) [-491.083] (-491.504) -- 0:00:39
327000 -- [-490.081] (-488.878) (-489.273) (-489.780) * (-488.776) [-488.698] (-488.089) (-488.933) -- 0:00:39
327500 -- (-492.882) (-488.133) (-497.162) [-489.835] * [-488.418] (-492.006) (-491.903) (-490.695) -- 0:00:39
328000 -- (-490.524) (-489.043) [-489.183] (-488.823) * (-492.009) (-494.962) [-490.132] (-493.246) -- 0:00:38
328500 -- (-489.784) (-493.164) (-488.653) [-494.640] * [-491.287] (-490.863) (-489.058) (-490.401) -- 0:00:38
329000 -- [-489.943] (-490.516) (-489.586) (-498.188) * (-489.773) (-488.456) (-488.398) [-488.899] -- 0:00:38
329500 -- [-491.550] (-488.448) (-492.701) (-488.930) * [-494.459] (-493.679) (-489.310) (-489.692) -- 0:00:38
330000 -- (-490.355) (-489.850) (-492.219) [-488.015] * [-489.609] (-488.617) (-490.019) (-489.807) -- 0:00:38
Average standard deviation of split frequencies: 0.011484
330500 -- [-488.837] (-490.869) (-488.172) (-491.558) * (-488.954) (-488.907) [-489.450] (-492.142) -- 0:00:38
331000 -- (-488.854) [-490.877] (-488.133) (-490.311) * (-488.142) [-491.753] (-489.157) (-495.713) -- 0:00:40
331500 -- (-488.474) [-490.847] (-488.570) (-490.058) * (-488.679) (-488.912) [-488.241] (-489.632) -- 0:00:40
332000 -- (-491.000) [-488.632] (-492.474) (-490.664) * (-489.732) (-490.649) [-490.680] (-488.703) -- 0:00:40
332500 -- (-490.354) [-489.226] (-490.443) (-488.652) * [-489.300] (-493.202) (-493.693) (-493.173) -- 0:00:40
333000 -- (-490.950) [-489.490] (-489.633) (-489.585) * [-492.193] (-491.415) (-491.800) (-491.913) -- 0:00:40
333500 -- (-491.841) [-489.280] (-493.713) (-488.569) * [-490.283] (-490.324) (-488.361) (-488.954) -- 0:00:39
334000 -- (-491.699) (-488.639) [-490.667] (-489.643) * (-489.594) [-489.257] (-489.088) (-489.154) -- 0:00:39
334500 -- [-490.248] (-489.354) (-488.911) (-489.340) * (-491.680) (-489.455) [-492.566] (-488.743) -- 0:00:39
335000 -- (-489.534) (-489.284) [-489.558] (-494.082) * (-492.408) (-493.750) (-491.249) [-491.383] -- 0:00:39
Average standard deviation of split frequencies: 0.011536
335500 -- (-489.356) (-489.491) [-487.796] (-497.564) * (-488.531) (-491.291) [-489.572] (-492.905) -- 0:00:39
336000 -- (-490.500) [-488.072] (-489.204) (-488.913) * (-489.491) (-488.627) (-490.746) [-495.745] -- 0:00:39
336500 -- (-489.632) (-491.050) [-491.967] (-490.325) * (-488.497) [-489.721] (-491.725) (-491.540) -- 0:00:39
337000 -- (-491.154) (-489.751) (-489.364) [-490.520] * (-487.659) [-488.689] (-494.320) (-490.888) -- 0:00:39
337500 -- (-491.445) (-488.899) [-490.944] (-488.438) * [-488.917] (-489.042) (-489.263) (-489.557) -- 0:00:39
338000 -- (-491.278) (-488.335) [-489.298] (-491.183) * [-489.258] (-492.473) (-493.279) (-488.511) -- 0:00:39
338500 -- [-488.983] (-492.633) (-492.767) (-489.416) * (-487.947) (-488.511) [-495.940] (-488.470) -- 0:00:39
339000 -- [-494.602] (-488.658) (-491.128) (-490.174) * [-488.782] (-492.173) (-495.541) (-487.524) -- 0:00:38
339500 -- (-493.264) [-489.047] (-488.087) (-491.607) * [-489.545] (-491.789) (-491.082) (-490.154) -- 0:00:38
340000 -- (-491.611) [-489.516] (-490.185) (-488.784) * (-489.647) (-488.008) [-488.188] (-491.708) -- 0:00:38
Average standard deviation of split frequencies: 0.011916
340500 -- (-492.047) [-489.973] (-489.541) (-488.861) * [-488.884] (-488.295) (-488.281) (-489.605) -- 0:00:38
341000 -- (-491.950) [-490.603] (-489.365) (-488.817) * (-489.066) (-487.805) (-490.311) [-491.563] -- 0:00:38
341500 -- (-490.079) [-495.492] (-489.378) (-489.450) * (-489.342) [-488.608] (-488.157) (-491.658) -- 0:00:38
342000 -- [-489.200] (-490.614) (-491.137) (-490.304) * (-493.131) (-487.439) (-490.447) [-491.070] -- 0:00:38
342500 -- (-487.902) (-491.460) (-495.412) [-492.906] * (-488.847) [-488.509] (-488.012) (-489.535) -- 0:00:38
343000 -- (-492.499) (-491.179) [-491.459] (-490.091) * (-490.704) [-487.869] (-489.488) (-488.579) -- 0:00:38
343500 -- (-490.594) [-489.486] (-491.989) (-496.610) * (-491.081) [-488.368] (-488.029) (-489.011) -- 0:00:38
344000 -- (-490.321) (-488.584) (-491.668) [-487.984] * (-491.619) (-490.353) [-487.941] (-489.280) -- 0:00:38
344500 -- (-492.658) [-490.848] (-487.940) (-488.214) * (-488.635) (-489.338) (-491.592) [-489.643] -- 0:00:38
345000 -- (-490.329) (-488.188) (-488.972) [-488.242] * (-488.268) (-488.545) [-489.213] (-491.001) -- 0:00:37
Average standard deviation of split frequencies: 0.010294
345500 -- [-491.598] (-491.144) (-491.038) (-489.549) * (-489.400) [-489.407] (-488.263) (-491.846) -- 0:00:37
346000 -- (-492.353) [-489.397] (-490.684) (-490.527) * (-488.639) (-488.043) (-487.977) [-491.156] -- 0:00:37
346500 -- (-488.213) [-489.124] (-492.561) (-491.037) * (-488.545) [-489.056] (-488.027) (-490.385) -- 0:00:37
347000 -- (-489.654) (-495.201) (-494.159) [-490.718] * (-488.330) (-493.995) (-488.497) [-489.532] -- 0:00:37
347500 -- [-491.890] (-490.245) (-493.487) (-488.823) * [-490.200] (-494.549) (-489.369) (-491.187) -- 0:00:37
348000 -- (-490.001) (-489.398) [-490.194] (-489.619) * (-490.653) (-493.890) [-489.697] (-488.765) -- 0:00:39
348500 -- (-490.551) (-492.015) (-493.169) [-489.793] * (-489.836) [-488.818] (-490.499) (-493.429) -- 0:00:39
349000 -- (-488.032) (-488.895) (-493.554) [-487.757] * [-491.569] (-489.581) (-488.719) (-491.435) -- 0:00:39
349500 -- (-491.062) [-487.852] (-491.078) (-489.248) * (-492.767) (-490.618) [-490.556] (-488.440) -- 0:00:39
350000 -- (-489.692) [-489.058] (-494.279) (-490.159) * (-487.941) [-490.390] (-488.605) (-489.629) -- 0:00:39
Average standard deviation of split frequencies: 0.010359
350500 -- (-489.505) (-487.828) [-488.097] (-489.716) * (-492.676) (-488.377) (-488.656) [-489.364] -- 0:00:38
351000 -- (-490.159) (-490.971) (-488.305) [-489.619] * (-490.916) (-489.417) [-488.973] (-488.173) -- 0:00:38
351500 -- (-489.115) (-488.381) (-490.858) [-489.314] * (-491.530) (-491.481) (-489.030) [-492.705] -- 0:00:38
352000 -- [-490.829] (-488.222) (-491.643) (-490.234) * [-489.743] (-490.615) (-489.557) (-492.501) -- 0:00:38
352500 -- (-493.599) (-490.883) [-487.970] (-490.151) * [-490.351] (-489.795) (-488.807) (-489.941) -- 0:00:38
353000 -- (-489.932) [-490.289] (-491.072) (-489.024) * [-490.769] (-490.404) (-489.304) (-489.703) -- 0:00:38
353500 -- (-493.074) (-496.519) [-489.400] (-488.097) * (-488.554) [-489.382] (-488.307) (-488.480) -- 0:00:38
354000 -- (-490.662) (-492.078) [-490.045] (-488.708) * [-489.234] (-491.952) (-490.418) (-489.392) -- 0:00:38
354500 -- (-489.673) (-488.641) (-491.548) [-490.774] * (-492.822) (-491.993) (-489.981) [-493.058] -- 0:00:38
355000 -- (-490.138) (-490.992) (-489.785) [-489.356] * (-489.669) (-489.713) (-488.622) [-494.059] -- 0:00:38
Average standard deviation of split frequencies: 0.010438
355500 -- (-490.983) (-489.515) (-496.379) [-490.795] * (-490.904) (-488.318) (-488.905) [-491.628] -- 0:00:38
356000 -- (-494.819) (-492.003) (-494.038) [-492.463] * [-488.340] (-489.969) (-488.017) (-491.508) -- 0:00:37
356500 -- [-489.164] (-490.825) (-492.667) (-488.601) * (-488.337) (-488.883) (-493.570) [-492.337] -- 0:00:37
357000 -- (-494.678) (-490.854) [-489.603] (-488.829) * [-491.012] (-490.077) (-490.739) (-489.623) -- 0:00:37
357500 -- (-490.204) (-489.196) (-496.793) [-488.756] * (-487.857) (-494.179) (-489.261) [-488.900] -- 0:00:37
358000 -- [-490.867] (-491.069) (-489.420) (-491.701) * (-488.407) (-491.711) (-489.093) [-491.201] -- 0:00:37
358500 -- [-489.778] (-490.594) (-492.124) (-489.442) * (-491.581) [-489.213] (-489.581) (-490.910) -- 0:00:37
359000 -- (-494.202) (-487.795) [-488.496] (-488.743) * [-493.007] (-492.896) (-493.281) (-488.715) -- 0:00:37
359500 -- [-496.218] (-489.763) (-491.669) (-489.958) * (-489.556) (-488.407) [-493.326] (-490.036) -- 0:00:37
360000 -- (-488.884) [-489.158] (-490.184) (-490.842) * (-489.453) (-492.837) (-490.332) [-488.333] -- 0:00:37
Average standard deviation of split frequencies: 0.009803
360500 -- (-489.672) [-488.385] (-488.530) (-492.660) * (-493.099) (-494.015) (-489.496) [-492.184] -- 0:00:37
361000 -- (-489.386) (-488.672) [-488.564] (-490.673) * (-495.021) [-488.506] (-488.420) (-487.778) -- 0:00:37
361500 -- (-488.511) [-489.649] (-490.324) (-491.056) * [-490.189] (-487.677) (-487.916) (-489.810) -- 0:00:37
362000 -- (-491.425) [-488.737] (-489.268) (-492.149) * (-490.952) [-488.417] (-490.127) (-491.513) -- 0:00:37
362500 -- [-491.181] (-490.268) (-491.450) (-491.963) * [-489.342] (-489.064) (-488.680) (-491.442) -- 0:00:36
363000 -- (-490.858) (-490.289) [-492.307] (-493.638) * (-490.677) [-488.976] (-493.409) (-489.326) -- 0:00:36
363500 -- (-489.319) (-488.580) (-492.310) [-488.709] * (-490.598) (-489.071) (-490.530) [-490.783] -- 0:00:36
364000 -- (-488.367) [-489.376] (-489.346) (-488.126) * (-490.441) (-490.075) (-490.128) [-487.918] -- 0:00:36
364500 -- [-491.479] (-492.981) (-489.430) (-490.006) * (-487.636) (-491.699) [-489.571] (-490.224) -- 0:00:36
365000 -- (-488.227) (-488.825) (-490.859) [-488.244] * [-490.348] (-492.689) (-493.034) (-493.895) -- 0:00:38
Average standard deviation of split frequencies: 0.009257
365500 -- (-487.820) [-492.044] (-493.030) (-488.805) * [-489.424] (-488.668) (-489.569) (-494.816) -- 0:00:38
366000 -- [-488.469] (-492.645) (-489.635) (-489.330) * [-489.194] (-494.545) (-488.622) (-490.242) -- 0:00:38
366500 -- (-490.661) (-498.019) [-490.382] (-490.039) * [-488.580] (-493.315) (-492.703) (-490.220) -- 0:00:38
367000 -- (-489.696) (-488.738) [-492.703] (-489.650) * (-489.425) [-490.588] (-492.960) (-489.190) -- 0:00:37
367500 -- (-488.541) [-490.356] (-492.825) (-490.775) * (-490.373) (-490.307) (-493.661) [-488.123] -- 0:00:37
368000 -- (-489.579) (-492.774) (-491.335) [-490.526] * (-490.923) (-488.806) (-490.716) [-492.403] -- 0:00:37
368500 -- (-490.080) (-488.412) [-488.643] (-493.268) * [-488.951] (-491.777) (-488.483) (-492.527) -- 0:00:37
369000 -- [-490.278] (-493.449) (-489.303) (-488.504) * (-490.317) (-492.131) (-489.534) [-491.245] -- 0:00:37
369500 -- (-490.182) [-494.179] (-488.425) (-491.541) * (-488.912) (-490.797) [-489.240] (-489.300) -- 0:00:37
370000 -- (-490.141) (-489.720) (-487.862) [-489.729] * [-489.247] (-490.346) (-489.772) (-488.766) -- 0:00:37
Average standard deviation of split frequencies: 0.009114
370500 -- [-491.356] (-488.582) (-491.692) (-491.834) * [-490.152] (-489.554) (-491.085) (-488.214) -- 0:00:37
371000 -- (-491.560) (-488.963) [-489.994] (-489.448) * (-488.646) [-487.965] (-494.684) (-493.175) -- 0:00:37
371500 -- (-491.140) (-491.777) (-490.066) [-487.879] * (-492.822) [-488.978] (-490.171) (-490.323) -- 0:00:37
372000 -- [-487.628] (-500.092) (-491.488) (-490.821) * (-488.836) [-489.634] (-493.650) (-492.358) -- 0:00:37
372500 -- (-493.179) (-497.244) (-489.265) [-488.702] * (-488.937) (-490.575) [-489.591] (-489.115) -- 0:00:37
373000 -- (-490.913) (-493.549) [-487.951] (-488.990) * (-490.456) (-491.171) (-488.780) [-488.976] -- 0:00:36
373500 -- [-491.251] (-488.519) (-489.653) (-490.556) * (-491.253) [-488.261] (-489.996) (-488.231) -- 0:00:36
374000 -- (-488.528) (-491.138) (-488.116) [-491.267] * [-490.997] (-490.274) (-487.793) (-489.438) -- 0:00:36
374500 -- (-490.002) (-489.322) (-488.615) [-489.109] * (-489.921) (-488.948) (-488.383) [-490.353] -- 0:00:36
375000 -- (-488.620) (-487.738) (-493.107) [-489.575] * [-489.877] (-488.552) (-490.345) (-491.585) -- 0:00:36
Average standard deviation of split frequencies: 0.007817
375500 -- [-493.951] (-488.234) (-491.323) (-493.589) * [-493.810] (-489.911) (-492.716) (-489.824) -- 0:00:36
376000 -- (-490.489) (-489.031) [-488.910] (-491.603) * (-489.120) (-494.173) [-492.441] (-488.184) -- 0:00:36
376500 -- (-488.059) (-488.089) (-490.427) [-488.494] * (-488.679) (-489.373) [-491.956] (-487.737) -- 0:00:36
377000 -- (-489.838) (-491.772) (-492.392) [-488.025] * (-489.815) (-491.325) [-491.276] (-489.217) -- 0:00:36
377500 -- (-488.524) (-492.329) [-488.379] (-490.285) * (-488.705) [-488.923] (-489.767) (-488.620) -- 0:00:36
378000 -- (-488.960) (-491.032) (-487.534) [-490.956] * [-489.213] (-491.858) (-488.994) (-490.332) -- 0:00:36
378500 -- (-491.278) [-494.312] (-488.324) (-488.006) * (-489.252) (-492.455) (-489.281) [-488.998] -- 0:00:36
379000 -- (-489.509) (-494.554) (-490.172) [-490.432] * [-490.749] (-489.758) (-491.278) (-488.486) -- 0:00:36
379500 -- (-491.428) (-496.495) [-494.536] (-490.733) * [-490.217] (-489.552) (-490.883) (-492.686) -- 0:00:35
380000 -- (-490.449) [-489.163] (-489.960) (-489.492) * [-488.076] (-487.842) (-492.762) (-489.757) -- 0:00:35
Average standard deviation of split frequencies: 0.008304
380500 -- (-488.440) [-493.100] (-488.775) (-488.208) * (-489.169) (-490.313) (-489.687) [-490.877] -- 0:00:35
381000 -- [-491.617] (-492.173) (-488.449) (-490.392) * (-491.005) [-491.211] (-490.220) (-489.836) -- 0:00:35
381500 -- (-490.148) (-492.403) [-489.170] (-490.967) * [-491.215] (-493.774) (-489.984) (-488.933) -- 0:00:37
382000 -- (-488.590) (-488.297) [-492.421] (-489.177) * (-487.790) (-489.169) (-488.611) [-489.883] -- 0:00:37
382500 -- (-490.086) [-489.390] (-488.161) (-489.685) * [-488.404] (-489.764) (-489.565) (-491.062) -- 0:00:37
383000 -- (-490.151) (-488.861) [-490.580] (-490.727) * [-488.163] (-489.036) (-489.505) (-489.416) -- 0:00:37
383500 -- (-491.698) (-489.388) (-489.192) [-488.129] * (-489.347) (-488.551) [-487.796] (-489.249) -- 0:00:36
384000 -- (-489.640) (-487.959) [-490.558] (-489.687) * (-487.958) (-487.729) [-488.914] (-490.071) -- 0:00:36
384500 -- [-493.780] (-488.526) (-488.740) (-488.291) * (-490.013) (-494.807) [-490.686] (-488.264) -- 0:00:36
385000 -- (-488.952) [-492.088] (-491.607) (-492.613) * (-489.442) [-488.698] (-490.617) (-491.728) -- 0:00:36
Average standard deviation of split frequencies: 0.007759
385500 -- [-490.824] (-493.108) (-493.604) (-490.864) * (-491.671) (-493.759) [-488.125] (-488.329) -- 0:00:36
386000 -- (-489.071) [-490.413] (-491.583) (-496.968) * (-490.097) (-490.788) (-488.648) [-487.888] -- 0:00:36
386500 -- (-487.626) (-495.508) [-488.359] (-493.408) * [-488.862] (-489.227) (-490.174) (-491.739) -- 0:00:36
387000 -- (-488.315) (-488.008) (-488.118) [-488.639] * (-489.653) (-491.590) [-490.736] (-490.866) -- 0:00:36
387500 -- [-489.680] (-491.531) (-492.829) (-488.961) * (-491.373) (-489.688) [-489.624] (-490.130) -- 0:00:36
388000 -- [-488.026] (-493.683) (-488.955) (-489.560) * (-490.212) [-487.858] (-487.717) (-490.229) -- 0:00:36
388500 -- [-491.859] (-496.080) (-488.096) (-488.126) * [-490.545] (-491.348) (-489.508) (-493.221) -- 0:00:36
389000 -- (-490.933) (-491.940) [-489.087] (-492.660) * (-489.593) (-489.166) [-488.047] (-487.779) -- 0:00:36
389500 -- (-489.325) (-488.030) [-490.385] (-493.536) * (-489.637) (-493.558) (-488.000) [-492.662] -- 0:00:36
390000 -- (-491.608) (-487.620) [-493.010] (-489.270) * [-488.628] (-492.167) (-490.729) (-489.964) -- 0:00:35
Average standard deviation of split frequencies: 0.007617
390500 -- (-493.140) (-488.922) (-493.009) [-488.196] * (-489.692) (-488.975) (-489.980) [-490.723] -- 0:00:35
391000 -- [-487.891] (-488.087) (-496.083) (-492.032) * [-489.152] (-490.970) (-487.717) (-488.693) -- 0:00:35
391500 -- (-489.473) (-493.093) (-487.671) [-488.614] * [-489.635] (-496.404) (-490.364) (-488.913) -- 0:00:35
392000 -- (-491.010) [-491.234] (-490.356) (-491.922) * (-491.543) [-490.939] (-491.739) (-489.835) -- 0:00:35
392500 -- (-489.649) (-489.202) [-489.276] (-490.399) * (-488.015) (-488.587) (-492.179) [-489.971] -- 0:00:35
393000 -- (-491.990) (-489.966) [-488.855] (-492.063) * (-489.646) (-489.175) (-488.580) [-489.941] -- 0:00:35
393500 -- (-491.345) (-489.478) [-491.083] (-488.539) * (-489.138) (-495.090) (-488.574) [-490.254] -- 0:00:35
394000 -- (-488.209) (-490.533) [-488.618] (-490.368) * [-488.816] (-490.756) (-487.429) (-488.119) -- 0:00:35
394500 -- (-495.595) (-492.156) [-491.196] (-488.314) * (-490.008) (-489.559) (-492.333) [-488.798] -- 0:00:35
395000 -- [-488.792] (-491.358) (-491.076) (-488.998) * [-490.427] (-491.542) (-491.888) (-494.586) -- 0:00:35
Average standard deviation of split frequencies: 0.008556
395500 -- (-490.849) (-492.954) [-488.384] (-487.641) * (-490.549) [-488.302] (-492.339) (-494.807) -- 0:00:35
396000 -- (-490.277) (-489.467) [-490.225] (-488.754) * (-491.039) (-490.215) [-492.002] (-492.018) -- 0:00:35
396500 -- (-488.145) [-492.958] (-489.973) (-489.764) * (-489.472) (-492.349) [-490.203] (-492.463) -- 0:00:35
397000 -- (-487.932) [-497.120] (-490.276) (-488.087) * (-488.126) (-487.939) (-490.932) [-489.494] -- 0:00:34
397500 -- (-495.509) (-493.344) [-488.421] (-488.423) * [-488.713] (-488.011) (-489.449) (-489.751) -- 0:00:34
398000 -- (-490.716) (-490.327) [-489.336] (-489.890) * [-488.966] (-487.709) (-488.023) (-493.689) -- 0:00:34
398500 -- [-487.932] (-490.104) (-489.926) (-493.094) * [-490.555] (-493.245) (-490.394) (-488.405) -- 0:00:36
399000 -- (-491.011) (-489.905) (-489.406) [-488.539] * (-488.139) (-491.203) [-488.787] (-488.324) -- 0:00:36
399500 -- (-489.898) (-492.618) [-494.723] (-488.874) * [-491.291] (-487.511) (-497.505) (-488.753) -- 0:00:36
400000 -- (-487.940) (-492.684) [-488.902] (-490.991) * (-489.498) (-495.274) (-493.582) [-487.430] -- 0:00:36
Average standard deviation of split frequencies: 0.008582
400500 -- (-488.690) [-489.508] (-490.085) (-488.331) * (-489.557) (-488.010) [-489.084] (-490.807) -- 0:00:35
401000 -- (-488.677) (-488.469) (-490.720) [-489.229] * (-493.438) (-488.405) (-491.174) [-491.977] -- 0:00:35
401500 -- (-488.666) [-488.964] (-490.685) (-492.544) * (-489.803) (-490.487) [-491.361] (-490.030) -- 0:00:35
402000 -- (-488.942) (-489.789) [-488.471] (-487.852) * [-491.815] (-489.050) (-491.286) (-491.050) -- 0:00:35
402500 -- (-489.055) (-488.900) (-489.908) [-489.085] * [-488.407] (-489.699) (-489.667) (-492.844) -- 0:00:35
403000 -- (-488.188) (-491.494) (-488.489) [-489.425] * (-488.475) (-491.900) [-488.565] (-490.458) -- 0:00:35
403500 -- [-488.464] (-491.415) (-489.373) (-490.695) * (-490.514) (-491.128) [-488.099] (-489.049) -- 0:00:35
404000 -- (-489.086) (-488.758) [-488.593] (-491.004) * [-488.611] (-488.964) (-494.568) (-489.139) -- 0:00:35
404500 -- (-489.802) (-489.001) (-488.229) [-490.879] * (-488.688) (-488.524) [-490.773] (-489.522) -- 0:00:35
405000 -- [-490.025] (-487.628) (-489.107) (-491.596) * (-488.253) (-489.190) (-487.581) [-489.178] -- 0:00:35
Average standard deviation of split frequencies: 0.009144
405500 -- (-490.196) [-489.508] (-493.490) (-490.474) * (-489.368) (-492.135) (-492.380) [-489.457] -- 0:00:35
406000 -- (-491.181) (-492.315) (-492.726) [-490.011] * (-489.783) [-491.949] (-490.668) (-488.986) -- 0:00:35
406500 -- (-489.815) (-489.586) (-490.665) [-489.780] * (-491.145) [-492.007] (-489.925) (-489.827) -- 0:00:35
407000 -- (-492.632) [-490.982] (-490.393) (-488.443) * (-489.133) [-489.065] (-488.476) (-488.582) -- 0:00:34
407500 -- (-492.944) (-490.946) (-492.659) [-490.126] * (-489.526) [-490.239] (-491.516) (-488.837) -- 0:00:34
408000 -- (-492.092) [-488.605] (-490.492) (-491.383) * [-489.087] (-488.644) (-488.101) (-494.034) -- 0:00:34
408500 -- [-489.145] (-488.542) (-488.885) (-487.594) * (-487.528) (-488.175) (-489.332) [-491.634] -- 0:00:34
409000 -- (-488.870) (-490.655) (-490.750) [-487.944] * (-488.996) (-493.142) (-490.732) [-489.353] -- 0:00:34
409500 -- (-487.949) (-488.217) [-490.459] (-489.964) * (-488.878) [-491.688] (-491.577) (-488.001) -- 0:00:34
410000 -- (-491.565) (-489.393) (-491.146) [-488.233] * (-492.593) (-490.481) [-490.280] (-489.292) -- 0:00:34
Average standard deviation of split frequencies: 0.008913
410500 -- (-490.765) [-491.464] (-491.425) (-489.940) * (-492.392) (-491.912) (-491.214) [-489.212] -- 0:00:34
411000 -- (-491.124) (-493.509) (-488.629) [-488.456] * (-491.789) (-488.409) (-489.523) [-488.832] -- 0:00:34
411500 -- (-492.164) (-492.366) (-489.010) [-489.011] * (-496.299) [-488.073] (-491.275) (-487.735) -- 0:00:34
412000 -- (-492.799) [-492.561] (-488.638) (-489.288) * [-490.779] (-487.956) (-490.042) (-488.750) -- 0:00:34
412500 -- (-487.869) [-492.593] (-490.803) (-493.606) * (-490.105) (-489.944) (-490.489) [-491.813] -- 0:00:34
413000 -- (-488.079) (-488.347) [-490.327] (-490.055) * (-494.352) (-490.357) (-491.105) [-494.888] -- 0:00:34
413500 -- (-490.374) (-489.199) [-489.719] (-489.701) * (-489.926) (-492.888) (-490.802) [-488.725] -- 0:00:34
414000 -- (-492.736) [-491.886] (-490.070) (-492.724) * (-490.318) (-490.575) [-490.721] (-488.165) -- 0:00:33
414500 -- (-494.472) (-489.098) (-492.181) [-490.005] * (-490.767) (-490.150) (-490.907) [-489.056] -- 0:00:33
415000 -- [-490.014] (-488.199) (-488.054) (-490.483) * (-490.332) (-489.927) [-488.355] (-491.101) -- 0:00:33
Average standard deviation of split frequencies: 0.008853
415500 -- (-495.366) (-489.801) (-491.045) [-491.484] * (-489.976) (-489.853) [-488.799] (-492.145) -- 0:00:35
416000 -- (-492.089) (-489.888) (-490.882) [-491.913] * (-494.001) (-492.259) [-488.471] (-488.628) -- 0:00:35
416500 -- (-490.663) (-493.992) (-492.069) [-488.938] * (-490.757) (-491.528) (-490.927) [-490.015] -- 0:00:35
417000 -- (-488.226) (-488.852) [-488.674] (-488.971) * (-488.993) [-489.864] (-489.712) (-491.568) -- 0:00:34
417500 -- (-488.324) (-489.039) [-489.709] (-489.250) * [-488.148] (-490.640) (-489.128) (-491.287) -- 0:00:34
418000 -- (-490.600) [-489.537] (-494.673) (-495.682) * (-489.326) (-489.616) (-488.797) [-490.471] -- 0:00:34
418500 -- (-488.462) (-490.592) (-491.015) [-491.784] * (-487.885) [-491.366] (-489.174) (-491.384) -- 0:00:34
419000 -- (-491.720) (-493.034) [-492.832] (-493.124) * [-487.859] (-492.828) (-489.296) (-490.349) -- 0:00:34
419500 -- [-489.399] (-491.465) (-493.114) (-491.639) * (-489.260) (-491.156) (-493.246) [-489.464] -- 0:00:34
420000 -- [-488.724] (-490.224) (-491.766) (-488.961) * (-489.260) (-489.532) (-488.136) [-492.308] -- 0:00:34
Average standard deviation of split frequencies: 0.008755
420500 -- [-494.380] (-488.902) (-489.616) (-488.674) * (-489.669) [-489.225] (-491.480) (-494.250) -- 0:00:34
421000 -- (-496.434) [-492.329] (-489.196) (-489.106) * [-488.220] (-490.174) (-491.386) (-492.076) -- 0:00:34
421500 -- [-488.951] (-495.123) (-489.041) (-488.179) * (-491.664) [-488.251] (-489.766) (-493.329) -- 0:00:34
422000 -- (-487.967) [-491.658] (-489.172) (-491.110) * (-489.344) (-488.692) (-494.525) [-488.909] -- 0:00:34
422500 -- [-490.429] (-490.659) (-488.188) (-488.939) * (-488.042) [-490.781] (-491.686) (-489.801) -- 0:00:34
423000 -- (-489.474) (-490.296) [-489.217] (-489.602) * [-488.110] (-490.548) (-491.944) (-487.873) -- 0:00:34
423500 -- (-490.059) (-488.745) [-488.192] (-489.416) * [-488.804] (-489.101) (-489.429) (-490.215) -- 0:00:34
424000 -- (-488.662) (-489.557) [-488.523] (-489.282) * (-488.797) [-489.588] (-492.065) (-488.744) -- 0:00:33
424500 -- (-492.399) (-488.392) [-489.660] (-491.175) * (-488.985) (-489.795) (-487.596) [-489.657] -- 0:00:33
425000 -- [-488.847] (-488.272) (-490.063) (-493.648) * (-493.070) (-489.764) [-488.738] (-488.294) -- 0:00:33
Average standard deviation of split frequencies: 0.008784
425500 -- (-490.814) (-488.847) (-494.643) [-488.863] * [-489.238] (-488.892) (-491.337) (-495.873) -- 0:00:33
426000 -- (-489.608) [-490.225] (-489.028) (-487.862) * (-489.320) [-490.355] (-490.473) (-491.868) -- 0:00:33
426500 -- (-487.811) [-490.671] (-490.974) (-489.993) * (-489.713) (-489.184) [-489.857] (-493.628) -- 0:00:33
427000 -- (-488.643) (-491.386) [-489.134] (-489.660) * [-488.692] (-490.880) (-490.362) (-492.749) -- 0:00:33
427500 -- [-487.303] (-489.922) (-489.347) (-496.600) * (-488.260) [-489.727] (-487.808) (-488.358) -- 0:00:33
428000 -- (-488.539) [-489.097] (-494.016) (-490.433) * (-488.612) (-489.309) [-487.651] (-491.758) -- 0:00:33
428500 -- (-495.430) (-489.344) [-489.766] (-489.759) * (-489.520) [-489.467] (-493.673) (-489.036) -- 0:00:33
429000 -- (-493.238) (-490.682) [-492.031] (-489.410) * (-490.715) (-489.688) [-489.992] (-491.823) -- 0:00:33
429500 -- (-491.414) (-488.407) (-492.615) [-489.734] * (-492.021) (-489.088) [-489.399] (-492.782) -- 0:00:33
430000 -- (-490.822) (-490.064) [-491.827] (-489.491) * [-490.644] (-492.706) (-492.587) (-489.792) -- 0:00:33
Average standard deviation of split frequencies: 0.008894
430500 -- (-489.936) (-492.844) (-492.092) [-488.024] * (-492.350) (-490.308) [-490.561] (-492.467) -- 0:00:33
431000 -- (-488.463) [-493.341] (-488.213) (-488.665) * (-493.266) (-491.155) [-490.477] (-491.296) -- 0:00:33
431500 -- [-489.892] (-489.193) (-488.158) (-491.031) * (-488.822) [-487.730] (-491.620) (-491.000) -- 0:00:32
432000 -- (-491.716) (-488.534) [-488.736] (-488.872) * (-489.687) (-492.915) (-489.238) [-490.173] -- 0:00:32
432500 -- (-490.615) (-488.081) (-489.570) [-488.494] * (-489.616) (-489.896) (-489.502) [-488.024] -- 0:00:34
433000 -- (-490.799) [-491.856] (-489.897) (-488.375) * (-488.374) (-488.005) [-491.494] (-493.635) -- 0:00:34
433500 -- [-488.687] (-490.200) (-489.458) (-489.767) * (-491.302) [-489.955] (-490.903) (-494.528) -- 0:00:33
434000 -- (-491.705) (-488.735) [-490.595] (-490.609) * [-493.547] (-488.807) (-497.342) (-491.096) -- 0:00:33
434500 -- (-491.608) (-490.066) [-488.275] (-489.684) * (-488.462) (-490.633) [-488.117] (-491.348) -- 0:00:33
435000 -- (-490.912) [-490.133] (-489.044) (-490.635) * (-490.792) (-490.101) [-487.784] (-488.905) -- 0:00:33
Average standard deviation of split frequencies: 0.009731
435500 -- [-492.372] (-491.528) (-489.731) (-490.511) * (-487.994) [-488.799] (-488.027) (-488.544) -- 0:00:33
436000 -- (-488.725) (-491.788) (-488.792) [-489.282] * (-488.551) (-488.275) (-489.112) [-492.512] -- 0:00:33
436500 -- (-489.546) (-489.341) [-491.341] (-492.212) * [-488.728] (-488.809) (-491.214) (-489.567) -- 0:00:33
437000 -- (-488.792) [-489.924] (-488.291) (-491.170) * (-490.197) (-489.840) [-489.412] (-488.099) -- 0:00:33
437500 -- (-490.621) (-488.872) (-490.145) [-489.876] * (-488.506) (-490.741) [-490.101] (-490.731) -- 0:00:33
438000 -- (-491.609) [-489.183] (-488.495) (-488.708) * [-491.660] (-493.295) (-490.735) (-491.902) -- 0:00:33
438500 -- (-489.835) (-490.473) (-491.307) [-491.010] * (-493.435) (-490.342) (-487.694) [-488.123] -- 0:00:33
439000 -- [-489.299] (-490.419) (-489.114) (-489.186) * (-490.181) (-496.951) [-491.093] (-487.482) -- 0:00:33
439500 -- (-490.631) [-488.728] (-491.463) (-490.536) * [-492.168] (-492.697) (-492.132) (-488.339) -- 0:00:33
440000 -- [-487.493] (-490.442) (-489.678) (-490.173) * (-490.913) (-490.372) (-491.199) [-491.089] -- 0:00:33
Average standard deviation of split frequencies: 0.010029
440500 -- (-489.808) (-490.284) [-487.745] (-490.089) * (-487.615) [-491.348] (-488.482) (-488.531) -- 0:00:33
441000 -- (-490.364) [-487.853] (-488.979) (-488.836) * (-488.610) (-490.641) [-488.755] (-489.160) -- 0:00:32
441500 -- (-491.217) (-489.083) [-487.959] (-488.701) * [-489.485] (-488.606) (-489.212) (-489.683) -- 0:00:32
442000 -- (-491.376) [-489.764] (-489.209) (-489.284) * (-490.989) (-487.917) [-492.118] (-491.233) -- 0:00:32
442500 -- (-491.494) [-489.057] (-489.001) (-488.892) * (-491.328) (-487.509) [-492.038] (-492.059) -- 0:00:32
443000 -- (-492.873) (-491.284) [-488.217] (-489.503) * (-491.719) (-489.233) [-491.858] (-489.423) -- 0:00:32
443500 -- [-493.549] (-490.698) (-490.237) (-489.103) * (-494.264) [-490.004] (-493.182) (-492.822) -- 0:00:32
444000 -- (-495.754) (-490.680) (-488.457) [-488.501] * [-489.425] (-494.185) (-492.195) (-492.916) -- 0:00:32
444500 -- (-488.405) (-489.699) [-489.308] (-489.842) * (-490.685) (-489.776) [-489.423] (-488.730) -- 0:00:32
445000 -- (-490.055) [-489.540] (-491.507) (-489.793) * (-489.651) (-490.400) (-490.298) [-493.257] -- 0:00:32
Average standard deviation of split frequencies: 0.009843
445500 -- (-489.462) [-490.642] (-489.073) (-495.696) * [-490.829] (-487.915) (-488.877) (-495.199) -- 0:00:32
446000 -- (-489.511) (-487.646) (-490.879) [-489.441] * (-490.418) (-488.579) (-488.818) [-488.590] -- 0:00:32
446500 -- (-490.258) (-488.115) (-491.002) [-489.745] * (-488.453) [-490.139] (-488.980) (-488.465) -- 0:00:32
447000 -- (-489.170) [-490.009] (-490.045) (-489.954) * (-487.717) [-489.736] (-490.719) (-487.598) -- 0:00:32
447500 -- (-491.898) [-490.848] (-488.768) (-488.598) * [-488.455] (-489.072) (-489.460) (-489.546) -- 0:00:32
448000 -- (-490.383) (-491.028) [-489.027] (-490.862) * (-492.259) (-491.600) (-493.185) [-491.292] -- 0:00:32
448500 -- [-489.678] (-491.446) (-491.688) (-488.470) * (-490.129) (-493.510) [-489.170] (-493.286) -- 0:00:31
449000 -- [-489.568] (-489.638) (-488.964) (-487.977) * (-490.490) (-489.893) [-487.660] (-489.268) -- 0:00:31
449500 -- [-488.155] (-493.234) (-489.377) (-487.576) * (-490.501) [-489.156] (-488.254) (-490.958) -- 0:00:33
450000 -- (-490.187) [-495.533] (-489.273) (-490.223) * (-491.434) (-491.043) (-491.768) [-493.903] -- 0:00:33
Average standard deviation of split frequencies: 0.009741
450500 -- (-492.188) (-490.863) [-489.449] (-488.792) * (-488.356) [-490.498] (-491.812) (-489.733) -- 0:00:32
451000 -- (-493.720) [-488.358] (-490.546) (-489.289) * [-489.054] (-491.053) (-490.015) (-491.743) -- 0:00:32
451500 -- (-491.146) [-491.548] (-488.989) (-492.317) * (-488.371) (-488.011) [-489.888] (-490.163) -- 0:00:32
452000 -- [-489.147] (-487.532) (-489.892) (-490.701) * (-488.263) (-487.746) [-488.053] (-488.768) -- 0:00:32
452500 -- [-490.172] (-491.020) (-492.539) (-488.973) * (-488.667) (-491.331) (-488.497) [-488.182] -- 0:00:32
453000 -- (-490.049) (-488.263) [-489.788] (-491.815) * (-487.823) (-488.264) [-492.480] (-491.704) -- 0:00:32
453500 -- (-488.655) (-490.924) (-488.775) [-489.751] * (-490.009) [-488.923] (-492.149) (-488.100) -- 0:00:32
454000 -- (-489.664) (-489.558) [-489.709] (-488.908) * (-491.599) [-488.462] (-490.604) (-490.938) -- 0:00:32
454500 -- (-490.304) (-488.952) [-489.411] (-488.439) * (-491.530) (-489.759) [-490.489] (-490.542) -- 0:00:32
455000 -- [-488.517] (-491.315) (-493.059) (-487.879) * (-488.855) (-488.553) [-490.117] (-488.901) -- 0:00:32
Average standard deviation of split frequencies: 0.009821
455500 -- (-490.468) (-491.786) (-489.483) [-488.788] * [-488.067] (-489.125) (-488.236) (-489.579) -- 0:00:32
456000 -- (-491.130) (-489.699) (-489.272) [-488.800] * (-489.220) (-488.997) [-488.737] (-492.330) -- 0:00:32
456500 -- [-491.688] (-489.574) (-488.950) (-487.831) * (-488.628) (-493.037) [-491.650] (-491.999) -- 0:00:32
457000 -- [-488.346] (-489.718) (-489.010) (-490.186) * (-488.550) (-489.526) (-487.806) [-490.377] -- 0:00:32
457500 -- [-489.321] (-488.920) (-490.839) (-490.341) * [-490.874] (-491.154) (-488.576) (-494.400) -- 0:00:32
458000 -- (-488.456) [-489.047] (-489.104) (-490.414) * [-492.080] (-493.675) (-489.547) (-490.514) -- 0:00:31
458500 -- (-488.569) [-493.941] (-491.473) (-487.506) * (-493.838) [-490.310] (-487.803) (-489.156) -- 0:00:31
459000 -- (-489.430) (-491.371) (-492.281) [-489.556] * [-488.811] (-489.778) (-489.721) (-488.065) -- 0:00:31
459500 -- (-488.946) (-491.592) (-490.578) [-489.564] * (-488.072) [-488.712] (-492.108) (-489.485) -- 0:00:31
460000 -- [-488.270] (-493.236) (-491.369) (-489.961) * [-488.530] (-488.794) (-489.401) (-490.339) -- 0:00:31
Average standard deviation of split frequencies: 0.010297
460500 -- [-487.648] (-490.770) (-502.269) (-490.518) * (-492.293) (-489.306) (-492.265) [-489.204] -- 0:00:31
461000 -- (-488.777) (-489.448) [-488.723] (-490.471) * (-489.622) (-490.524) (-492.059) [-488.013] -- 0:00:31
461500 -- [-488.974] (-489.961) (-489.968) (-489.481) * (-489.707) (-488.667) [-491.446] (-489.762) -- 0:00:31
462000 -- (-492.685) (-490.689) [-489.813] (-492.945) * (-489.499) [-488.006] (-493.581) (-488.178) -- 0:00:31
462500 -- (-493.419) [-488.540] (-488.660) (-489.538) * (-489.697) [-489.997] (-488.342) (-489.690) -- 0:00:31
463000 -- [-490.252] (-491.010) (-488.893) (-492.203) * (-488.643) [-489.577] (-489.987) (-488.871) -- 0:00:31
463500 -- (-489.100) (-490.862) (-491.195) [-488.324] * (-489.595) [-489.942] (-488.973) (-488.252) -- 0:00:31
464000 -- (-489.888) [-489.366] (-489.784) (-489.723) * (-492.676) (-489.569) [-488.597] (-490.567) -- 0:00:31
464500 -- (-488.421) (-489.398) [-489.135] (-490.286) * (-489.329) [-491.499] (-491.922) (-493.260) -- 0:00:31
465000 -- (-487.339) (-488.766) [-494.008] (-490.679) * [-489.136] (-493.425) (-488.805) (-489.492) -- 0:00:31
Average standard deviation of split frequencies: 0.010432
465500 -- (-487.649) (-488.612) (-490.306) [-489.405] * (-490.369) (-490.979) (-493.863) [-489.770] -- 0:00:31
466000 -- (-488.806) [-488.811] (-490.633) (-488.725) * [-491.543] (-492.683) (-489.833) (-490.703) -- 0:00:32
466500 -- (-488.707) (-491.274) [-488.803] (-490.076) * [-490.578] (-489.180) (-488.478) (-489.396) -- 0:00:32
467000 -- (-487.724) (-490.742) [-497.775] (-489.274) * (-492.441) (-490.812) [-488.155] (-489.477) -- 0:00:31
467500 -- (-490.305) [-489.999] (-489.285) (-489.042) * (-489.952) (-490.237) (-490.888) [-488.970] -- 0:00:31
468000 -- [-487.763] (-492.480) (-490.930) (-487.835) * (-489.641) (-489.173) [-489.963] (-490.411) -- 0:00:31
468500 -- [-488.290] (-491.690) (-492.097) (-488.584) * [-491.600] (-488.052) (-489.022) (-492.603) -- 0:00:31
469000 -- (-488.669) (-490.718) [-493.550] (-488.498) * [-488.181] (-490.009) (-492.060) (-489.516) -- 0:00:31
469500 -- (-490.599) (-489.357) (-491.830) [-491.307] * (-488.867) (-493.031) [-489.516] (-487.962) -- 0:00:31
470000 -- (-493.362) (-493.265) (-488.121) [-489.126] * (-492.648) [-489.206] (-489.046) (-489.711) -- 0:00:31
Average standard deviation of split frequencies: 0.010329
470500 -- (-494.425) (-489.675) [-491.199] (-489.378) * (-491.442) (-490.106) [-487.352] (-491.501) -- 0:00:31
471000 -- (-489.464) (-489.769) [-491.360] (-490.512) * (-488.683) (-488.256) (-488.556) [-490.389] -- 0:00:31
471500 -- (-488.828) (-490.738) (-488.636) [-489.346] * (-494.439) (-488.250) (-487.887) [-489.800] -- 0:00:31
472000 -- (-490.669) [-489.313] (-490.765) (-489.248) * (-487.990) [-487.931] (-489.080) (-492.737) -- 0:00:31
472500 -- (-487.696) (-489.888) (-488.381) [-493.196] * (-488.162) (-496.015) (-489.614) [-493.540] -- 0:00:31
473000 -- (-489.895) (-488.562) (-490.300) [-489.217] * (-488.508) (-489.889) (-488.614) [-487.449] -- 0:00:31
473500 -- (-489.157) [-490.411] (-490.382) (-489.164) * [-489.061] (-489.594) (-488.355) (-492.801) -- 0:00:31
474000 -- (-489.893) (-489.840) [-488.990] (-490.400) * (-488.506) [-489.090] (-489.677) (-490.413) -- 0:00:31
474500 -- (-490.310) (-491.027) [-488.913] (-490.791) * [-488.597] (-489.403) (-489.578) (-490.108) -- 0:00:31
475000 -- (-489.435) [-487.881] (-490.879) (-489.748) * [-489.641] (-490.919) (-488.953) (-488.776) -- 0:00:30
Average standard deviation of split frequencies: 0.010399
475500 -- [-489.214] (-489.376) (-489.576) (-488.315) * (-497.193) [-490.934] (-491.637) (-489.373) -- 0:00:30
476000 -- (-488.304) (-490.937) (-488.423) [-488.850] * (-494.781) (-491.137) (-491.988) [-488.988] -- 0:00:30
476500 -- (-488.512) (-490.557) (-487.918) [-488.627] * (-492.740) (-494.544) [-488.843] (-489.826) -- 0:00:30
477000 -- [-489.651] (-494.309) (-489.227) (-489.844) * (-488.384) (-495.722) [-489.018] (-494.407) -- 0:00:30
477500 -- (-491.079) (-489.648) (-492.258) [-490.198] * [-489.825] (-495.544) (-492.660) (-490.902) -- 0:00:30
478000 -- [-490.498] (-490.150) (-491.061) (-489.719) * (-492.278) (-489.595) [-490.107] (-489.766) -- 0:00:30
478500 -- (-491.386) (-490.051) [-489.173] (-490.333) * [-489.676] (-493.303) (-489.206) (-489.868) -- 0:00:30
479000 -- (-488.675) [-488.460] (-490.556) (-488.544) * (-489.067) (-489.274) [-488.525] (-490.476) -- 0:00:30
479500 -- (-487.348) [-488.283] (-490.946) (-491.935) * (-493.603) (-488.415) (-487.702) [-489.515] -- 0:00:30
480000 -- [-489.256] (-491.434) (-489.909) (-488.620) * (-488.158) [-488.292] (-491.511) (-489.966) -- 0:00:30
Average standard deviation of split frequencies: 0.010420
480500 -- (-488.657) [-490.728] (-489.092) (-492.618) * (-490.228) (-489.479) [-491.288] (-490.169) -- 0:00:30
481000 -- (-490.137) [-488.928] (-488.957) (-488.045) * (-487.496) (-489.193) (-491.991) [-491.375] -- 0:00:30
481500 -- (-490.326) (-489.372) (-489.300) [-487.870] * (-492.274) (-489.599) [-490.512] (-487.949) -- 0:00:30
482000 -- [-489.618] (-489.227) (-491.442) (-488.055) * [-490.755] (-490.227) (-488.348) (-496.886) -- 0:00:30
482500 -- [-488.328] (-487.938) (-489.099) (-489.894) * (-491.972) (-493.618) (-489.395) [-489.450] -- 0:00:30
483000 -- (-489.193) (-490.443) [-490.125] (-489.394) * (-492.898) [-492.269] (-487.674) (-488.133) -- 0:00:31
483500 -- [-490.998] (-487.607) (-489.417) (-488.168) * (-492.549) (-498.246) [-489.185] (-490.376) -- 0:00:30
484000 -- [-492.315] (-489.040) (-489.884) (-492.211) * (-488.503) (-489.919) [-488.989] (-490.116) -- 0:00:30
484500 -- (-488.237) [-489.737] (-488.663) (-490.173) * (-489.938) (-490.236) (-490.969) [-491.334] -- 0:00:30
485000 -- [-488.696] (-489.067) (-490.181) (-488.624) * (-491.200) (-492.054) [-488.644] (-491.386) -- 0:00:30
Average standard deviation of split frequencies: 0.010185
485500 -- (-488.286) (-489.307) [-488.218] (-488.638) * (-499.734) (-488.830) (-491.655) [-488.620] -- 0:00:30
486000 -- (-489.848) [-488.810] (-490.619) (-488.848) * (-489.579) [-489.931] (-490.927) (-490.342) -- 0:00:30
486500 -- (-492.204) (-489.961) (-490.589) [-489.255] * [-490.687] (-491.247) (-489.180) (-490.180) -- 0:00:30
487000 -- (-492.905) (-489.133) (-490.750) [-491.862] * (-488.272) (-489.121) [-489.547] (-490.390) -- 0:00:30
487500 -- [-491.764] (-491.299) (-490.533) (-493.205) * [-490.222] (-490.102) (-489.739) (-494.422) -- 0:00:30
488000 -- (-491.247) [-488.006] (-493.507) (-494.457) * (-489.956) [-488.946] (-488.315) (-495.088) -- 0:00:30
488500 -- [-491.825] (-491.969) (-489.337) (-491.550) * (-491.201) (-490.838) (-487.325) [-489.030] -- 0:00:30
489000 -- (-492.133) (-491.563) (-490.062) [-488.457] * [-489.853] (-488.869) (-488.751) (-490.930) -- 0:00:30
489500 -- (-489.235) [-491.362] (-492.224) (-496.737) * [-488.144] (-488.702) (-489.417) (-489.889) -- 0:00:30
490000 -- (-488.568) (-488.585) (-496.785) [-489.819] * (-490.256) [-489.399] (-491.788) (-491.203) -- 0:00:30
Average standard deviation of split frequencies: 0.009427
490500 -- (-490.407) (-489.649) (-493.065) [-490.527] * (-491.083) [-490.433] (-492.797) (-487.760) -- 0:00:30
491000 -- (-489.445) (-488.270) [-489.420] (-488.392) * (-488.644) (-497.986) (-488.543) [-487.673] -- 0:00:30
491500 -- [-489.050] (-489.088) (-491.077) (-488.842) * (-489.491) [-487.834] (-490.714) (-488.135) -- 0:00:30
492000 -- (-491.425) (-488.446) [-488.257] (-490.373) * (-489.896) (-487.796) (-487.988) [-488.558] -- 0:00:29
492500 -- (-492.875) (-490.711) [-487.850] (-488.777) * (-491.529) (-490.071) [-488.859] (-487.690) -- 0:00:29
493000 -- (-492.483) [-487.671] (-489.331) (-490.305) * (-488.213) (-490.425) [-492.166] (-488.641) -- 0:00:29
493500 -- (-488.787) (-489.394) [-488.921] (-491.108) * (-493.175) (-489.410) [-488.547] (-490.440) -- 0:00:29
494000 -- [-489.926] (-488.793) (-491.671) (-491.381) * (-489.101) (-490.328) [-488.934] (-490.291) -- 0:00:29
494500 -- (-491.110) (-488.800) [-489.453] (-488.734) * (-490.690) [-491.545] (-488.772) (-488.588) -- 0:00:29
495000 -- [-487.838] (-488.415) (-489.497) (-489.413) * [-489.945] (-491.303) (-487.758) (-490.129) -- 0:00:29
Average standard deviation of split frequencies: 0.009124
495500 -- [-492.460] (-488.396) (-489.691) (-491.281) * [-490.534] (-487.847) (-489.438) (-487.801) -- 0:00:29
496000 -- [-491.077] (-489.465) (-487.961) (-491.702) * (-491.242) (-488.751) (-491.321) [-491.276] -- 0:00:29
496500 -- (-496.399) (-490.982) [-488.961] (-488.663) * [-488.814] (-488.738) (-489.522) (-488.486) -- 0:00:29
497000 -- (-488.806) (-488.820) [-488.091] (-492.046) * (-491.606) (-490.332) (-490.024) [-490.083] -- 0:00:29
497500 -- (-488.944) (-488.618) [-487.993] (-490.229) * [-489.743] (-488.285) (-489.500) (-488.850) -- 0:00:29
498000 -- (-489.928) (-490.701) [-489.132] (-491.069) * (-489.312) [-487.657] (-488.449) (-490.506) -- 0:00:29
498500 -- (-495.386) [-490.248] (-488.202) (-493.016) * [-491.540] (-488.139) (-492.706) (-489.376) -- 0:00:29
499000 -- (-503.500) (-488.787) (-489.426) [-489.214] * (-490.208) [-488.850] (-488.241) (-494.800) -- 0:00:29
499500 -- (-492.843) (-488.810) [-489.994] (-488.358) * (-488.483) [-489.076] (-487.732) (-489.844) -- 0:00:30
500000 -- [-491.237] (-489.378) (-490.958) (-487.782) * (-491.463) (-493.992) [-489.254] (-487.761) -- 0:00:30
Average standard deviation of split frequencies: 0.009004
500500 -- (-494.147) (-489.017) (-492.791) [-489.680] * [-490.890] (-493.651) (-491.270) (-488.415) -- 0:00:29
501000 -- (-489.789) [-488.020] (-488.695) (-491.244) * (-488.265) [-489.480] (-488.277) (-489.290) -- 0:00:29
501500 -- (-492.725) [-489.751] (-489.567) (-488.714) * (-492.300) [-489.588] (-488.108) (-492.045) -- 0:00:29
502000 -- (-490.622) (-491.177) [-489.044] (-493.927) * (-489.518) [-487.510] (-488.172) (-487.735) -- 0:00:29
502500 -- (-493.790) [-491.488] (-488.196) (-488.866) * (-489.733) (-488.659) [-488.357] (-492.094) -- 0:00:29
503000 -- [-493.550] (-493.216) (-489.816) (-491.242) * (-489.790) [-487.390] (-489.336) (-489.962) -- 0:00:29
503500 -- (-493.480) (-489.874) (-490.353) [-489.468] * (-492.287) [-489.074] (-490.617) (-489.676) -- 0:00:29
504000 -- (-489.196) [-492.877] (-488.252) (-489.300) * (-487.699) (-489.143) (-491.113) [-489.073] -- 0:00:29
504500 -- [-488.547] (-489.203) (-488.536) (-490.309) * (-488.470) [-490.442] (-489.840) (-495.254) -- 0:00:29
505000 -- [-488.070] (-488.778) (-491.291) (-491.053) * (-488.433) (-489.194) [-488.857] (-489.584) -- 0:00:29
Average standard deviation of split frequencies: 0.009025
505500 -- (-488.416) (-488.864) [-492.180] (-491.183) * [-488.374] (-488.470) (-489.273) (-492.259) -- 0:00:29
506000 -- (-489.570) [-489.676] (-488.545) (-489.474) * (-488.551) (-490.342) [-488.538] (-492.709) -- 0:00:29
506500 -- (-487.896) (-489.773) (-492.274) [-487.820] * (-490.103) (-488.217) (-488.354) [-491.552] -- 0:00:29
507000 -- (-488.548) (-491.869) (-493.216) [-489.274] * (-490.205) [-491.055] (-487.928) (-489.955) -- 0:00:29
507500 -- (-488.873) (-494.929) (-489.877) [-491.327] * (-489.210) (-491.841) (-487.901) [-491.889] -- 0:00:29
508000 -- (-492.047) (-489.089) (-488.504) [-492.049] * (-487.920) (-493.810) [-489.920] (-490.444) -- 0:00:29
508500 -- (-489.121) (-493.914) [-488.875] (-489.084) * (-488.543) (-491.369) [-491.485] (-488.861) -- 0:00:28
509000 -- (-488.119) (-491.337) (-489.310) [-489.159] * [-487.350] (-490.309) (-495.957) (-490.806) -- 0:00:28
509500 -- [-490.228] (-490.524) (-489.057) (-487.865) * [-491.906] (-488.130) (-488.235) (-490.476) -- 0:00:28
510000 -- (-493.176) (-491.668) (-491.940) [-488.270] * (-492.320) [-488.240] (-488.179) (-491.983) -- 0:00:28
Average standard deviation of split frequencies: 0.009600
510500 -- (-489.428) [-491.410] (-489.234) (-488.106) * [-488.953] (-488.241) (-491.490) (-491.463) -- 0:00:28
511000 -- [-489.149] (-489.017) (-489.699) (-493.091) * (-490.722) (-489.142) (-490.231) [-488.243] -- 0:00:28
511500 -- (-488.798) [-487.971] (-488.040) (-491.837) * (-487.631) (-489.599) [-487.941] (-490.473) -- 0:00:28
512000 -- (-488.882) (-489.480) (-490.000) [-490.322] * (-490.390) [-489.066] (-489.389) (-488.508) -- 0:00:28
512500 -- (-487.644) [-490.730] (-489.068) (-489.964) * (-490.623) [-490.538] (-492.903) (-490.044) -- 0:00:28
513000 -- (-489.642) (-488.433) (-489.906) [-489.177] * [-489.370] (-489.036) (-489.069) (-492.166) -- 0:00:28
513500 -- (-488.228) (-490.380) [-488.890] (-487.750) * (-488.467) [-489.766] (-487.873) (-490.230) -- 0:00:28
514000 -- (-487.900) (-490.576) [-488.132] (-487.928) * (-498.508) [-489.155] (-491.028) (-490.532) -- 0:00:28
514500 -- (-488.212) (-491.612) [-491.497] (-488.158) * (-490.409) [-488.296] (-490.578) (-491.312) -- 0:00:28
515000 -- (-489.586) (-489.954) (-491.480) [-490.123] * (-488.475) (-492.112) [-490.826] (-490.300) -- 0:00:28
Average standard deviation of split frequencies: 0.010354
515500 -- (-489.807) (-488.422) (-489.069) [-487.986] * [-490.021] (-490.033) (-490.251) (-490.835) -- 0:00:28
516000 -- (-490.290) (-489.523) [-488.351] (-488.185) * (-489.572) (-489.069) (-490.597) [-491.098] -- 0:00:28
516500 -- [-489.442] (-488.884) (-489.326) (-488.563) * (-492.623) [-487.824] (-488.544) (-491.166) -- 0:00:29
517000 -- (-488.341) (-489.806) [-491.007] (-489.316) * (-490.056) (-487.673) [-488.360] (-491.641) -- 0:00:28
517500 -- (-489.838) [-494.072] (-489.808) (-488.276) * [-489.147] (-489.002) (-488.481) (-489.382) -- 0:00:28
518000 -- [-489.534] (-491.067) (-489.330) (-490.625) * (-490.164) (-488.939) [-488.977] (-491.040) -- 0:00:28
518500 -- [-489.216] (-489.937) (-490.155) (-489.867) * (-490.756) (-489.834) [-487.560] (-490.474) -- 0:00:28
519000 -- (-491.545) (-490.461) [-489.337] (-488.839) * (-488.906) [-489.775] (-494.274) (-489.634) -- 0:00:28
519500 -- (-489.732) (-489.926) [-491.076] (-490.021) * (-491.186) (-488.969) (-489.727) [-487.741] -- 0:00:28
520000 -- (-491.938) (-490.942) (-489.032) [-489.492] * (-489.347) (-488.866) [-488.765] (-488.451) -- 0:00:28
Average standard deviation of split frequencies: 0.009839
520500 -- [-490.812] (-487.848) (-490.955) (-491.713) * [-491.895] (-500.353) (-492.093) (-488.006) -- 0:00:28
521000 -- (-487.838) (-488.244) [-488.939] (-488.499) * (-489.112) [-495.207] (-494.445) (-488.700) -- 0:00:28
521500 -- (-489.172) [-489.698] (-488.249) (-489.810) * (-488.082) (-494.505) (-488.947) [-489.808] -- 0:00:28
522000 -- (-488.991) (-488.688) (-488.405) [-488.885] * (-490.228) [-489.233] (-489.035) (-489.785) -- 0:00:28
522500 -- (-491.407) [-488.762] (-489.454) (-487.423) * [-491.334] (-488.371) (-494.759) (-498.585) -- 0:00:28
523000 -- [-488.315] (-490.579) (-488.032) (-487.409) * [-493.537] (-491.170) (-494.202) (-495.224) -- 0:00:28
523500 -- [-489.400] (-492.293) (-489.526) (-488.201) * (-487.875) (-490.643) [-489.956] (-489.262) -- 0:00:28
524000 -- [-488.252] (-490.685) (-488.078) (-490.626) * (-496.207) (-487.933) [-488.916] (-488.694) -- 0:00:28
524500 -- [-488.856] (-489.392) (-489.763) (-488.328) * (-491.826) (-488.443) [-490.837] (-490.517) -- 0:00:28
525000 -- (-490.163) (-489.592) (-488.261) [-489.885] * (-493.544) (-489.194) [-488.789] (-493.673) -- 0:00:28
Average standard deviation of split frequencies: 0.009354
525500 -- [-487.588] (-490.418) (-489.239) (-492.191) * (-492.091) [-492.329] (-488.292) (-489.384) -- 0:00:27
526000 -- (-489.970) (-487.984) [-489.011] (-490.239) * (-489.797) (-493.099) [-488.435] (-488.746) -- 0:00:27
526500 -- (-490.397) [-488.360] (-488.435) (-489.913) * [-488.558] (-490.868) (-488.807) (-489.419) -- 0:00:27
527000 -- [-493.518] (-488.900) (-489.759) (-488.846) * (-488.375) [-488.510] (-489.622) (-489.008) -- 0:00:27
527500 -- (-489.147) (-488.312) (-488.116) [-491.429] * (-494.703) [-487.431] (-492.515) (-488.601) -- 0:00:27
528000 -- [-490.889] (-490.587) (-490.755) (-493.842) * (-493.314) (-488.336) (-491.852) [-490.439] -- 0:00:27
528500 -- (-489.702) (-493.906) (-491.040) [-490.586] * (-495.270) (-490.499) [-492.550] (-488.481) -- 0:00:27
529000 -- (-488.294) (-489.767) (-487.537) [-490.110] * [-491.209] (-489.300) (-492.936) (-492.736) -- 0:00:27
529500 -- (-493.831) (-490.031) (-490.331) [-492.474] * [-491.650] (-491.125) (-490.737) (-490.248) -- 0:00:27
530000 -- (-488.070) (-493.573) (-489.371) [-488.673] * [-488.930] (-488.252) (-488.083) (-490.784) -- 0:00:27
Average standard deviation of split frequencies: 0.009549
530500 -- (-489.380) (-493.569) [-488.221] (-490.026) * [-488.808] (-491.100) (-493.056) (-489.633) -- 0:00:27
531000 -- (-490.384) (-489.647) (-494.604) [-489.793] * (-489.236) (-491.332) [-488.508] (-489.849) -- 0:00:27
531500 -- (-490.222) (-489.194) [-489.478] (-490.513) * (-491.750) [-490.873] (-489.710) (-489.111) -- 0:00:27
532000 -- [-490.866] (-491.766) (-490.837) (-488.906) * (-488.965) (-495.404) [-489.623] (-490.655) -- 0:00:27
532500 -- (-489.167) [-489.282] (-491.191) (-489.647) * [-489.630] (-493.772) (-489.201) (-492.316) -- 0:00:27
533000 -- (-489.560) (-490.755) (-488.378) [-488.665] * (-495.199) [-494.117] (-489.949) (-489.859) -- 0:00:27
533500 -- (-489.517) (-490.942) (-489.645) [-490.124] * (-493.042) (-492.407) [-489.352] (-490.911) -- 0:00:27
534000 -- (-490.430) (-489.034) [-489.428] (-488.983) * (-488.794) [-488.863] (-492.454) (-493.370) -- 0:00:27
534500 -- (-489.862) (-489.804) [-488.769] (-488.096) * [-488.593] (-489.061) (-488.093) (-489.291) -- 0:00:27
535000 -- (-488.452) (-488.045) [-489.671] (-489.097) * [-489.782] (-492.908) (-490.735) (-490.213) -- 0:00:27
Average standard deviation of split frequencies: 0.009147
535500 -- (-491.998) [-488.289] (-493.595) (-490.636) * (-492.050) [-487.476] (-488.146) (-489.629) -- 0:00:27
536000 -- (-490.647) [-489.772] (-492.634) (-489.205) * (-489.646) [-488.352] (-488.034) (-489.194) -- 0:00:27
536500 -- [-489.024] (-489.373) (-487.914) (-489.292) * (-488.363) [-488.564] (-490.334) (-489.444) -- 0:00:27
537000 -- (-491.263) (-495.539) [-488.701] (-492.690) * (-488.766) (-489.805) (-488.590) [-492.057] -- 0:00:27
537500 -- (-491.071) (-492.184) (-491.384) [-488.409] * (-495.060) (-492.258) [-492.763] (-491.118) -- 0:00:27
538000 -- (-489.812) (-490.217) (-493.384) [-491.714] * [-492.351] (-489.382) (-492.825) (-493.128) -- 0:00:27
538500 -- (-489.758) (-492.238) (-490.155) [-488.214] * (-489.922) (-491.441) [-490.617] (-488.661) -- 0:00:27
539000 -- [-490.746] (-491.711) (-489.757) (-487.860) * (-493.645) [-491.408] (-490.198) (-491.005) -- 0:00:27
539500 -- [-490.438] (-489.000) (-492.184) (-488.238) * (-489.709) [-490.583] (-489.691) (-493.205) -- 0:00:27
540000 -- (-489.320) [-489.554] (-491.829) (-493.751) * (-490.238) [-492.025] (-489.576) (-489.453) -- 0:00:27
Average standard deviation of split frequencies: 0.009010
540500 -- (-491.596) (-488.785) (-489.215) [-489.278] * [-493.730] (-490.190) (-489.352) (-490.341) -- 0:00:27
541000 -- (-491.242) [-490.622] (-497.323) (-487.942) * [-488.328] (-491.233) (-489.968) (-489.950) -- 0:00:27
541500 -- (-488.802) [-490.081] (-498.828) (-489.138) * [-492.308] (-488.236) (-487.737) (-490.373) -- 0:00:27
542000 -- (-490.882) (-490.150) [-493.888] (-489.931) * (-488.544) (-490.396) [-487.792] (-489.174) -- 0:00:27
542500 -- (-493.660) (-489.309) (-491.531) [-490.406] * (-489.272) [-490.159] (-488.925) (-488.995) -- 0:00:26
543000 -- (-493.062) (-488.261) (-492.501) [-488.190] * (-490.247) [-489.013] (-488.760) (-489.785) -- 0:00:26
543500 -- [-490.680] (-498.532) (-493.160) (-488.892) * (-489.824) (-489.312) [-489.457] (-492.243) -- 0:00:26
544000 -- [-490.773] (-490.141) (-487.800) (-490.091) * (-490.762) [-490.166] (-489.043) (-495.326) -- 0:00:26
544500 -- (-490.643) (-491.571) [-489.084] (-492.045) * (-493.281) (-488.979) [-488.583] (-489.665) -- 0:00:26
545000 -- (-492.069) (-487.960) (-491.570) [-487.925] * (-490.694) [-487.922] (-488.778) (-488.381) -- 0:00:26
Average standard deviation of split frequencies: 0.009267
545500 -- [-489.893] (-488.962) (-490.473) (-487.522) * (-491.887) (-490.069) (-493.202) [-492.959] -- 0:00:26
546000 -- (-488.526) [-488.964] (-488.454) (-488.267) * (-488.534) (-489.940) [-488.980] (-490.170) -- 0:00:26
546500 -- (-488.540) (-488.506) [-488.322] (-488.404) * (-490.375) [-490.465] (-488.446) (-489.463) -- 0:00:26
547000 -- (-490.865) (-490.261) [-488.840] (-488.002) * (-488.118) (-488.701) (-488.331) [-492.208] -- 0:00:26
547500 -- (-492.243) (-489.831) [-489.156] (-490.303) * [-488.199] (-489.944) (-491.072) (-490.851) -- 0:00:26
548000 -- (-490.096) [-488.451] (-489.620) (-489.364) * (-489.605) [-492.295] (-490.432) (-489.770) -- 0:00:26
548500 -- [-490.563] (-493.343) (-490.783) (-493.130) * (-488.221) [-490.127] (-492.490) (-489.208) -- 0:00:26
549000 -- (-490.263) (-494.134) [-493.724] (-488.498) * [-489.009] (-490.598) (-492.869) (-487.964) -- 0:00:26
549500 -- (-490.005) [-490.953] (-489.871) (-492.392) * (-491.216) [-490.758] (-489.481) (-490.726) -- 0:00:26
550000 -- (-488.656) (-494.821) [-491.289] (-494.099) * [-488.910] (-488.749) (-491.998) (-487.846) -- 0:00:26
Average standard deviation of split frequencies: 0.009577
550500 -- (-493.188) (-490.609) [-488.261] (-488.204) * [-490.033] (-490.212) (-488.303) (-490.744) -- 0:00:26
551000 -- (-488.197) (-493.215) (-489.418) [-488.088] * [-488.691] (-490.975) (-493.542) (-490.767) -- 0:00:26
551500 -- (-493.284) [-488.647] (-490.274) (-487.882) * [-488.707] (-490.471) (-488.857) (-491.660) -- 0:00:26
552000 -- (-489.676) [-488.474] (-490.530) (-491.238) * (-495.206) (-489.960) [-488.979] (-488.749) -- 0:00:26
552500 -- (-490.076) (-489.574) [-497.313] (-490.552) * (-489.699) (-488.060) (-489.050) [-489.014] -- 0:00:26
553000 -- (-491.044) (-489.938) (-490.900) [-488.724] * (-491.278) [-489.395] (-488.379) (-489.711) -- 0:00:26
553500 -- (-490.054) (-492.090) (-491.007) [-488.638] * (-488.845) (-488.416) [-488.448] (-487.699) -- 0:00:26
554000 -- (-490.943) [-489.899] (-489.837) (-488.120) * (-493.896) [-490.339] (-488.387) (-488.526) -- 0:00:26
554500 -- (-489.540) [-490.120] (-487.825) (-490.836) * (-491.831) (-494.067) (-491.745) [-488.059] -- 0:00:26
555000 -- (-491.516) (-490.232) (-487.872) [-489.996] * [-488.989] (-493.456) (-487.565) (-488.577) -- 0:00:26
Average standard deviation of split frequencies: 0.009856
555500 -- [-492.847] (-488.991) (-489.123) (-488.171) * [-489.247] (-487.634) (-488.754) (-491.678) -- 0:00:26
556000 -- [-492.463] (-488.942) (-488.228) (-488.905) * (-490.166) [-488.387] (-491.808) (-490.283) -- 0:00:26
556500 -- [-489.302] (-488.975) (-488.234) (-487.652) * (-489.105) (-488.160) [-489.343] (-489.334) -- 0:00:26
557000 -- (-489.533) [-488.228] (-489.519) (-489.733) * (-487.964) [-487.721] (-490.598) (-491.921) -- 0:00:26
557500 -- [-489.638] (-490.120) (-488.501) (-488.803) * (-489.128) (-491.151) [-490.788] (-490.485) -- 0:00:26
558000 -- (-492.973) [-487.858] (-488.560) (-488.271) * (-491.936) [-487.945] (-492.107) (-494.240) -- 0:00:26
558500 -- (-487.718) [-488.805] (-489.330) (-491.634) * (-488.662) [-487.427] (-493.382) (-490.165) -- 0:00:26
559000 -- (-487.779) (-488.560) [-492.687] (-491.126) * (-488.312) [-491.095] (-487.641) (-493.722) -- 0:00:26
559500 -- (-488.504) [-490.043] (-490.369) (-492.949) * (-488.726) (-490.449) [-490.735] (-490.103) -- 0:00:25
560000 -- (-488.460) [-490.399] (-488.809) (-494.605) * (-491.184) (-488.040) (-491.011) [-492.764] -- 0:00:25
Average standard deviation of split frequencies: 0.009921
560500 -- (-488.300) (-489.750) [-491.269] (-494.857) * (-490.089) (-494.326) [-490.553] (-492.122) -- 0:00:25
561000 -- (-490.826) [-491.587] (-489.328) (-490.982) * (-491.870) (-493.617) (-489.635) [-492.876] -- 0:00:25
561500 -- [-490.712] (-491.397) (-488.842) (-488.178) * (-488.820) (-488.852) (-492.811) [-489.481] -- 0:00:25
562000 -- (-494.954) (-491.476) (-488.808) [-491.678] * (-488.697) [-489.480] (-489.520) (-488.646) -- 0:00:25
562500 -- (-491.400) (-490.784) (-488.791) [-488.864] * (-489.541) (-488.462) [-488.043] (-488.747) -- 0:00:25
563000 -- (-488.690) (-489.746) [-490.013] (-493.235) * (-491.543) (-488.488) (-488.393) [-488.957] -- 0:00:25
563500 -- (-489.974) [-489.058] (-489.669) (-491.902) * (-496.668) [-487.813] (-489.072) (-493.366) -- 0:00:25
564000 -- [-489.722] (-490.010) (-489.840) (-491.750) * (-493.496) [-488.008] (-489.981) (-489.876) -- 0:00:25
564500 -- [-488.987] (-490.998) (-488.841) (-490.070) * (-490.568) [-489.062] (-496.839) (-489.442) -- 0:00:25
565000 -- (-489.909) (-489.852) (-491.561) [-490.265] * (-487.916) [-488.324] (-493.178) (-488.653) -- 0:00:25
Average standard deviation of split frequencies: 0.009526
565500 -- (-489.188) (-488.935) (-489.303) [-489.390] * [-488.531] (-488.112) (-490.045) (-494.868) -- 0:00:26
566000 -- (-490.149) [-488.419] (-489.938) (-490.551) * (-490.612) (-490.690) (-494.478) [-490.582] -- 0:00:26
566500 -- [-487.779] (-491.854) (-490.450) (-489.357) * (-488.859) [-491.251] (-488.913) (-488.783) -- 0:00:26
567000 -- [-489.249] (-492.308) (-489.408) (-491.190) * (-489.341) (-488.056) [-491.042] (-488.553) -- 0:00:25
567500 -- (-489.677) [-487.821] (-488.768) (-489.177) * (-489.859) (-489.073) (-490.321) [-489.091] -- 0:00:25
568000 -- (-490.170) (-490.305) (-488.904) [-489.341] * (-491.769) [-488.767] (-490.294) (-489.153) -- 0:00:25
568500 -- [-488.412] (-490.380) (-488.703) (-489.343) * [-492.065] (-488.906) (-489.643) (-493.186) -- 0:00:25
569000 -- [-488.438] (-490.952) (-488.864) (-488.231) * (-491.319) (-495.785) [-488.355] (-490.183) -- 0:00:25
569500 -- [-488.756] (-490.484) (-489.761) (-491.203) * (-489.230) (-490.733) [-488.319] (-488.477) -- 0:00:25
570000 -- (-488.873) (-489.896) [-488.838] (-493.950) * [-490.388] (-490.285) (-490.732) (-490.721) -- 0:00:25
Average standard deviation of split frequencies: 0.009345
570500 -- [-489.898] (-488.006) (-489.035) (-489.436) * [-492.041] (-490.200) (-490.904) (-489.581) -- 0:00:25
571000 -- [-490.389] (-488.547) (-491.317) (-491.957) * (-489.048) (-489.246) (-493.321) [-488.045] -- 0:00:25
571500 -- (-491.200) (-488.091) [-492.629] (-488.903) * (-491.236) (-488.728) (-491.532) [-490.468] -- 0:00:25
572000 -- [-488.174] (-489.941) (-489.259) (-490.313) * (-488.074) (-487.704) [-489.230] (-490.715) -- 0:00:25
572500 -- (-491.481) [-488.041] (-489.266) (-489.670) * [-489.656] (-492.966) (-492.127) (-489.015) -- 0:00:25
573000 -- (-491.306) (-489.954) [-489.978] (-490.319) * (-492.649) [-488.663] (-487.705) (-489.978) -- 0:00:25
573500 -- (-491.789) (-490.597) (-489.363) [-487.675] * (-492.500) (-488.970) [-489.546] (-488.144) -- 0:00:25
574000 -- (-493.966) [-487.744] (-488.845) (-492.271) * (-493.748) [-488.197] (-488.426) (-488.199) -- 0:00:25
574500 -- [-488.962] (-489.836) (-488.042) (-494.481) * (-492.567) [-490.517] (-490.507) (-488.338) -- 0:00:25
575000 -- (-492.504) (-489.767) (-488.236) [-487.555] * (-489.645) (-487.804) (-489.052) [-489.289] -- 0:00:25
Average standard deviation of split frequencies: 0.008675
575500 -- (-490.110) (-488.355) [-489.662] (-489.102) * [-491.425] (-488.459) (-495.474) (-491.258) -- 0:00:25
576000 -- (-489.006) (-488.384) (-488.726) [-489.065] * (-489.761) (-487.590) (-496.052) [-488.938] -- 0:00:25
576500 -- [-490.313] (-489.794) (-490.602) (-488.783) * (-490.573) [-489.718] (-493.695) (-488.306) -- 0:00:24
577000 -- (-488.468) (-488.750) (-491.813) [-490.733] * [-490.234] (-491.936) (-492.722) (-488.518) -- 0:00:24
577500 -- (-492.498) (-489.208) [-493.486] (-490.510) * (-492.803) (-489.203) [-487.768] (-488.421) -- 0:00:24
578000 -- [-490.633] (-488.341) (-489.210) (-487.835) * (-494.560) (-491.812) (-487.939) [-490.083] -- 0:00:24
578500 -- [-487.712] (-490.034) (-488.942) (-488.523) * (-491.067) (-492.271) [-488.131] (-489.544) -- 0:00:24
579000 -- (-488.839) (-489.802) [-489.274] (-488.657) * [-487.977] (-491.544) (-490.048) (-490.215) -- 0:00:24
579500 -- (-487.807) [-488.964] (-490.598) (-492.163) * [-489.082] (-490.351) (-489.145) (-488.512) -- 0:00:24
580000 -- (-487.764) [-491.613] (-495.020) (-490.185) * (-496.899) [-488.887] (-488.212) (-493.322) -- 0:00:24
Average standard deviation of split frequencies: 0.008829
580500 -- [-488.331] (-488.810) (-489.523) (-491.892) * (-490.269) (-493.061) [-489.910] (-491.779) -- 0:00:24
581000 -- (-488.124) (-495.053) [-489.573] (-489.210) * (-488.940) (-488.052) (-488.671) [-490.400] -- 0:00:24
581500 -- [-489.504] (-495.590) (-488.511) (-489.116) * [-489.297] (-489.150) (-491.931) (-488.185) -- 0:00:25
582000 -- (-489.597) (-490.425) [-493.119] (-491.828) * (-489.802) (-495.521) [-488.497] (-491.638) -- 0:00:25
582500 -- [-490.577] (-490.120) (-489.257) (-490.537) * [-501.556] (-490.430) (-489.922) (-490.497) -- 0:00:25
583000 -- (-488.452) [-488.890] (-487.939) (-487.959) * [-490.151] (-490.393) (-489.321) (-493.045) -- 0:00:25
583500 -- (-488.381) [-489.433] (-490.483) (-489.277) * (-489.989) (-487.685) [-490.096] (-496.238) -- 0:00:24
584000 -- (-488.159) (-487.677) (-492.360) [-487.425] * (-488.228) [-488.253] (-488.589) (-487.833) -- 0:00:24
584500 -- [-489.967] (-488.063) (-492.191) (-488.879) * [-490.532] (-489.490) (-489.630) (-489.348) -- 0:00:24
585000 -- (-489.403) [-493.212] (-490.191) (-490.888) * [-489.723] (-488.439) (-494.384) (-489.934) -- 0:00:24
Average standard deviation of split frequencies: 0.008497
585500 -- (-489.356) (-489.485) (-498.502) [-491.158] * (-487.857) (-489.543) (-493.524) [-489.371] -- 0:00:24
586000 -- (-489.156) (-490.844) (-501.340) [-489.761] * (-490.501) (-489.268) (-489.436) [-488.774] -- 0:00:24
586500 -- (-491.902) (-489.291) [-491.055] (-490.346) * (-488.446) (-488.778) (-488.617) [-490.708] -- 0:00:24
587000 -- [-489.891] (-489.851) (-489.843) (-488.602) * (-488.557) (-488.224) [-489.837] (-489.307) -- 0:00:24
587500 -- [-488.128] (-488.523) (-489.810) (-488.898) * (-489.063) (-490.069) [-487.385] (-487.856) -- 0:00:24
588000 -- (-489.521) [-488.085] (-488.531) (-491.355) * [-489.545] (-490.531) (-487.559) (-490.893) -- 0:00:24
588500 -- [-487.971] (-488.855) (-488.687) (-491.146) * (-488.518) (-490.664) [-492.354] (-493.311) -- 0:00:24
589000 -- (-488.851) (-490.083) [-488.299] (-490.075) * (-488.829) (-489.378) [-488.890] (-488.542) -- 0:00:24
589500 -- [-488.285] (-487.976) (-488.650) (-489.210) * (-489.536) [-488.850] (-490.443) (-488.385) -- 0:00:24
590000 -- [-488.468] (-492.771) (-488.273) (-491.924) * (-490.951) (-488.110) (-489.987) [-490.619] -- 0:00:24
Average standard deviation of split frequencies: 0.008920
590500 -- (-489.697) [-488.872] (-491.991) (-492.824) * (-496.634) (-492.001) [-490.290] (-489.450) -- 0:00:24
591000 -- (-491.313) (-487.720) (-493.946) [-489.112] * [-492.298] (-489.118) (-488.352) (-491.096) -- 0:00:24
591500 -- [-489.331] (-488.444) (-488.287) (-489.289) * (-492.722) (-487.864) (-496.947) [-488.448] -- 0:00:24
592000 -- (-487.705) [-487.881] (-489.418) (-489.628) * (-491.355) [-489.335] (-488.479) (-491.072) -- 0:00:24
592500 -- (-488.102) [-488.159] (-490.010) (-489.825) * (-492.287) (-488.713) [-489.387] (-490.198) -- 0:00:24
593000 -- (-490.322) (-487.907) (-488.474) [-489.846] * (-489.266) (-491.096) (-489.493) [-490.169] -- 0:00:24
593500 -- (-489.360) (-490.127) (-491.653) [-489.959] * (-491.211) (-491.178) [-491.130] (-488.902) -- 0:00:23
594000 -- (-488.305) [-489.718] (-493.141) (-492.003) * (-489.636) [-491.176] (-493.570) (-490.482) -- 0:00:23
594500 -- (-489.227) [-490.920] (-490.773) (-491.033) * (-488.707) (-488.058) [-489.592] (-493.382) -- 0:00:23
595000 -- (-494.312) (-488.230) [-487.744] (-491.201) * [-488.571] (-492.422) (-493.961) (-488.602) -- 0:00:23
Average standard deviation of split frequencies: 0.009073
595500 -- (-491.653) (-489.282) (-489.078) [-493.801] * [-488.648] (-489.221) (-490.488) (-490.045) -- 0:00:23
596000 -- (-489.716) [-490.369] (-491.382) (-488.573) * (-488.963) (-489.498) (-491.562) [-488.766] -- 0:00:23
596500 -- (-492.241) [-489.803] (-487.602) (-489.606) * (-493.710) (-488.436) (-488.905) [-489.329] -- 0:00:23
597000 -- (-488.650) (-489.532) [-488.889] (-490.039) * [-490.626] (-491.749) (-491.650) (-489.063) -- 0:00:23
597500 -- (-491.215) [-489.886] (-489.986) (-488.657) * [-491.699] (-490.853) (-493.635) (-491.206) -- 0:00:23
598000 -- (-491.342) (-488.320) [-489.595] (-488.191) * [-489.724] (-490.846) (-488.824) (-488.728) -- 0:00:23
598500 -- [-490.738] (-488.100) (-490.168) (-491.681) * (-489.410) [-493.690] (-490.694) (-487.899) -- 0:00:24
599000 -- (-488.602) (-489.349) [-487.686] (-488.447) * (-488.229) (-489.510) [-490.421] (-488.083) -- 0:00:24
599500 -- [-488.922] (-490.922) (-488.431) (-491.952) * [-491.582] (-488.546) (-492.742) (-489.360) -- 0:00:24
600000 -- (-489.403) [-488.533] (-493.819) (-488.361) * (-493.980) [-489.013] (-487.598) (-489.043) -- 0:00:24
Average standard deviation of split frequencies: 0.009464
600500 -- [-488.997] (-492.137) (-488.197) (-489.560) * (-490.373) (-492.118) [-490.891] (-494.411) -- 0:00:23
601000 -- (-492.911) (-491.824) [-488.579] (-490.690) * (-491.880) (-488.514) [-488.454] (-492.927) -- 0:00:23
601500 -- (-493.966) [-489.753] (-489.164) (-490.967) * [-491.496] (-489.049) (-488.826) (-489.675) -- 0:00:23
602000 -- (-490.609) [-490.622] (-489.217) (-489.137) * (-488.020) (-488.330) [-489.065] (-489.555) -- 0:00:23
602500 -- (-493.490) (-488.272) [-488.095] (-489.940) * [-488.173] (-492.276) (-488.752) (-491.970) -- 0:00:23
603000 -- (-489.952) (-492.143) [-491.322] (-489.257) * (-489.331) (-489.599) [-489.158] (-493.265) -- 0:00:23
603500 -- (-497.578) [-490.149] (-488.232) (-488.659) * (-491.492) (-492.091) [-491.352] (-494.138) -- 0:00:23
604000 -- (-491.106) (-490.965) (-488.481) [-488.867] * (-488.505) (-492.360) [-491.789] (-491.119) -- 0:00:23
604500 -- (-488.298) (-491.748) (-487.661) [-489.122] * (-488.437) [-488.481] (-493.190) (-488.161) -- 0:00:23
605000 -- (-489.055) (-491.590) [-491.134] (-488.267) * (-488.628) (-489.517) [-490.106] (-490.275) -- 0:00:23
Average standard deviation of split frequencies: 0.009197
605500 -- [-491.010] (-488.342) (-488.047) (-488.364) * (-491.608) (-489.020) [-490.813] (-492.453) -- 0:00:23
606000 -- (-487.793) (-491.804) (-489.782) [-488.541] * (-487.738) (-489.245) [-489.894] (-488.366) -- 0:00:23
606500 -- (-488.629) (-491.093) [-488.810] (-491.753) * (-489.540) (-488.702) [-488.796] (-488.295) -- 0:00:23
607000 -- [-489.255] (-488.470) (-488.186) (-489.267) * [-489.829] (-488.227) (-488.801) (-487.829) -- 0:00:23
607500 -- [-489.702] (-487.991) (-492.080) (-492.730) * [-489.793] (-488.327) (-488.806) (-488.512) -- 0:00:23
608000 -- [-491.662] (-491.426) (-492.470) (-495.133) * [-488.420] (-488.551) (-487.830) (-493.032) -- 0:00:23
608500 -- (-490.889) [-493.066] (-489.799) (-490.685) * [-491.393] (-491.404) (-490.155) (-489.455) -- 0:00:23
609000 -- [-488.680] (-491.325) (-488.510) (-488.902) * [-490.558] (-492.311) (-491.942) (-494.513) -- 0:00:23
609500 -- (-490.070) [-491.935] (-489.048) (-488.270) * (-493.470) [-493.188] (-490.232) (-492.915) -- 0:00:23
610000 -- (-492.284) (-492.587) [-488.738] (-487.528) * (-490.633) [-489.409] (-491.861) (-489.678) -- 0:00:23
Average standard deviation of split frequencies: 0.009400
610500 -- (-488.977) (-488.786) [-489.710] (-492.352) * (-488.542) (-489.026) (-490.700) [-489.825] -- 0:00:22
611000 -- (-491.656) [-488.616] (-495.160) (-490.177) * (-488.901) (-489.022) (-489.789) [-490.955] -- 0:00:22
611500 -- (-490.393) (-489.731) [-489.841] (-488.723) * (-487.703) (-489.182) (-493.675) [-492.623] -- 0:00:22
612000 -- (-489.607) [-492.417] (-494.833) (-492.063) * [-488.787] (-490.067) (-491.321) (-490.565) -- 0:00:22
612500 -- (-488.664) (-488.133) (-488.824) [-490.135] * (-490.919) (-491.591) (-490.302) [-488.923] -- 0:00:22
613000 -- [-489.075] (-491.093) (-489.304) (-490.378) * (-491.255) (-492.028) (-489.332) [-489.626] -- 0:00:22
613500 -- (-490.213) (-492.260) (-487.942) [-488.989] * (-491.222) (-488.388) [-490.243] (-489.923) -- 0:00:22
614000 -- (-488.618) (-489.006) (-489.697) [-488.164] * [-489.576] (-492.389) (-490.828) (-492.593) -- 0:00:22
614500 -- (-488.904) (-489.267) [-490.065] (-489.909) * (-491.127) (-488.987) [-489.822] (-489.060) -- 0:00:22
615000 -- (-491.831) (-490.395) (-487.948) [-491.584] * (-488.449) (-493.953) (-488.812) [-489.046] -- 0:00:22
Average standard deviation of split frequencies: 0.009422
615500 -- (-493.223) (-490.289) (-488.138) [-488.608] * (-488.545) [-490.505] (-489.955) (-490.122) -- 0:00:23
616000 -- [-488.011] (-489.701) (-487.723) (-487.945) * (-491.727) (-496.012) (-489.451) [-488.046] -- 0:00:23
616500 -- [-490.748] (-492.355) (-491.194) (-489.239) * (-488.372) [-489.342] (-493.007) (-489.540) -- 0:00:23
617000 -- [-489.385] (-489.371) (-490.307) (-493.977) * (-488.741) (-491.813) (-489.373) [-489.904] -- 0:00:22
617500 -- (-491.079) (-492.147) (-488.928) [-490.639] * (-489.538) (-489.358) [-489.577] (-488.929) -- 0:00:22
618000 -- [-491.267] (-491.124) (-488.819) (-489.531) * (-489.423) [-490.992] (-491.153) (-488.315) -- 0:00:22
618500 -- (-489.352) (-488.937) [-488.808] (-495.611) * [-488.330] (-490.045) (-490.612) (-489.981) -- 0:00:22
619000 -- (-488.388) (-488.859) (-490.600) [-490.120] * (-491.527) (-489.220) (-491.411) [-490.425] -- 0:00:22
619500 -- [-489.151] (-488.859) (-489.342) (-490.558) * [-491.463] (-488.897) (-488.182) (-489.901) -- 0:00:22
620000 -- (-494.679) (-489.023) [-490.171] (-491.719) * (-491.335) [-492.658] (-488.811) (-489.959) -- 0:00:22
Average standard deviation of split frequencies: 0.009541
620500 -- [-493.343] (-488.510) (-491.157) (-488.997) * [-488.621] (-490.826) (-490.330) (-489.343) -- 0:00:22
621000 -- (-493.485) [-488.913] (-487.907) (-491.075) * [-488.462] (-493.198) (-488.397) (-487.857) -- 0:00:22
621500 -- (-489.691) (-491.705) [-487.507] (-490.092) * [-493.334] (-490.196) (-491.540) (-488.852) -- 0:00:22
622000 -- (-488.608) (-490.294) [-487.826] (-490.410) * (-491.149) (-488.631) [-489.743] (-488.532) -- 0:00:22
622500 -- (-488.619) [-488.516] (-490.979) (-492.335) * (-490.471) [-488.472] (-491.069) (-488.561) -- 0:00:22
623000 -- (-489.872) (-489.477) [-488.646] (-490.482) * (-488.468) (-489.228) (-489.512) [-490.123] -- 0:00:22
623500 -- (-491.504) (-489.840) (-491.104) [-490.725] * (-488.916) (-489.739) [-489.687] (-487.818) -- 0:00:22
624000 -- (-490.010) (-487.582) [-488.045] (-492.796) * (-492.447) (-493.087) [-488.108] (-490.108) -- 0:00:22
624500 -- (-491.148) [-488.247] (-487.660) (-490.512) * [-488.724] (-489.988) (-488.862) (-490.164) -- 0:00:22
625000 -- [-492.839] (-491.686) (-488.868) (-490.670) * [-488.809] (-490.545) (-496.216) (-493.768) -- 0:00:22
Average standard deviation of split frequencies: 0.009319
625500 -- (-492.706) (-487.980) [-490.487] (-491.411) * (-493.221) (-490.346) [-493.340] (-489.749) -- 0:00:22
626000 -- (-500.156) (-490.815) (-488.080) [-488.279] * [-492.477] (-497.554) (-490.137) (-493.604) -- 0:00:22
626500 -- (-489.941) [-492.664] (-489.294) (-488.144) * (-499.375) (-493.369) [-491.174] (-492.256) -- 0:00:22
627000 -- [-487.642] (-489.205) (-488.700) (-490.060) * (-499.485) (-490.287) [-492.184] (-488.345) -- 0:00:22
627500 -- [-488.626] (-491.258) (-489.579) (-488.662) * [-490.292] (-488.802) (-488.938) (-488.078) -- 0:00:21
628000 -- (-488.128) (-492.005) [-487.891] (-489.482) * (-491.788) [-490.048] (-491.540) (-490.360) -- 0:00:21
628500 -- [-487.614] (-491.646) (-487.446) (-488.442) * (-490.458) (-491.521) (-491.638) [-490.096] -- 0:00:21
629000 -- (-489.132) (-488.289) (-488.116) [-488.324] * [-489.360] (-488.412) (-489.252) (-489.816) -- 0:00:21
629500 -- [-490.040] (-488.207) (-489.291) (-489.281) * (-493.004) [-488.547] (-489.774) (-490.138) -- 0:00:21
630000 -- (-490.084) [-487.968] (-487.699) (-489.089) * (-489.676) (-488.973) (-487.628) [-489.146] -- 0:00:21
Average standard deviation of split frequencies: 0.008409
630500 -- (-489.272) (-488.370) [-488.439] (-488.220) * (-492.133) (-493.957) (-488.544) [-490.177] -- 0:00:21
631000 -- (-488.840) (-491.283) [-489.892] (-490.010) * [-492.691] (-490.170) (-488.048) (-489.578) -- 0:00:21
631500 -- (-489.304) (-491.609) [-492.064] (-490.937) * [-488.696] (-489.776) (-489.655) (-488.349) -- 0:00:21
632000 -- (-488.981) (-489.513) [-491.035] (-490.765) * [-489.508] (-488.164) (-491.925) (-488.405) -- 0:00:21
632500 -- (-489.960) (-491.158) [-489.707] (-490.601) * (-491.956) (-489.104) [-489.468] (-488.072) -- 0:00:22
633000 -- (-488.466) (-490.958) [-488.247] (-488.985) * (-491.679) (-490.162) (-490.013) [-488.955] -- 0:00:22
633500 -- (-487.508) (-490.566) [-490.344] (-490.507) * (-492.108) [-489.060] (-490.068) (-489.992) -- 0:00:21
634000 -- [-489.486] (-493.537) (-491.412) (-489.894) * [-490.559] (-488.548) (-488.028) (-490.989) -- 0:00:21
634500 -- (-491.859) (-489.539) [-488.628] (-489.206) * (-493.596) (-488.535) [-488.355] (-489.680) -- 0:00:21
635000 -- [-491.451] (-489.418) (-490.011) (-490.332) * (-493.022) (-488.498) [-488.981] (-490.915) -- 0:00:21
Average standard deviation of split frequencies: 0.007875
635500 -- (-491.813) (-489.741) (-489.541) [-493.823] * (-493.048) (-492.241) (-487.638) [-488.652] -- 0:00:21
636000 -- [-489.408] (-490.584) (-489.470) (-491.339) * (-489.870) (-489.184) [-488.721] (-491.891) -- 0:00:21
636500 -- (-490.339) (-487.741) [-490.452] (-488.652) * (-489.737) [-488.489] (-491.087) (-489.319) -- 0:00:21
637000 -- (-487.815) [-487.925] (-489.124) (-489.770) * [-491.309] (-488.620) (-489.459) (-491.727) -- 0:00:21
637500 -- [-489.737] (-487.798) (-490.394) (-490.435) * (-490.925) [-490.201] (-488.436) (-495.102) -- 0:00:21
638000 -- (-488.474) [-487.829] (-489.643) (-488.918) * (-492.440) (-490.620) [-489.067] (-489.637) -- 0:00:21
638500 -- [-489.702] (-487.831) (-490.296) (-489.719) * (-492.250) (-489.853) [-488.521] (-490.213) -- 0:00:21
639000 -- (-491.425) [-488.583] (-488.323) (-493.921) * (-490.946) (-488.668) (-493.899) [-489.864] -- 0:00:21
639500 -- (-489.847) [-490.536] (-488.032) (-489.778) * (-488.598) [-488.083] (-491.268) (-489.023) -- 0:00:21
640000 -- (-488.132) [-487.984] (-490.191) (-487.678) * (-489.258) (-488.271) (-490.416) [-488.682] -- 0:00:21
Average standard deviation of split frequencies: 0.008186
640500 -- (-489.179) [-491.503] (-490.951) (-490.622) * (-488.774) [-489.038] (-490.850) (-490.641) -- 0:00:21
641000 -- [-490.024] (-489.834) (-492.194) (-490.595) * (-489.218) (-492.878) (-488.563) [-489.783] -- 0:00:21
641500 -- (-491.192) (-489.219) (-488.025) [-487.737] * [-490.308] (-490.689) (-491.911) (-488.159) -- 0:00:21
642000 -- (-492.521) (-488.213) [-491.998] (-488.007) * (-488.841) (-489.407) [-492.783] (-488.843) -- 0:00:21
642500 -- [-493.855] (-489.639) (-494.761) (-488.924) * [-492.706] (-488.928) (-487.419) (-488.727) -- 0:00:21
643000 -- [-488.946] (-489.956) (-493.578) (-489.999) * (-489.676) [-489.353] (-490.828) (-490.796) -- 0:00:21
643500 -- (-488.467) (-493.525) [-490.546] (-491.131) * (-489.147) (-489.026) [-490.375] (-491.474) -- 0:00:21
644000 -- (-489.621) [-490.956] (-492.479) (-490.440) * (-491.819) (-489.584) [-489.321] (-488.810) -- 0:00:21
644500 -- (-489.722) [-490.369] (-488.443) (-488.136) * [-491.410] (-490.065) (-497.727) (-490.193) -- 0:00:20
645000 -- (-489.311) (-491.043) (-488.596) [-490.894] * [-489.435] (-489.601) (-494.974) (-491.942) -- 0:00:20
Average standard deviation of split frequencies: 0.008027
645500 -- (-489.527) [-487.447] (-491.545) (-488.518) * (-488.701) (-489.797) (-493.367) [-488.317] -- 0:00:20
646000 -- [-488.136] (-487.447) (-487.714) (-489.890) * (-493.470) (-490.925) (-491.839) [-489.965] -- 0:00:20
646500 -- (-489.580) (-490.805) (-488.354) [-489.804] * [-491.312] (-490.392) (-488.858) (-496.387) -- 0:00:20
647000 -- (-488.428) (-490.914) (-490.152) [-495.986] * (-493.193) (-490.478) [-491.337] (-490.062) -- 0:00:20
647500 -- (-489.252) (-488.430) (-488.417) [-491.203] * [-491.361] (-490.111) (-490.186) (-491.041) -- 0:00:20
648000 -- (-491.899) [-489.925] (-488.735) (-489.824) * (-499.376) (-490.472) [-490.040] (-491.678) -- 0:00:20
648500 -- [-488.806] (-491.087) (-488.638) (-490.119) * (-492.605) (-492.130) [-489.998] (-498.536) -- 0:00:20
649000 -- (-489.856) [-489.985] (-493.223) (-492.047) * [-489.692] (-495.054) (-491.313) (-491.798) -- 0:00:20
649500 -- (-490.013) [-488.038] (-490.446) (-492.582) * (-491.016) (-489.615) [-488.873] (-488.997) -- 0:00:21
650000 -- (-492.837) (-491.313) [-490.955] (-488.669) * [-487.874] (-494.936) (-496.147) (-488.477) -- 0:00:21
Average standard deviation of split frequencies: 0.007743
650500 -- (-488.958) (-494.867) [-488.117] (-489.454) * [-489.115] (-488.556) (-491.583) (-488.329) -- 0:00:20
651000 -- (-491.048) [-492.139] (-491.959) (-492.185) * (-489.882) (-489.570) (-490.687) [-488.177] -- 0:00:20
651500 -- (-488.778) (-490.299) [-488.701] (-490.815) * [-492.622] (-491.681) (-489.669) (-490.840) -- 0:00:20
652000 -- (-494.272) [-490.961] (-490.937) (-488.626) * (-492.838) (-488.648) (-489.794) [-494.083] -- 0:00:20
652500 -- [-489.551] (-490.291) (-491.177) (-488.187) * (-495.598) (-488.641) (-489.276) [-489.183] -- 0:00:20
653000 -- [-490.710] (-488.423) (-491.898) (-489.489) * (-493.133) (-491.520) (-490.211) [-491.632] -- 0:00:20
653500 -- (-489.599) (-487.677) [-488.329] (-488.650) * (-491.174) (-489.243) (-490.593) [-492.673] -- 0:00:20
654000 -- (-492.271) (-490.974) (-492.529) [-490.398] * (-491.317) (-491.374) (-489.032) [-488.651] -- 0:00:20
654500 -- (-497.100) [-491.551] (-489.472) (-491.052) * (-491.330) (-488.300) [-488.945] (-490.744) -- 0:00:20
655000 -- (-494.773) (-490.767) (-490.971) [-490.376] * [-490.019] (-491.228) (-492.154) (-488.035) -- 0:00:20
Average standard deviation of split frequencies: 0.007815
655500 -- (-488.623) (-490.215) (-488.197) [-488.681] * (-489.945) (-492.477) [-491.052] (-491.367) -- 0:00:20
656000 -- (-487.951) (-490.117) [-488.527] (-491.203) * [-489.412] (-488.848) (-490.690) (-489.782) -- 0:00:20
656500 -- [-488.580] (-497.393) (-491.925) (-490.608) * [-489.703] (-488.243) (-489.140) (-489.604) -- 0:00:20
657000 -- (-490.502) [-490.547] (-491.683) (-489.848) * (-491.845) (-493.197) [-489.677] (-487.778) -- 0:00:20
657500 -- (-489.407) [-490.972] (-488.388) (-492.037) * (-492.757) (-493.406) (-490.519) [-488.192] -- 0:00:20
658000 -- (-489.517) (-491.965) [-487.856] (-494.541) * (-488.811) [-490.296] (-490.725) (-490.998) -- 0:00:20
658500 -- [-489.731] (-491.922) (-491.235) (-497.198) * (-488.699) (-490.905) [-488.482] (-491.989) -- 0:00:20
659000 -- (-491.605) (-488.010) (-487.945) [-489.338] * (-490.211) (-491.169) (-491.413) [-489.349] -- 0:00:20
659500 -- (-491.277) [-488.366] (-488.441) (-488.859) * (-489.919) [-487.834] (-490.122) (-488.055) -- 0:00:20
660000 -- (-490.126) [-489.370] (-488.859) (-490.943) * (-490.562) (-488.728) (-488.597) [-490.915] -- 0:00:20
Average standard deviation of split frequencies: 0.007468
660500 -- (-497.101) (-489.816) [-490.345] (-491.021) * [-489.150] (-489.369) (-490.192) (-491.607) -- 0:00:20
661000 -- (-491.494) (-489.521) (-489.375) [-492.133] * [-489.692] (-492.135) (-491.833) (-490.751) -- 0:00:20
661500 -- (-489.343) (-490.101) (-491.598) [-489.032] * (-489.346) (-489.081) (-491.926) [-489.317] -- 0:00:19
662000 -- [-490.005] (-488.479) (-492.952) (-492.123) * (-488.651) (-489.264) [-490.344] (-489.441) -- 0:00:19
662500 -- (-488.689) (-492.845) [-489.162] (-493.253) * (-491.759) [-489.380] (-494.320) (-489.352) -- 0:00:19
663000 -- (-490.244) (-490.448) [-487.735] (-493.899) * (-490.885) (-490.187) [-493.431] (-493.227) -- 0:00:19
663500 -- (-488.873) [-489.767] (-488.694) (-491.308) * [-489.632] (-488.233) (-489.590) (-489.780) -- 0:00:19
664000 -- (-489.166) (-488.380) (-489.303) [-490.935] * (-488.124) [-488.986] (-488.314) (-490.927) -- 0:00:19
664500 -- [-487.704] (-489.112) (-488.651) (-494.815) * (-488.021) (-491.118) (-488.329) [-488.931] -- 0:00:19
665000 -- [-489.788] (-488.551) (-488.150) (-489.762) * (-492.869) (-488.405) (-488.607) [-494.225] -- 0:00:19
Average standard deviation of split frequencies: 0.007597
665500 -- (-490.226) (-492.405) (-489.976) [-489.864] * (-498.316) (-487.879) [-488.452] (-491.323) -- 0:00:19
666000 -- (-490.185) (-496.079) [-489.246] (-488.078) * (-497.099) (-489.838) [-490.026] (-489.110) -- 0:00:19
666500 -- [-493.239] (-492.482) (-488.828) (-489.330) * (-502.035) (-489.141) [-490.921] (-489.430) -- 0:00:20
667000 -- (-491.721) (-490.023) (-493.360) [-489.013] * (-491.751) [-489.776] (-490.842) (-489.239) -- 0:00:19
667500 -- (-488.361) (-490.283) [-489.100] (-488.031) * (-489.972) (-492.870) (-489.728) [-491.694] -- 0:00:19
668000 -- (-491.345) (-488.621) (-488.781) [-493.870] * (-491.224) (-491.208) (-490.094) [-490.862] -- 0:00:19
668500 -- (-487.810) (-488.395) [-488.954] (-492.125) * (-489.663) (-491.062) [-488.310] (-488.999) -- 0:00:19
669000 -- (-489.380) (-488.056) (-490.935) [-492.162] * (-489.817) (-488.804) [-490.688] (-488.844) -- 0:00:19
669500 -- (-488.363) (-488.433) (-490.732) [-489.805] * (-489.434) (-491.479) [-489.487] (-488.840) -- 0:00:19
670000 -- (-489.563) [-488.040] (-492.979) (-488.548) * [-490.911] (-487.645) (-490.809) (-490.347) -- 0:00:19
Average standard deviation of split frequencies: 0.007732
670500 -- (-491.364) (-489.852) [-489.936] (-488.104) * (-497.424) (-489.666) [-493.105] (-492.630) -- 0:00:19
671000 -- (-488.145) [-490.001] (-490.370) (-490.025) * (-490.677) (-488.809) (-489.451) [-489.247] -- 0:00:19
671500 -- (-490.599) (-491.600) (-491.425) [-488.249] * [-487.758] (-489.748) (-491.794) (-492.884) -- 0:00:19
672000 -- (-488.817) (-491.573) (-490.114) [-490.345] * (-489.251) (-493.073) (-490.158) [-490.043] -- 0:00:19
672500 -- [-490.729] (-488.503) (-487.816) (-488.414) * (-490.505) [-491.031] (-489.764) (-494.817) -- 0:00:19
673000 -- [-490.763] (-493.352) (-488.085) (-489.481) * (-487.673) (-489.360) (-490.662) [-493.776] -- 0:00:19
673500 -- (-491.571) (-489.796) [-490.595] (-489.768) * [-489.258] (-487.738) (-488.494) (-491.002) -- 0:00:19
674000 -- (-492.957) (-493.812) (-492.079) [-489.601] * (-490.112) (-487.450) [-488.546] (-489.899) -- 0:00:19
674500 -- (-491.807) (-492.466) [-492.331] (-490.160) * (-490.471) [-488.034] (-488.405) (-489.143) -- 0:00:19
675000 -- (-489.624) [-489.182] (-488.260) (-489.557) * (-491.317) (-488.552) (-489.041) [-489.156] -- 0:00:19
Average standard deviation of split frequencies: 0.007857
675500 -- (-488.406) (-490.173) (-489.146) [-488.933] * (-488.299) (-489.667) (-489.829) [-490.619] -- 0:00:19
676000 -- (-491.547) (-490.041) (-487.806) [-489.998] * (-491.309) (-490.654) (-490.585) [-490.500] -- 0:00:19
676500 -- (-487.737) (-489.365) [-487.824] (-491.076) * [-488.682] (-489.417) (-489.072) (-489.078) -- 0:00:19
677000 -- [-491.259] (-490.916) (-488.427) (-490.584) * (-488.705) (-490.973) (-487.910) [-489.241] -- 0:00:19
677500 -- (-490.758) (-489.926) [-489.221] (-490.459) * (-490.237) (-490.570) (-493.713) [-487.721] -- 0:00:19
678000 -- (-488.459) (-489.628) [-490.164] (-489.397) * (-491.267) [-490.325] (-491.318) (-488.263) -- 0:00:18
678500 -- [-490.159] (-488.671) (-490.018) (-493.517) * (-490.574) (-488.615) (-488.721) [-491.984] -- 0:00:18
679000 -- [-489.178] (-490.704) (-490.385) (-489.503) * [-489.310] (-493.034) (-493.337) (-492.784) -- 0:00:18
679500 -- (-489.983) (-490.601) [-488.986] (-492.075) * (-489.130) (-491.645) (-493.059) [-488.375] -- 0:00:18
680000 -- (-491.339) (-492.146) (-489.495) [-492.978] * (-490.936) (-493.497) [-491.032] (-488.798) -- 0:00:18
Average standard deviation of split frequencies: 0.008126
680500 -- (-489.734) [-487.841] (-489.321) (-487.740) * (-489.734) [-493.840] (-489.309) (-491.773) -- 0:00:18
681000 -- (-489.705) (-489.145) [-488.106] (-492.563) * (-491.559) [-489.330] (-489.468) (-490.162) -- 0:00:18
681500 -- (-488.845) (-489.157) (-492.788) [-490.095] * (-489.864) (-490.015) (-489.388) [-490.752] -- 0:00:18
682000 -- (-488.702) (-490.043) (-489.440) [-488.045] * (-493.118) [-488.232] (-494.187) (-489.307) -- 0:00:18
682500 -- (-488.975) (-495.561) [-487.642] (-490.609) * (-488.322) [-487.619] (-489.360) (-489.410) -- 0:00:18
683000 -- (-489.169) (-489.945) (-488.251) [-489.846] * (-490.473) (-488.798) (-488.220) [-492.146] -- 0:00:18
683500 -- (-489.351) [-489.663] (-489.384) (-488.626) * (-489.088) (-489.114) [-490.499] (-489.246) -- 0:00:18
684000 -- (-490.533) [-489.445] (-490.117) (-488.412) * (-490.179) (-489.950) (-490.781) [-490.375] -- 0:00:18
684500 -- (-490.763) (-490.272) (-490.339) [-488.744] * (-489.016) (-491.899) (-490.592) [-489.153] -- 0:00:18
685000 -- (-488.958) (-490.138) [-491.027] (-491.340) * (-491.935) (-488.068) (-495.379) [-488.466] -- 0:00:18
Average standard deviation of split frequencies: 0.007971
685500 -- (-487.793) [-487.611] (-488.218) (-491.398) * [-489.241] (-489.178) (-492.094) (-488.960) -- 0:00:18
686000 -- (-490.855) [-487.371] (-490.335) (-489.344) * (-489.513) [-491.818] (-492.625) (-496.453) -- 0:00:18
686500 -- (-489.119) (-490.635) (-491.277) [-488.306] * (-488.306) [-489.730] (-488.918) (-495.367) -- 0:00:18
687000 -- (-489.102) (-491.234) (-491.170) [-488.984] * (-490.420) [-488.500] (-488.279) (-495.250) -- 0:00:18
687500 -- [-488.050] (-487.937) (-488.025) (-489.203) * (-490.091) (-490.761) (-487.367) [-490.165] -- 0:00:18
688000 -- [-487.908] (-489.075) (-489.485) (-489.255) * (-493.332) [-489.986] (-488.434) (-491.178) -- 0:00:18
688500 -- (-489.550) (-489.786) (-489.920) [-489.082] * (-490.950) (-493.085) [-488.650] (-490.875) -- 0:00:18
689000 -- [-490.139] (-491.301) (-491.542) (-489.558) * (-490.721) (-489.395) [-488.381] (-493.508) -- 0:00:18
689500 -- (-490.858) (-491.251) [-492.440] (-494.321) * (-490.989) (-488.684) (-493.066) [-491.977] -- 0:00:18
690000 -- [-488.515] (-492.160) (-491.841) (-487.807) * (-493.514) [-490.170] (-488.397) (-489.166) -- 0:00:18
Average standard deviation of split frequencies: 0.007144
690500 -- (-489.569) (-489.387) [-493.159] (-491.776) * (-496.251) [-488.326] (-491.375) (-489.418) -- 0:00:18
691000 -- [-487.711] (-494.854) (-491.374) (-489.352) * (-490.400) (-489.695) (-493.002) [-488.338] -- 0:00:18
691500 -- (-487.993) [-492.263] (-488.742) (-490.460) * [-491.119] (-489.730) (-489.110) (-489.571) -- 0:00:18
692000 -- (-488.917) (-491.899) [-490.020] (-488.110) * (-491.849) [-489.397] (-491.822) (-492.540) -- 0:00:18
692500 -- [-490.345] (-488.206) (-491.546) (-489.167) * (-492.937) [-488.801] (-489.368) (-493.329) -- 0:00:18
693000 -- (-488.448) [-490.279] (-491.416) (-492.522) * [-493.826] (-487.816) (-488.030) (-494.311) -- 0:00:18
693500 -- (-488.389) (-488.557) (-489.722) [-488.323] * (-491.240) [-487.810] (-488.945) (-490.272) -- 0:00:18
694000 -- (-488.036) (-491.781) (-488.332) [-487.596] * (-494.397) (-488.111) (-491.203) [-488.196] -- 0:00:18
694500 -- (-491.025) [-487.900] (-489.464) (-488.272) * [-488.418] (-488.010) (-490.020) (-489.791) -- 0:00:18
695000 -- (-491.412) [-489.604] (-490.138) (-494.017) * (-489.318) [-488.790] (-489.984) (-488.705) -- 0:00:17
Average standard deviation of split frequencies: 0.007360
695500 -- [-488.212] (-488.365) (-488.913) (-488.452) * (-489.400) (-489.134) [-491.082] (-489.976) -- 0:00:17
696000 -- [-488.154] (-491.053) (-489.270) (-488.559) * (-488.160) [-489.153] (-494.314) (-489.193) -- 0:00:17
696500 -- (-490.188) (-492.681) [-488.928] (-489.186) * (-491.184) [-491.637] (-491.502) (-492.271) -- 0:00:17
697000 -- [-489.128] (-489.549) (-495.215) (-487.996) * (-488.170) [-491.104] (-487.901) (-492.254) -- 0:00:17
697500 -- (-490.589) [-488.610] (-490.262) (-488.677) * (-490.902) (-489.269) [-488.421] (-489.448) -- 0:00:17
698000 -- (-491.081) [-488.402] (-492.718) (-490.641) * [-490.521] (-489.035) (-488.028) (-489.018) -- 0:00:17
698500 -- (-491.242) (-488.503) [-491.961] (-489.100) * [-490.772] (-488.660) (-488.975) (-488.099) -- 0:00:17
699000 -- (-490.294) (-488.497) [-491.282] (-489.028) * [-491.241] (-490.384) (-489.304) (-487.892) -- 0:00:17
699500 -- (-487.675) (-489.296) [-490.167] (-490.817) * (-491.251) (-490.345) (-495.013) [-488.317] -- 0:00:17
700000 -- (-487.405) [-489.950] (-489.271) (-489.674) * (-491.736) [-489.077] (-491.057) (-488.694) -- 0:00:17
Average standard deviation of split frequencies: 0.007715
700500 -- (-488.533) (-489.889) [-488.562] (-488.995) * (-488.359) (-488.517) [-490.093] (-489.880) -- 0:00:17
701000 -- (-494.547) [-489.650] (-489.171) (-487.903) * [-489.034] (-487.840) (-487.863) (-487.840) -- 0:00:17
701500 -- (-493.154) (-489.934) (-489.165) [-488.575] * [-489.536] (-490.688) (-489.667) (-488.784) -- 0:00:17
702000 -- (-490.203) (-490.333) (-492.920) [-488.448] * [-489.165] (-489.787) (-490.796) (-488.470) -- 0:00:17
702500 -- (-492.757) (-494.493) [-488.374] (-488.673) * (-489.796) [-491.910] (-494.123) (-489.231) -- 0:00:17
703000 -- [-490.188] (-490.153) (-489.117) (-488.188) * (-488.069) [-487.981] (-488.852) (-493.256) -- 0:00:17
703500 -- [-492.878] (-492.135) (-494.445) (-488.912) * (-488.856) (-489.623) [-487.867] (-490.335) -- 0:00:17
704000 -- (-488.987) [-488.004] (-491.601) (-488.234) * (-489.164) [-488.254] (-489.087) (-488.140) -- 0:00:17
704500 -- (-488.997) (-487.825) (-489.751) [-490.751] * (-488.695) (-488.757) [-490.411] (-488.488) -- 0:00:17
705000 -- (-492.209) [-493.248] (-491.110) (-489.434) * (-491.493) (-488.306) [-489.956] (-487.555) -- 0:00:17
Average standard deviation of split frequencies: 0.007523
705500 -- [-488.983] (-491.531) (-489.397) (-488.124) * (-492.578) (-489.423) [-492.865] (-489.010) -- 0:00:17
706000 -- (-495.709) (-489.008) (-493.491) [-489.402] * (-491.938) [-490.638] (-490.082) (-489.599) -- 0:00:17
706500 -- [-489.169] (-489.803) (-490.066) (-491.265) * (-490.999) [-489.579] (-489.215) (-489.043) -- 0:00:17
707000 -- (-488.979) (-489.852) (-491.893) [-489.670] * (-493.136) [-488.431] (-488.241) (-489.353) -- 0:00:17
707500 -- (-487.990) [-495.002] (-491.139) (-490.612) * (-488.371) (-489.098) (-491.752) [-487.624] -- 0:00:17
708000 -- (-490.992) (-492.262) (-489.155) [-487.620] * (-490.630) [-487.910] (-488.738) (-489.941) -- 0:00:17
708500 -- (-488.619) (-490.524) [-489.099] (-487.618) * (-492.116) (-491.819) (-487.818) [-488.266] -- 0:00:17
709000 -- (-489.227) (-488.650) (-488.464) [-491.022] * (-491.147) [-490.555] (-489.927) (-489.328) -- 0:00:17
709500 -- [-488.901] (-491.472) (-488.718) (-490.344) * (-488.902) [-488.153] (-493.845) (-489.397) -- 0:00:17
710000 -- (-489.980) [-490.372] (-489.217) (-491.061) * (-487.914) (-489.016) (-493.024) [-489.160] -- 0:00:17
Average standard deviation of split frequencies: 0.007208
710500 -- (-488.640) (-490.056) [-487.391] (-490.588) * [-491.489] (-490.828) (-492.033) (-489.550) -- 0:00:17
711000 -- [-487.909] (-493.098) (-487.924) (-488.349) * [-492.166] (-489.176) (-490.323) (-488.927) -- 0:00:17
711500 -- (-489.177) [-487.879] (-491.297) (-488.044) * (-495.464) [-491.840] (-489.597) (-491.181) -- 0:00:17
712000 -- (-490.208) (-488.097) [-489.343] (-490.063) * (-491.234) (-493.754) (-491.563) [-492.973] -- 0:00:16
712500 -- (-488.974) [-490.310] (-488.398) (-489.128) * (-491.762) [-489.646] (-487.999) (-488.403) -- 0:00:16
713000 -- (-489.957) (-490.891) [-492.963] (-488.572) * (-488.060) [-489.129] (-488.711) (-489.746) -- 0:00:16
713500 -- (-493.198) (-490.872) (-493.347) [-489.099] * (-489.310) [-490.433] (-491.907) (-488.192) -- 0:00:16
714000 -- [-489.440] (-487.944) (-497.153) (-490.034) * (-490.387) [-491.250] (-490.316) (-489.498) -- 0:00:16
714500 -- (-489.164) [-489.725] (-491.503) (-490.930) * [-491.517] (-488.665) (-490.859) (-492.909) -- 0:00:16
715000 -- [-488.780] (-489.301) (-489.343) (-488.233) * [-488.590] (-488.912) (-489.176) (-491.194) -- 0:00:16
Average standard deviation of split frequencies: 0.006803
715500 -- [-487.798] (-490.638) (-489.846) (-489.273) * [-489.514] (-489.895) (-489.895) (-489.432) -- 0:00:16
716000 -- [-488.795] (-488.717) (-490.461) (-490.357) * [-489.882] (-489.312) (-492.123) (-489.993) -- 0:00:16
716500 -- (-488.591) [-489.047] (-488.334) (-489.947) * [-488.792] (-489.700) (-487.572) (-489.510) -- 0:00:16
717000 -- (-489.098) (-487.948) [-488.890] (-491.387) * (-489.312) [-488.664] (-488.759) (-489.258) -- 0:00:16
717500 -- (-491.123) (-489.763) [-489.633] (-492.329) * (-488.962) [-488.931] (-490.212) (-490.085) -- 0:00:16
718000 -- (-493.659) (-489.957) (-490.113) [-488.120] * (-488.089) (-489.090) [-488.462] (-488.407) -- 0:00:16
718500 -- (-489.982) (-491.442) (-490.098) [-489.693] * (-488.089) [-490.534] (-493.995) (-489.186) -- 0:00:16
719000 -- (-487.594) [-493.592] (-490.348) (-490.266) * (-491.318) [-490.168] (-491.104) (-492.655) -- 0:00:16
719500 -- [-488.341] (-496.044) (-492.927) (-488.082) * (-490.482) (-490.462) [-489.603] (-490.790) -- 0:00:16
720000 -- [-488.780] (-494.283) (-488.150) (-488.808) * [-490.681] (-496.690) (-489.946) (-495.430) -- 0:00:16
Average standard deviation of split frequencies: 0.006672
720500 -- (-489.153) (-488.513) (-489.299) [-489.016] * [-488.302] (-491.686) (-488.586) (-489.753) -- 0:00:16
721000 -- [-488.612] (-489.894) (-489.719) (-487.472) * (-488.949) [-488.248] (-490.266) (-489.689) -- 0:00:16
721500 -- (-489.697) (-488.914) [-487.865] (-491.142) * [-488.355] (-493.108) (-488.953) (-488.335) -- 0:00:16
722000 -- (-490.556) [-491.100] (-492.325) (-488.613) * (-488.576) (-490.769) [-488.588] (-489.231) -- 0:00:16
722500 -- (-489.138) (-488.734) (-489.344) [-487.503] * (-492.017) (-489.111) (-488.821) [-490.803] -- 0:00:16
723000 -- [-490.425] (-490.731) (-490.418) (-489.250) * (-489.743) [-490.849] (-488.399) (-488.154) -- 0:00:16
723500 -- (-489.840) (-488.130) [-491.483] (-494.157) * (-487.862) [-489.736] (-489.339) (-489.926) -- 0:00:16
724000 -- [-489.749] (-488.072) (-491.244) (-492.437) * (-488.503) [-490.141] (-489.689) (-489.290) -- 0:00:16
724500 -- (-488.467) [-489.121] (-491.753) (-489.885) * (-488.173) (-489.735) [-491.712] (-489.199) -- 0:00:16
725000 -- (-489.421) [-488.603] (-493.253) (-495.186) * (-488.168) [-489.706] (-491.076) (-490.404) -- 0:00:16
Average standard deviation of split frequencies: 0.006623
725500 -- (-490.045) (-492.760) (-490.160) [-489.962] * (-488.023) (-488.259) [-490.321] (-490.091) -- 0:00:16
726000 -- (-493.302) (-490.883) (-489.756) [-491.824] * (-492.616) (-488.929) [-487.543] (-487.285) -- 0:00:16
726500 -- [-489.796] (-489.437) (-489.278) (-489.561) * (-490.426) (-488.604) [-487.541] (-490.448) -- 0:00:16
727000 -- (-489.099) [-488.524] (-491.797) (-491.223) * (-490.207) (-490.692) [-487.574] (-488.813) -- 0:00:16
727500 -- (-488.929) (-489.025) (-488.680) [-488.461] * (-489.759) (-491.911) (-488.098) [-493.386] -- 0:00:16
728000 -- (-491.843) (-488.571) (-490.064) [-492.999] * (-492.565) (-491.554) (-491.600) [-489.651] -- 0:00:16
728500 -- (-488.565) (-488.746) (-488.396) [-488.283] * (-488.197) (-490.511) (-489.786) [-488.276] -- 0:00:16
729000 -- (-492.255) (-489.687) (-488.567) [-488.456] * (-488.171) (-491.138) [-490.436] (-489.083) -- 0:00:15
729500 -- (-489.742) [-490.167] (-489.833) (-489.787) * (-489.995) [-487.886] (-488.403) (-489.865) -- 0:00:15
730000 -- (-488.520) (-491.038) [-488.944] (-488.022) * [-489.475] (-489.865) (-488.286) (-489.446) -- 0:00:15
Average standard deviation of split frequencies: 0.006194
730500 -- [-487.873] (-488.955) (-488.883) (-489.917) * (-493.253) (-491.717) (-488.419) [-490.405] -- 0:00:15
731000 -- (-492.774) [-488.039] (-493.070) (-488.180) * [-488.792] (-490.122) (-487.764) (-490.479) -- 0:00:15
731500 -- [-489.458] (-488.593) (-492.931) (-495.197) * (-490.128) [-489.766] (-487.698) (-489.308) -- 0:00:15
732000 -- (-487.316) (-491.397) [-489.329] (-487.658) * (-491.502) (-487.654) (-488.531) [-490.153] -- 0:00:15
732500 -- (-489.489) [-493.188] (-490.243) (-487.830) * (-491.003) (-492.273) (-489.858) [-488.315] -- 0:00:15
733000 -- (-491.222) [-491.905] (-491.957) (-492.018) * (-491.812) (-493.823) (-488.352) [-489.893] -- 0:00:15
733500 -- [-489.452] (-493.356) (-488.047) (-493.758) * (-490.438) (-495.815) (-488.487) [-492.031] -- 0:00:15
734000 -- (-488.955) (-488.019) [-489.631] (-489.009) * [-489.582] (-488.412) (-488.280) (-491.098) -- 0:00:15
734500 -- (-489.021) (-496.008) [-488.913] (-489.302) * (-489.348) (-487.979) [-490.872] (-492.093) -- 0:00:15
735000 -- (-489.041) (-492.297) [-488.455] (-490.940) * (-493.385) (-489.112) [-487.653] (-493.716) -- 0:00:15
Average standard deviation of split frequencies: 0.006320
735500 -- (-489.105) (-488.073) (-490.538) [-489.734] * [-491.423] (-492.246) (-487.791) (-493.199) -- 0:00:15
736000 -- (-489.968) (-489.674) (-494.935) [-488.110] * [-489.240] (-488.464) (-489.036) (-491.021) -- 0:00:15
736500 -- (-488.787) [-488.639] (-490.056) (-487.865) * (-488.673) (-492.685) (-488.990) [-490.399] -- 0:00:15
737000 -- (-488.115) [-488.497] (-490.259) (-490.489) * (-488.455) [-489.987] (-487.715) (-494.866) -- 0:00:15
737500 -- [-488.956] (-489.875) (-490.938) (-490.781) * [-488.388] (-490.409) (-489.479) (-494.263) -- 0:00:15
738000 -- [-488.304] (-490.440) (-488.834) (-492.237) * (-490.404) [-489.530] (-492.330) (-495.008) -- 0:00:15
738500 -- (-487.894) (-489.807) (-491.782) [-490.474] * [-490.983] (-491.162) (-488.300) (-489.818) -- 0:00:15
739000 -- [-488.186] (-489.891) (-488.489) (-487.936) * (-489.490) (-491.258) [-488.036] (-491.475) -- 0:00:15
739500 -- (-489.708) (-488.004) (-494.012) [-488.182] * [-489.230] (-489.781) (-487.750) (-489.404) -- 0:00:15
740000 -- (-493.392) (-492.846) [-489.130] (-489.130) * [-488.903] (-488.378) (-488.530) (-489.372) -- 0:00:15
Average standard deviation of split frequencies: 0.005474
740500 -- (-489.647) (-488.955) [-489.864] (-490.460) * [-488.202] (-490.670) (-489.933) (-488.361) -- 0:00:15
741000 -- (-490.087) (-488.895) [-492.991] (-487.617) * (-488.239) [-489.736] (-488.505) (-491.498) -- 0:00:15
741500 -- (-488.940) (-488.307) (-491.334) [-488.016] * (-488.642) (-489.200) (-488.492) [-492.651] -- 0:00:15
742000 -- [-489.745] (-489.824) (-491.388) (-489.728) * (-488.891) (-491.588) [-489.011] (-493.001) -- 0:00:15
742500 -- (-490.065) (-490.067) (-490.430) [-490.639] * (-490.244) [-489.433] (-488.668) (-493.380) -- 0:00:15
743000 -- (-492.828) (-490.806) (-489.472) [-488.695] * (-487.830) (-490.351) [-488.123] (-489.286) -- 0:00:15
743500 -- [-490.042] (-491.710) (-490.393) (-489.437) * [-489.617] (-491.522) (-487.896) (-488.635) -- 0:00:15
744000 -- (-494.577) (-493.297) [-490.528] (-494.115) * [-490.894] (-488.510) (-487.936) (-491.405) -- 0:00:15
744500 -- (-488.125) (-492.161) (-490.064) [-491.287] * (-489.637) (-488.014) (-492.230) [-489.687] -- 0:00:15
745000 -- [-489.319] (-488.958) (-490.497) (-488.292) * (-494.322) (-489.749) (-489.371) [-488.812] -- 0:00:15
Average standard deviation of split frequencies: 0.005898
745500 -- (-490.469) (-488.377) (-490.728) [-490.530] * (-492.513) (-493.733) (-489.041) [-489.291] -- 0:00:15
746000 -- (-487.891) (-488.663) [-488.631] (-489.749) * (-490.370) [-490.364] (-487.662) (-493.065) -- 0:00:14
746500 -- (-488.328) (-487.712) (-488.253) [-490.660] * [-489.761] (-489.811) (-489.533) (-493.905) -- 0:00:14
747000 -- (-488.676) [-488.946] (-489.603) (-490.915) * (-492.495) (-489.691) [-494.189] (-489.187) -- 0:00:14
747500 -- (-489.369) (-487.728) [-492.798] (-489.787) * (-493.004) (-491.474) (-489.837) [-488.346] -- 0:00:14
748000 -- [-489.230] (-488.529) (-492.955) (-491.753) * (-490.629) [-487.824] (-491.585) (-489.889) -- 0:00:14
748500 -- [-488.872] (-488.254) (-492.438) (-499.145) * (-489.080) (-487.860) (-495.069) [-492.346] -- 0:00:14
749000 -- (-489.897) (-487.733) (-493.002) [-489.477] * (-489.453) (-488.910) [-489.380] (-488.097) -- 0:00:14
749500 -- (-489.382) (-487.775) [-489.243] (-489.058) * (-491.382) (-490.813) [-487.795] (-488.314) -- 0:00:14
750000 -- (-491.056) (-489.601) (-490.410) [-488.759] * (-490.885) [-490.272] (-489.481) (-489.473) -- 0:00:14
Average standard deviation of split frequencies: 0.006029
750500 -- (-490.618) (-487.869) (-491.692) [-491.098] * (-490.386) [-491.501] (-489.452) (-491.761) -- 0:00:14
751000 -- (-491.782) (-490.061) [-489.193] (-489.426) * (-493.681) (-491.719) (-490.440) [-492.967] -- 0:00:14
751500 -- (-491.639) (-489.055) [-488.667] (-488.233) * [-491.802] (-492.104) (-489.247) (-490.435) -- 0:00:14
752000 -- (-490.805) (-490.165) (-488.646) [-490.892] * [-488.301] (-489.395) (-488.466) (-489.366) -- 0:00:14
752500 -- [-490.382] (-490.054) (-490.560) (-491.534) * [-490.652] (-489.541) (-496.461) (-490.491) -- 0:00:14
753000 -- (-488.994) (-491.105) (-489.542) [-496.610] * (-488.191) (-487.767) [-493.119] (-492.054) -- 0:00:14
753500 -- (-488.733) (-490.259) [-492.826] (-489.433) * (-489.930) (-488.736) (-489.270) [-489.670] -- 0:00:14
754000 -- (-491.581) [-490.144] (-490.961) (-488.808) * (-489.046) (-490.642) (-489.160) [-490.657] -- 0:00:14
754500 -- [-489.042] (-488.519) (-490.982) (-489.131) * [-489.954] (-489.005) (-488.487) (-489.951) -- 0:00:14
755000 -- (-489.886) [-488.581] (-493.567) (-487.782) * (-488.112) (-490.039) [-490.586] (-489.968) -- 0:00:14
Average standard deviation of split frequencies: 0.006319
755500 -- (-490.335) (-490.560) (-494.097) [-488.164] * (-490.151) [-488.865] (-489.840) (-490.489) -- 0:00:14
756000 -- (-489.475) (-491.575) [-489.814] (-489.363) * (-488.666) (-489.400) (-488.907) [-488.006] -- 0:00:14
756500 -- (-492.010) [-492.194] (-489.340) (-492.040) * (-488.967) (-489.348) (-488.195) [-490.367] -- 0:00:14
757000 -- (-489.237) (-489.085) (-490.715) [-489.173] * (-488.153) (-487.749) (-488.358) [-492.164] -- 0:00:14
757500 -- [-490.385] (-488.431) (-490.647) (-488.149) * (-490.611) (-490.788) (-488.161) [-489.584] -- 0:00:14
758000 -- [-488.309] (-489.075) (-490.632) (-490.861) * (-488.682) (-490.474) (-490.566) [-488.325] -- 0:00:14
758500 -- [-488.235] (-487.726) (-491.558) (-491.717) * (-496.940) (-490.697) (-488.967) [-488.262] -- 0:00:14
759000 -- (-489.163) [-488.969] (-491.023) (-489.571) * [-494.138] (-489.010) (-490.769) (-488.878) -- 0:00:14
759500 -- [-488.862] (-489.908) (-489.525) (-492.217) * (-490.271) (-489.325) (-490.199) [-488.962] -- 0:00:14
760000 -- (-487.824) [-488.333] (-489.366) (-492.580) * [-490.857] (-489.247) (-488.497) (-487.877) -- 0:00:14
Average standard deviation of split frequencies: 0.006693
760500 -- (-490.750) [-491.863] (-491.643) (-491.917) * (-490.275) (-490.086) (-488.981) [-487.776] -- 0:00:14
761000 -- (-490.608) (-490.610) [-490.829] (-488.428) * (-491.154) [-489.015] (-489.413) (-489.322) -- 0:00:14
761500 -- [-488.462] (-489.060) (-490.494) (-490.105) * (-491.719) (-488.393) [-488.731] (-491.980) -- 0:00:14
762000 -- (-492.022) (-489.647) (-490.770) [-490.545] * [-493.614] (-489.170) (-487.392) (-489.242) -- 0:00:14
762500 -- [-493.220] (-491.075) (-492.806) (-494.184) * (-490.456) (-490.750) (-491.239) [-489.061] -- 0:00:14
763000 -- [-490.174] (-490.007) (-492.191) (-490.974) * (-488.244) (-490.160) (-491.164) [-489.390] -- 0:00:13
763500 -- (-492.553) [-488.598] (-490.772) (-489.440) * (-488.244) (-488.381) [-489.037] (-490.193) -- 0:00:13
764000 -- (-488.620) (-489.918) (-489.558) [-489.415] * (-491.801) [-492.593] (-489.632) (-489.932) -- 0:00:13
764500 -- (-487.918) [-488.567] (-490.148) (-490.559) * (-496.293) (-491.483) (-494.957) [-488.302] -- 0:00:13
765000 -- (-488.053) (-490.190) (-487.751) [-489.668] * [-490.976] (-488.732) (-492.903) (-488.980) -- 0:00:13
Average standard deviation of split frequencies: 0.006564
765500 -- (-489.407) [-489.181] (-487.751) (-488.224) * (-489.321) (-491.358) (-490.473) [-488.604] -- 0:00:13
766000 -- [-489.227] (-487.859) (-491.902) (-489.835) * (-490.159) (-489.774) (-489.445) [-490.221] -- 0:00:13
766500 -- (-490.452) (-488.237) (-490.725) [-492.633] * (-493.796) [-489.085] (-494.294) (-489.574) -- 0:00:13
767000 -- (-489.855) [-489.521] (-489.305) (-491.139) * (-489.207) [-490.259] (-490.334) (-490.924) -- 0:00:13
767500 -- (-490.681) (-487.924) [-491.082] (-490.851) * [-488.656] (-490.731) (-489.258) (-493.174) -- 0:00:13
768000 -- (-490.317) (-489.719) [-492.361] (-489.077) * [-488.256] (-490.513) (-489.253) (-491.808) -- 0:00:13
768500 -- (-491.350) (-490.595) [-488.594] (-489.283) * (-489.014) (-493.308) [-488.519] (-490.136) -- 0:00:13
769000 -- (-495.320) (-492.484) [-488.894] (-489.050) * (-489.249) [-489.811] (-490.817) (-488.108) -- 0:00:13
769500 -- [-492.651] (-488.244) (-490.117) (-487.628) * [-489.338] (-489.987) (-488.091) (-489.311) -- 0:00:13
770000 -- (-491.341) (-489.776) [-491.244] (-489.464) * (-490.704) (-490.292) [-488.130] (-496.828) -- 0:00:13
Average standard deviation of split frequencies: 0.006525
770500 -- [-489.748] (-494.944) (-489.344) (-489.192) * [-493.280] (-487.918) (-489.226) (-495.881) -- 0:00:13
771000 -- (-491.237) [-490.362] (-491.116) (-489.060) * (-488.363) (-491.888) (-491.411) [-491.214] -- 0:00:13
771500 -- (-490.710) (-491.575) [-490.627] (-487.904) * (-490.143) (-489.890) [-489.928] (-490.145) -- 0:00:13
772000 -- (-489.136) (-490.171) (-489.096) [-487.766] * (-491.935) (-488.808) (-489.983) [-488.854] -- 0:00:13
772500 -- [-492.230] (-487.887) (-491.756) (-489.773) * (-489.322) [-491.672] (-489.298) (-489.333) -- 0:00:13
773000 -- (-494.693) [-490.948] (-491.711) (-490.904) * (-489.862) (-488.642) [-488.111] (-488.566) -- 0:00:13
773500 -- [-493.073] (-490.832) (-492.007) (-487.970) * [-488.608] (-488.841) (-488.400) (-488.703) -- 0:00:13
774000 -- [-490.806] (-491.384) (-489.304) (-488.596) * (-492.097) (-494.416) (-488.346) [-487.773] -- 0:00:13
774500 -- (-488.026) (-490.490) (-487.954) [-488.866] * (-488.433) [-491.242] (-488.497) (-492.181) -- 0:00:13
775000 -- (-489.131) [-491.594] (-488.110) (-492.559) * (-490.493) [-489.164] (-488.573) (-491.107) -- 0:00:13
Average standard deviation of split frequencies: 0.006561
775500 -- [-490.224] (-492.471) (-487.668) (-490.455) * (-489.466) [-490.581] (-487.722) (-489.320) -- 0:00:13
776000 -- (-492.109) [-489.041] (-489.830) (-488.472) * (-488.815) (-491.884) (-493.303) [-489.186] -- 0:00:13
776500 -- (-488.929) [-489.024] (-491.133) (-488.472) * (-490.847) (-491.273) [-491.208] (-491.003) -- 0:00:13
777000 -- (-490.882) [-489.758] (-493.357) (-487.780) * [-490.122] (-492.408) (-495.636) (-492.286) -- 0:00:13
777500 -- (-489.393) (-489.441) (-489.360) [-489.169] * [-490.917] (-489.654) (-492.373) (-493.819) -- 0:00:13
778000 -- (-490.158) [-488.429] (-491.105) (-488.056) * (-489.873) [-490.602] (-489.669) (-488.172) -- 0:00:13
778500 -- [-489.113] (-489.709) (-490.026) (-488.084) * [-489.661] (-490.525) (-488.415) (-487.891) -- 0:00:13
779000 -- (-488.566) (-488.771) [-488.919] (-488.819) * [-488.524] (-491.856) (-488.521) (-487.960) -- 0:00:13
779500 -- [-492.500] (-488.188) (-489.970) (-488.556) * (-488.487) (-493.387) (-488.267) [-489.443] -- 0:00:13
780000 -- (-489.812) (-487.935) [-489.195] (-491.259) * [-488.497] (-490.598) (-490.778) (-489.461) -- 0:00:12
Average standard deviation of split frequencies: 0.006320
780500 -- (-489.462) [-488.889] (-489.691) (-492.182) * (-487.842) (-489.038) (-489.799) [-490.985] -- 0:00:12
781000 -- (-489.390) (-488.255) [-492.018] (-492.114) * (-490.689) (-489.130) [-490.115] (-490.474) -- 0:00:12
781500 -- (-488.389) (-488.108) (-490.451) [-489.730] * (-488.426) (-492.555) (-491.702) [-487.889] -- 0:00:12
782000 -- (-488.211) (-488.787) (-488.458) [-488.936] * (-489.682) (-488.600) [-487.626] (-488.916) -- 0:00:12
782500 -- (-488.265) (-489.544) (-491.509) [-490.229] * (-489.229) [-488.600] (-488.368) (-490.307) -- 0:00:12
783000 -- (-490.002) [-487.631] (-489.059) (-490.860) * (-490.522) [-499.691] (-490.161) (-491.078) -- 0:00:12
783500 -- (-489.780) [-489.132] (-490.876) (-490.430) * [-490.924] (-491.124) (-493.081) (-490.614) -- 0:00:12
784000 -- (-490.446) [-489.682] (-488.061) (-488.113) * [-493.843] (-490.046) (-497.138) (-489.399) -- 0:00:12
784500 -- (-490.017) [-489.675] (-488.055) (-488.099) * (-495.742) [-489.522] (-489.362) (-490.141) -- 0:00:12
785000 -- (-489.034) (-491.044) [-491.875] (-489.445) * (-492.038) (-488.796) (-491.533) [-488.673] -- 0:00:12
Average standard deviation of split frequencies: 0.006077
785500 -- (-490.064) (-491.000) [-490.746] (-488.989) * (-493.274) (-488.902) (-491.635) [-489.845] -- 0:00:12
786000 -- (-491.619) [-489.024] (-494.085) (-488.857) * (-490.914) (-496.126) [-491.197] (-489.019) -- 0:00:12
786500 -- [-489.166] (-489.250) (-491.596) (-488.898) * [-491.566] (-491.051) (-488.184) (-490.627) -- 0:00:12
787000 -- [-491.122] (-494.369) (-489.578) (-490.293) * (-491.105) [-490.187] (-497.946) (-490.630) -- 0:00:12
787500 -- (-489.160) [-492.409] (-487.852) (-489.849) * [-489.162] (-490.521) (-489.894) (-487.817) -- 0:00:12
788000 -- (-490.259) (-487.852) [-490.931] (-489.159) * (-489.097) [-489.435] (-489.079) (-490.627) -- 0:00:12
788500 -- (-490.984) (-487.762) (-489.985) [-490.892] * (-488.807) (-489.032) (-487.701) [-490.067] -- 0:00:12
789000 -- (-489.437) (-489.536) (-491.826) [-487.959] * (-490.977) [-492.059] (-488.989) (-489.369) -- 0:00:12
789500 -- (-487.489) [-488.824] (-489.824) (-490.018) * [-489.717] (-490.218) (-489.757) (-489.543) -- 0:00:12
790000 -- (-488.782) (-489.210) [-489.651] (-489.253) * (-490.130) (-492.290) [-490.179] (-488.969) -- 0:00:12
Average standard deviation of split frequencies: 0.006399
790500 -- (-490.305) (-488.356) (-489.775) [-488.302] * (-489.064) (-490.479) [-490.676] (-488.316) -- 0:00:12
791000 -- (-495.893) (-488.181) [-488.004] (-488.224) * (-489.018) [-489.003] (-493.463) (-488.410) -- 0:00:12
791500 -- (-497.962) (-488.052) (-488.127) [-489.000] * (-489.841) (-497.498) [-489.690] (-492.007) -- 0:00:12
792000 -- (-489.967) (-489.138) (-491.896) [-489.850] * (-490.398) [-488.104] (-491.139) (-491.551) -- 0:00:12
792500 -- [-488.854] (-491.825) (-493.200) (-490.616) * (-489.561) (-488.026) (-493.210) [-489.140] -- 0:00:12
793000 -- (-490.119) [-491.703] (-495.792) (-490.386) * (-489.075) (-488.210) (-491.535) [-491.716] -- 0:00:12
793500 -- (-489.599) [-488.992] (-491.232) (-488.573) * [-490.479] (-489.045) (-492.931) (-490.377) -- 0:00:12
794000 -- (-490.003) [-492.152] (-489.672) (-489.589) * (-487.814) (-490.742) (-488.523) [-489.732] -- 0:00:12
794500 -- (-489.397) (-492.301) (-489.673) [-488.289] * [-488.733] (-491.078) (-488.075) (-491.398) -- 0:00:12
795000 -- (-494.468) (-488.281) (-494.827) [-494.190] * (-489.794) [-488.618] (-488.746) (-493.220) -- 0:00:12
Average standard deviation of split frequencies: 0.006120
795500 -- [-489.456] (-487.852) (-487.872) (-491.529) * (-489.968) (-489.680) [-492.208] (-490.687) -- 0:00:12
796000 -- (-489.031) [-488.631] (-497.040) (-487.531) * (-487.975) [-490.244] (-492.633) (-490.751) -- 0:00:12
796500 -- (-491.123) (-489.865) (-487.885) [-487.531] * (-488.722) (-489.371) [-490.371] (-491.307) -- 0:00:12
797000 -- (-493.671) (-493.700) [-488.842] (-491.982) * (-490.926) (-489.415) [-489.800] (-490.712) -- 0:00:11
797500 -- (-490.234) [-488.867] (-487.832) (-490.770) * (-487.932) (-494.225) [-487.816] (-490.167) -- 0:00:11
798000 -- (-492.340) (-496.654) [-489.316] (-489.016) * (-490.483) (-490.721) (-491.085) [-487.785] -- 0:00:11
798500 -- (-490.172) (-490.588) (-488.242) [-489.411] * (-489.710) (-488.628) (-489.210) [-489.195] -- 0:00:11
799000 -- (-493.277) (-487.684) (-489.952) [-489.262] * [-489.707] (-490.070) (-489.681) (-487.950) -- 0:00:11
799500 -- (-491.236) (-490.918) [-489.560] (-489.357) * (-487.644) (-493.219) (-490.099) [-489.472] -- 0:00:11
800000 -- (-490.592) (-489.018) (-488.877) [-488.036] * [-488.482] (-488.371) (-488.937) (-494.976) -- 0:00:11
Average standard deviation of split frequencies: 0.006162
800500 -- (-492.734) [-488.115] (-487.740) (-489.570) * [-489.077] (-489.399) (-488.444) (-492.130) -- 0:00:11
801000 -- (-490.341) (-489.758) (-487.821) [-489.302] * (-494.705) (-489.084) (-487.650) [-488.833] -- 0:00:11
801500 -- (-489.839) (-488.828) [-488.603] (-489.347) * [-491.108] (-497.164) (-488.386) (-488.961) -- 0:00:11
802000 -- (-490.083) [-488.638] (-488.037) (-491.035) * (-494.286) [-493.902] (-488.457) (-489.664) -- 0:00:11
802500 -- (-493.752) [-488.973] (-491.277) (-488.497) * (-488.996) [-493.430] (-490.449) (-488.403) -- 0:00:11
803000 -- (-490.748) [-489.908] (-490.235) (-488.901) * (-487.634) [-491.696] (-490.674) (-488.205) -- 0:00:11
803500 -- (-487.797) [-488.328] (-490.727) (-489.356) * [-490.068] (-489.470) (-490.003) (-489.642) -- 0:00:11
804000 -- [-487.949] (-489.108) (-489.562) (-490.444) * (-489.168) (-487.804) [-491.392] (-495.560) -- 0:00:11
804500 -- (-493.574) (-489.239) [-488.080] (-490.028) * (-488.637) (-488.341) [-488.413] (-491.796) -- 0:00:11
805000 -- (-490.488) (-489.368) (-490.436) [-492.415] * (-490.093) (-492.670) (-487.541) [-489.817] -- 0:00:11
Average standard deviation of split frequencies: 0.005693
805500 -- (-491.564) (-488.945) (-492.271) [-489.953] * (-488.256) (-494.324) (-487.608) [-487.722] -- 0:00:11
806000 -- (-493.286) [-489.404] (-491.404) (-495.430) * (-492.935) [-489.703] (-488.224) (-491.598) -- 0:00:11
806500 -- (-488.972) (-493.869) (-490.615) [-489.374] * (-490.777) (-491.562) [-488.019] (-489.005) -- 0:00:11
807000 -- [-488.521] (-488.547) (-489.004) (-489.147) * (-488.640) (-490.025) [-489.651] (-488.484) -- 0:00:11
807500 -- [-487.974] (-490.687) (-495.301) (-489.782) * (-488.248) [-489.377] (-489.095) (-489.638) -- 0:00:11
808000 -- (-491.238) [-489.724] (-496.669) (-490.840) * (-488.628) (-491.104) [-489.124] (-490.512) -- 0:00:11
808500 -- [-490.366] (-488.502) (-491.592) (-489.293) * (-488.166) [-488.832] (-490.139) (-489.236) -- 0:00:11
809000 -- (-490.079) (-490.012) (-491.176) [-490.787] * (-487.768) (-491.383) [-489.023] (-490.926) -- 0:00:11
809500 -- (-490.179) (-489.049) (-489.581) [-488.444] * [-489.554] (-492.033) (-491.595) (-489.386) -- 0:00:11
810000 -- (-490.604) (-489.624) [-488.533] (-491.797) * (-493.084) (-493.023) (-496.125) [-492.142] -- 0:00:11
Average standard deviation of split frequencies: 0.005621
810500 -- (-494.213) (-488.731) [-494.196] (-490.838) * (-491.021) [-490.264] (-490.251) (-491.847) -- 0:00:11
811000 -- (-489.408) [-487.999] (-492.637) (-487.906) * (-490.383) [-489.145] (-489.262) (-491.506) -- 0:00:11
811500 -- [-489.414] (-489.832) (-489.656) (-487.859) * (-488.507) (-491.447) [-488.519] (-490.632) -- 0:00:11
812000 -- (-491.219) [-487.861] (-488.993) (-489.536) * (-490.180) [-488.965] (-490.474) (-490.385) -- 0:00:11
812500 -- (-494.212) (-488.486) [-489.857] (-489.253) * (-489.715) [-491.377] (-491.228) (-489.277) -- 0:00:11
813000 -- (-489.755) (-492.585) [-488.721] (-488.215) * (-492.515) [-492.292] (-489.168) (-489.575) -- 0:00:11
813500 -- [-489.168] (-490.063) (-488.913) (-491.358) * (-491.815) (-489.742) (-490.355) [-489.876] -- 0:00:11
814000 -- (-490.410) (-493.761) (-488.004) [-491.222] * (-492.024) (-496.502) [-489.368] (-489.056) -- 0:00:10
814500 -- (-487.801) (-490.283) (-488.019) [-488.408] * (-492.759) (-497.224) (-489.020) [-490.425] -- 0:00:10
815000 -- (-493.082) [-491.622] (-488.790) (-490.699) * (-491.435) [-489.409] (-489.242) (-492.596) -- 0:00:10
Average standard deviation of split frequencies: 0.005392
815500 -- (-488.716) (-491.735) [-488.095] (-487.629) * (-490.637) (-487.901) (-490.790) [-492.126] -- 0:00:10
816000 -- [-489.248] (-489.749) (-488.362) (-490.216) * [-489.955] (-491.238) (-490.413) (-490.686) -- 0:00:10
816500 -- (-488.423) [-489.217] (-487.946) (-488.452) * (-490.647) (-490.507) (-488.117) [-488.722] -- 0:00:10
817000 -- [-489.477] (-488.768) (-487.988) (-489.069) * (-492.412) [-489.477] (-490.735) (-489.809) -- 0:00:10
817500 -- (-488.277) (-490.180) (-491.605) [-489.169] * (-489.115) (-492.621) (-489.636) [-489.061] -- 0:00:10
818000 -- (-491.279) [-489.359] (-489.091) (-490.628) * (-491.105) (-488.804) (-490.914) [-489.583] -- 0:00:10
818500 -- [-490.644] (-489.752) (-489.522) (-493.770) * (-492.788) (-494.335) (-492.393) [-488.965] -- 0:00:10
819000 -- [-488.851] (-488.907) (-489.739) (-489.531) * (-489.970) (-488.773) [-489.630] (-490.032) -- 0:00:10
819500 -- (-489.051) (-488.578) (-489.261) [-489.113] * (-489.122) (-490.223) (-490.836) [-495.158] -- 0:00:10
820000 -- (-488.347) (-488.067) (-491.765) [-490.085] * (-488.076) [-488.807] (-487.361) (-488.684) -- 0:00:10
Average standard deviation of split frequencies: 0.005476
820500 -- (-489.684) (-489.360) [-490.476] (-494.317) * (-489.577) [-489.005] (-489.713) (-489.100) -- 0:00:10
821000 -- (-489.588) (-489.052) [-489.050] (-493.882) * (-490.638) (-488.379) [-490.355] (-491.220) -- 0:00:10
821500 -- (-490.728) [-489.667] (-489.931) (-490.283) * [-491.401] (-489.535) (-494.559) (-488.964) -- 0:00:10
822000 -- (-495.017) (-492.349) [-490.142] (-490.563) * [-490.535] (-487.951) (-493.679) (-488.176) -- 0:00:10
822500 -- [-487.846] (-489.241) (-490.914) (-490.249) * [-489.601] (-487.686) (-490.146) (-488.939) -- 0:00:10
823000 -- (-488.687) [-489.831] (-489.929) (-489.961) * [-490.715] (-488.546) (-492.311) (-488.786) -- 0:00:10
823500 -- (-489.488) [-492.045] (-488.921) (-491.618) * (-489.476) (-489.034) [-488.074] (-489.713) -- 0:00:10
824000 -- [-491.025] (-493.882) (-488.275) (-493.415) * (-488.642) [-490.802] (-488.125) (-488.031) -- 0:00:10
824500 -- (-489.001) (-490.570) (-490.553) [-490.663] * (-490.103) (-492.610) [-488.448] (-491.107) -- 0:00:10
825000 -- (-489.190) (-490.774) (-488.980) [-489.070] * [-491.079] (-491.159) (-488.124) (-490.163) -- 0:00:10
Average standard deviation of split frequencies: 0.005593
825500 -- (-489.690) (-490.571) (-491.334) [-488.531] * (-489.423) (-490.622) (-488.493) [-488.023] -- 0:00:10
826000 -- (-489.797) (-490.556) (-491.091) [-489.875] * (-490.873) [-489.334] (-494.743) (-489.283) -- 0:00:10
826500 -- (-488.684) (-489.139) (-488.061) [-489.207] * (-492.774) [-488.692] (-488.612) (-492.673) -- 0:00:10
827000 -- [-488.816] (-489.924) (-493.606) (-489.309) * (-492.104) (-489.395) [-489.093] (-490.173) -- 0:00:10
827500 -- [-488.079] (-490.505) (-491.879) (-490.169) * [-492.425] (-488.221) (-491.199) (-488.362) -- 0:00:10
828000 -- (-494.805) (-491.555) (-489.504) [-489.991] * [-488.675] (-487.528) (-493.748) (-487.973) -- 0:00:10
828500 -- (-492.854) (-491.598) (-489.570) [-489.557] * (-488.576) (-488.569) (-490.807) [-489.141] -- 0:00:10
829000 -- [-490.091] (-493.678) (-489.035) (-490.827) * (-489.367) (-487.648) (-492.583) [-488.760] -- 0:00:10
829500 -- (-488.535) (-490.708) (-490.919) [-490.677] * (-488.855) [-487.658] (-491.346) (-489.226) -- 0:00:10
830000 -- (-490.023) (-487.689) (-493.175) [-488.984] * (-490.425) (-493.088) [-487.867] (-493.693) -- 0:00:10
Average standard deviation of split frequencies: 0.005221
830500 -- (-492.498) (-487.740) [-491.656] (-488.280) * (-492.545) (-493.886) [-487.848] (-489.601) -- 0:00:10
831000 -- (-490.005) [-489.932] (-489.850) (-489.965) * [-491.522] (-490.775) (-488.911) (-491.766) -- 0:00:09
831500 -- [-490.026] (-491.761) (-488.613) (-489.256) * (-490.156) (-492.141) [-492.466] (-492.721) -- 0:00:09
832000 -- [-488.957] (-489.117) (-490.626) (-488.998) * (-490.260) [-494.021] (-493.969) (-492.261) -- 0:00:09
832500 -- (-488.705) [-488.651] (-489.368) (-491.218) * [-490.668] (-488.523) (-489.051) (-493.849) -- 0:00:09
833000 -- (-491.877) (-490.098) (-492.723) [-489.083] * (-489.361) (-487.976) [-489.282] (-488.773) -- 0:00:09
833500 -- (-490.788) [-488.972] (-488.167) (-489.704) * (-491.534) (-487.773) [-487.895] (-489.682) -- 0:00:09
834000 -- (-490.891) (-488.376) (-488.345) [-488.629] * (-492.153) (-487.520) (-488.112) [-491.090] -- 0:00:09
834500 -- (-492.999) [-488.760] (-490.071) (-488.846) * (-492.153) (-488.632) (-488.123) [-492.271] -- 0:00:09
835000 -- (-490.472) (-489.029) (-489.489) [-488.300] * (-490.499) (-488.167) (-488.702) [-491.956] -- 0:00:09
Average standard deviation of split frequencies: 0.005451
835500 -- (-490.671) (-490.748) [-489.646] (-491.061) * (-488.860) [-488.161] (-492.420) (-488.719) -- 0:00:09
836000 -- (-493.260) [-490.013] (-488.525) (-491.481) * (-490.950) (-489.310) (-490.176) [-490.460] -- 0:00:09
836500 -- (-489.356) [-488.692] (-488.019) (-493.384) * (-488.755) (-492.080) [-489.671] (-491.223) -- 0:00:09
837000 -- (-489.298) (-491.001) [-488.042] (-492.333) * (-488.846) (-494.019) [-488.042] (-489.900) -- 0:00:09
837500 -- (-488.392) (-488.960) (-491.519) [-487.958] * (-489.753) (-490.408) [-490.667] (-488.893) -- 0:00:09
838000 -- (-487.844) (-490.864) [-488.434] (-494.596) * [-491.152] (-491.973) (-488.254) (-490.187) -- 0:00:09
838500 -- [-488.282] (-488.973) (-489.942) (-488.769) * (-493.544) (-488.863) (-488.305) [-491.221] -- 0:00:09
839000 -- (-490.525) (-488.996) (-489.818) [-493.697] * (-489.787) (-493.031) [-491.053] (-491.166) -- 0:00:09
839500 -- [-492.297] (-488.751) (-489.598) (-488.025) * (-488.800) [-491.479] (-488.185) (-489.236) -- 0:00:09
840000 -- (-491.773) (-489.809) [-488.565] (-490.788) * [-488.000] (-492.053) (-493.537) (-488.889) -- 0:00:09
Average standard deviation of split frequencies: 0.005495
840500 -- (-491.774) (-490.647) (-492.061) [-490.246] * (-488.591) (-489.787) (-492.060) [-489.433] -- 0:00:09
841000 -- (-491.262) (-490.180) [-489.576] (-488.736) * [-489.285] (-489.578) (-489.738) (-489.350) -- 0:00:09
841500 -- [-489.301] (-491.679) (-489.692) (-490.962) * (-490.775) [-488.963] (-490.279) (-490.104) -- 0:00:09
842000 -- [-489.114] (-489.617) (-489.681) (-489.210) * [-490.056] (-487.900) (-491.806) (-495.158) -- 0:00:09
842500 -- (-493.179) [-488.795] (-491.023) (-488.761) * (-489.982) [-488.688] (-489.012) (-492.088) -- 0:00:09
843000 -- (-490.406) (-491.133) [-490.752] (-489.652) * (-489.725) [-491.181] (-493.295) (-490.489) -- 0:00:09
843500 -- [-490.243] (-488.097) (-496.835) (-488.135) * (-492.066) [-492.001] (-493.017) (-489.718) -- 0:00:09
844000 -- [-490.011] (-487.720) (-487.801) (-488.944) * (-492.724) (-488.445) (-488.251) [-492.564] -- 0:00:09
844500 -- (-497.324) [-488.487] (-490.635) (-490.003) * [-488.524] (-489.356) (-489.847) (-494.122) -- 0:00:09
845000 -- (-491.898) (-491.905) [-488.877] (-489.486) * (-490.767) (-492.333) [-490.061] (-490.597) -- 0:00:09
Average standard deviation of split frequencies: 0.005201
845500 -- (-494.026) (-489.459) (-488.052) [-491.820] * (-489.210) [-494.713] (-488.958) (-489.279) -- 0:00:09
846000 -- (-488.471) [-488.603] (-490.057) (-489.208) * (-490.233) (-489.821) (-488.144) [-487.675] -- 0:00:09
846500 -- (-490.402) [-488.323] (-489.462) (-490.547) * (-489.957) [-488.442] (-490.676) (-490.939) -- 0:00:09
847000 -- (-490.772) (-487.645) (-489.869) [-490.820] * [-487.527] (-489.625) (-489.200) (-489.437) -- 0:00:09
847500 -- [-492.026] (-490.190) (-488.812) (-490.081) * (-487.626) [-489.628] (-494.000) (-490.645) -- 0:00:08
848000 -- (-492.474) [-489.167] (-493.802) (-492.304) * [-491.257] (-489.295) (-496.899) (-490.458) -- 0:00:08
848500 -- [-489.822] (-487.921) (-491.530) (-489.920) * (-487.849) [-488.455] (-487.875) (-494.311) -- 0:00:08
849000 -- (-493.591) [-488.417] (-491.242) (-492.393) * (-492.776) [-488.665] (-491.565) (-491.520) -- 0:00:08
849500 -- [-488.343] (-487.734) (-489.831) (-489.568) * (-491.332) (-488.980) [-488.883] (-487.816) -- 0:00:08
850000 -- (-496.626) (-489.639) [-488.228] (-495.892) * [-492.844] (-493.313) (-487.953) (-491.027) -- 0:00:08
Average standard deviation of split frequencies: 0.005209
850500 -- (-487.968) [-489.711] (-488.021) (-490.647) * (-490.653) [-489.391] (-490.943) (-488.874) -- 0:00:08
851000 -- (-490.215) (-490.630) [-488.490] (-489.060) * (-490.213) [-492.179] (-489.708) (-490.250) -- 0:00:08
851500 -- (-490.873) (-492.253) [-489.411] (-488.944) * (-489.748) (-496.749) [-488.252] (-492.125) -- 0:00:08
852000 -- (-492.168) (-496.501) (-489.006) [-489.072] * [-491.357] (-493.619) (-491.055) (-489.288) -- 0:00:08
852500 -- (-490.047) [-493.694] (-489.959) (-490.050) * (-488.660) (-491.966) [-487.907] (-492.723) -- 0:00:08
853000 -- (-488.981) (-490.255) (-488.266) [-491.728] * [-488.796] (-490.765) (-492.503) (-487.956) -- 0:00:08
853500 -- (-490.142) (-493.096) [-488.702] (-488.766) * (-491.824) (-489.500) [-491.941] (-487.488) -- 0:00:08
854000 -- (-488.451) (-489.749) [-488.573] (-491.182) * (-495.134) (-489.704) [-490.172] (-487.743) -- 0:00:08
854500 -- (-490.704) (-488.636) (-491.603) [-488.843] * (-491.330) (-489.344) (-489.969) [-489.391] -- 0:00:08
855000 -- [-490.017] (-491.997) (-488.789) (-491.823) * [-489.510] (-489.788) (-490.134) (-491.842) -- 0:00:08
Average standard deviation of split frequencies: 0.005030
855500 -- (-491.314) [-491.972] (-490.328) (-490.978) * (-487.939) (-492.423) (-488.818) [-491.323] -- 0:00:08
856000 -- (-488.170) (-490.500) [-491.200] (-488.243) * [-489.477] (-493.972) (-487.705) (-492.070) -- 0:00:08
856500 -- (-489.751) (-489.264) (-489.924) [-490.268] * (-490.108) [-488.638] (-491.017) (-488.422) -- 0:00:08
857000 -- (-490.294) [-490.926] (-487.961) (-493.105) * (-487.813) (-488.519) [-490.319] (-489.580) -- 0:00:08
857500 -- (-490.037) [-488.078] (-492.247) (-492.989) * (-488.243) (-488.053) [-490.377] (-494.272) -- 0:00:08
858000 -- [-489.270] (-488.178) (-493.598) (-490.617) * (-493.245) [-489.403] (-489.925) (-490.996) -- 0:00:08
858500 -- (-489.604) [-487.667] (-488.836) (-490.176) * (-489.713) (-490.989) [-488.981] (-489.979) -- 0:00:08
859000 -- (-491.165) (-490.610) [-488.938] (-490.428) * (-491.730) [-488.532] (-490.399) (-490.320) -- 0:00:08
859500 -- [-487.504] (-493.629) (-493.768) (-489.343) * (-490.412) (-488.173) (-490.321) [-490.008] -- 0:00:08
860000 -- (-488.805) (-489.643) (-493.468) [-487.729] * [-492.112] (-490.728) (-492.083) (-487.524) -- 0:00:08
Average standard deviation of split frequencies: 0.004710
860500 -- (-490.579) (-490.116) (-490.056) [-488.291] * [-490.279] (-488.262) (-487.642) (-487.620) -- 0:00:08
861000 -- [-490.141] (-489.801) (-489.614) (-492.494) * (-489.386) (-487.569) [-489.089] (-487.914) -- 0:00:08
861500 -- [-489.506] (-493.448) (-488.967) (-488.988) * (-489.302) (-489.970) (-488.574) [-489.144] -- 0:00:08
862000 -- (-489.481) (-491.089) (-488.276) [-488.972] * [-487.730] (-491.332) (-488.836) (-490.161) -- 0:00:08
862500 -- (-490.752) (-495.073) (-491.021) [-488.893] * (-488.531) [-493.930] (-488.258) (-488.876) -- 0:00:08
863000 -- (-488.553) (-490.220) [-488.087] (-488.574) * (-488.777) (-489.771) (-488.944) [-489.394] -- 0:00:08
863500 -- (-490.783) [-490.170] (-488.450) (-489.825) * (-492.151) [-488.811] (-488.418) (-492.045) -- 0:00:08
864000 -- (-488.311) (-490.545) [-489.533] (-490.493) * (-488.527) (-491.397) [-489.470] (-489.178) -- 0:00:08
864500 -- [-488.222] (-489.765) (-488.163) (-491.244) * [-493.605] (-490.232) (-489.208) (-488.996) -- 0:00:07
865000 -- [-488.596] (-488.740) (-488.182) (-492.887) * (-493.965) (-489.953) (-491.054) [-494.533] -- 0:00:07
Average standard deviation of split frequencies: 0.004754
865500 -- (-488.542) (-489.757) (-493.107) [-491.577] * [-493.571] (-494.131) (-488.900) (-494.269) -- 0:00:07
866000 -- (-491.259) [-490.180] (-489.681) (-488.401) * (-490.772) (-488.216) (-492.469) [-489.319] -- 0:00:07
866500 -- [-490.083] (-488.076) (-491.925) (-489.355) * (-488.540) (-487.822) [-490.610] (-490.911) -- 0:00:07
867000 -- (-491.928) [-493.502] (-489.626) (-488.795) * (-488.231) (-490.355) [-488.986] (-488.485) -- 0:00:07
867500 -- (-490.152) (-497.601) (-492.102) [-490.193] * (-489.447) [-489.119] (-489.590) (-488.311) -- 0:00:07
868000 -- [-489.790] (-489.000) (-488.527) (-490.050) * (-490.514) [-490.819] (-493.434) (-490.698) -- 0:00:07
868500 -- (-490.348) (-490.080) (-491.074) [-492.175] * (-489.236) (-488.913) (-488.324) [-489.016] -- 0:00:07
869000 -- (-493.504) (-491.547) (-488.735) [-489.448] * (-487.810) [-488.604] (-489.235) (-489.642) -- 0:00:07
869500 -- [-488.587] (-490.412) (-489.823) (-490.347) * [-490.785] (-491.406) (-488.433) (-490.359) -- 0:00:07
870000 -- [-487.643] (-491.465) (-489.182) (-488.933) * [-488.662] (-488.560) (-487.680) (-489.031) -- 0:00:07
Average standard deviation of split frequencies: 0.004765
870500 -- (-489.358) (-490.298) [-490.715] (-489.733) * (-489.463) (-489.084) (-488.369) [-487.832] -- 0:00:07
871000 -- [-489.718] (-489.699) (-490.268) (-489.200) * (-490.116) (-490.533) [-491.101] (-488.773) -- 0:00:07
871500 -- [-491.565] (-489.596) (-490.070) (-489.316) * (-491.211) (-489.345) [-492.767] (-488.432) -- 0:00:07
872000 -- [-491.410] (-489.676) (-490.181) (-489.234) * (-489.769) (-489.400) [-487.489] (-488.982) -- 0:00:07
872500 -- (-492.797) (-489.843) (-491.658) [-487.977] * (-489.855) (-489.012) [-489.304] (-489.483) -- 0:00:07
873000 -- (-493.905) (-489.256) [-489.861] (-488.572) * [-489.152] (-487.992) (-489.205) (-492.167) -- 0:00:07
873500 -- (-489.003) (-489.005) (-493.295) [-488.453] * (-492.064) [-487.621] (-488.591) (-491.415) -- 0:00:07
874000 -- (-489.250) (-488.937) [-491.287] (-488.269) * (-489.090) (-494.955) [-490.076] (-491.178) -- 0:00:07
874500 -- (-489.388) (-488.347) (-490.904) [-488.435] * [-488.165] (-488.618) (-488.538) (-489.517) -- 0:00:07
875000 -- (-489.558) (-490.429) (-489.617) [-490.557] * (-489.830) (-490.143) [-489.828] (-491.073) -- 0:00:07
Average standard deviation of split frequencies: 0.004449
875500 -- (-488.957) (-495.047) (-489.644) [-491.064] * [-488.412] (-493.248) (-495.345) (-488.960) -- 0:00:07
876000 -- (-488.963) (-488.076) [-488.654] (-497.080) * [-491.247] (-490.450) (-491.059) (-488.842) -- 0:00:07
876500 -- (-489.678) [-492.081] (-491.609) (-488.771) * (-488.850) (-493.713) (-489.958) [-488.789] -- 0:00:07
877000 -- (-488.291) (-491.115) [-494.455] (-487.907) * [-489.799] (-489.977) (-493.009) (-490.740) -- 0:00:07
877500 -- (-488.324) [-490.102] (-489.142) (-491.163) * [-492.332] (-488.425) (-490.737) (-488.314) -- 0:00:07
878000 -- [-488.945] (-492.645) (-488.908) (-489.831) * (-487.968) [-489.923] (-490.985) (-490.668) -- 0:00:07
878500 -- (-492.965) (-491.095) (-488.813) [-489.332] * (-489.363) (-489.015) (-489.613) [-489.887] -- 0:00:07
879000 -- [-490.162] (-490.105) (-488.863) (-489.682) * (-490.231) (-490.381) [-488.604] (-493.432) -- 0:00:07
879500 -- [-488.687] (-489.428) (-491.818) (-492.079) * [-490.878] (-489.784) (-493.989) (-488.884) -- 0:00:07
880000 -- (-487.811) [-494.638] (-490.748) (-488.015) * (-489.639) [-491.724] (-493.721) (-491.396) -- 0:00:07
Average standard deviation of split frequencies: 0.004425
880500 -- (-490.729) (-490.829) (-489.006) [-490.729] * (-491.498) (-489.618) (-489.735) [-488.565] -- 0:00:07
881000 -- (-492.389) (-489.744) [-489.517] (-491.249) * (-489.988) (-488.914) (-490.663) [-488.243] -- 0:00:07
881500 -- (-490.794) (-487.495) [-488.954] (-490.193) * (-489.977) (-489.911) [-489.622] (-489.666) -- 0:00:06
882000 -- (-494.974) (-489.259) [-489.218] (-489.339) * [-488.829] (-490.503) (-489.312) (-488.970) -- 0:00:06
882500 -- (-487.591) [-492.212] (-493.271) (-488.930) * (-490.154) [-490.290] (-491.140) (-487.414) -- 0:00:06
883000 -- (-488.570) (-489.464) [-490.440] (-488.858) * (-487.548) (-492.974) (-491.804) [-487.895] -- 0:00:06
883500 -- [-494.905] (-488.847) (-488.925) (-490.153) * (-488.405) (-488.782) [-492.221] (-490.965) -- 0:00:06
884000 -- (-488.083) [-490.583] (-491.062) (-489.073) * [-493.777] (-488.666) (-489.606) (-488.621) -- 0:00:06
884500 -- (-490.698) (-489.480) [-496.056] (-489.899) * (-490.323) (-490.494) (-489.062) [-489.472] -- 0:00:06
885000 -- (-489.968) [-492.080] (-496.539) (-487.817) * (-488.934) (-489.296) [-488.891] (-489.177) -- 0:00:06
Average standard deviation of split frequencies: 0.004398
885500 -- (-490.122) [-490.022] (-494.507) (-489.608) * [-491.074] (-489.789) (-488.496) (-488.436) -- 0:00:06
886000 -- (-491.209) (-488.415) [-488.905] (-491.210) * (-489.471) (-490.889) [-490.797] (-490.751) -- 0:00:06
886500 -- [-488.605] (-489.074) (-488.611) (-490.511) * (-493.212) (-487.575) [-489.988] (-490.202) -- 0:00:06
887000 -- (-488.193) [-490.455] (-487.965) (-489.760) * (-489.580) [-488.827] (-488.934) (-488.970) -- 0:00:06
887500 -- (-488.142) [-494.355] (-488.451) (-489.931) * (-488.788) (-488.157) (-489.755) [-491.136] -- 0:00:06
888000 -- [-489.580] (-489.500) (-489.273) (-490.235) * (-490.399) (-493.511) [-488.548] (-491.989) -- 0:00:06
888500 -- [-487.652] (-489.649) (-491.051) (-491.143) * (-489.955) (-492.902) (-488.678) [-494.143] -- 0:00:06
889000 -- [-487.850] (-490.841) (-491.611) (-487.737) * (-487.941) [-490.913] (-489.781) (-489.670) -- 0:00:06
889500 -- (-488.235) [-487.740] (-493.131) (-489.884) * [-489.840] (-488.039) (-488.430) (-490.854) -- 0:00:06
890000 -- (-490.368) (-489.261) [-488.279] (-489.643) * [-490.773] (-487.980) (-490.065) (-493.049) -- 0:00:06
Average standard deviation of split frequencies: 0.004411
890500 -- [-487.634] (-489.577) (-489.263) (-489.400) * [-491.217] (-490.856) (-489.286) (-495.711) -- 0:00:06
891000 -- (-489.299) (-490.818) [-488.380] (-488.331) * (-491.265) (-489.011) (-491.833) [-489.722] -- 0:00:06
891500 -- (-491.571) (-491.309) (-489.562) [-490.651] * (-490.119) (-488.860) [-488.904] (-492.485) -- 0:00:06
892000 -- (-491.236) (-488.819) [-488.765] (-494.357) * (-494.387) (-491.511) (-490.395) [-489.902] -- 0:00:06
892500 -- (-488.719) [-487.955] (-492.009) (-490.398) * (-494.457) (-489.919) [-492.136] (-490.110) -- 0:00:06
893000 -- [-490.200] (-491.720) (-489.439) (-489.864) * (-489.943) (-487.592) [-491.376] (-488.756) -- 0:00:06
893500 -- (-489.723) [-489.192] (-488.404) (-489.047) * (-490.143) (-487.729) (-491.517) [-490.281] -- 0:00:06
894000 -- (-488.796) (-495.257) [-488.813] (-489.518) * [-491.533] (-488.265) (-494.656) (-490.742) -- 0:00:06
894500 -- (-489.441) (-491.169) [-489.920] (-490.448) * (-489.636) [-492.852] (-490.106) (-491.027) -- 0:00:06
895000 -- (-488.943) [-490.664] (-495.044) (-488.773) * (-488.269) (-489.280) [-488.862] (-492.026) -- 0:00:06
Average standard deviation of split frequencies: 0.004840
895500 -- (-492.947) [-489.870] (-490.024) (-492.778) * (-488.241) (-488.761) [-489.666] (-492.245) -- 0:00:06
896000 -- (-489.222) [-489.824] (-488.697) (-492.459) * (-487.722) (-489.219) [-488.922] (-489.687) -- 0:00:06
896500 -- (-490.852) [-488.415] (-490.419) (-488.959) * (-489.455) (-488.949) [-490.253] (-488.153) -- 0:00:06
897000 -- (-495.468) [-488.444] (-487.689) (-489.418) * (-489.315) [-495.428] (-489.716) (-489.190) -- 0:00:06
897500 -- (-494.049) (-488.385) (-489.173) [-489.897] * (-492.716) [-494.871] (-489.522) (-489.088) -- 0:00:06
898000 -- (-489.381) (-489.403) (-488.763) [-490.559] * [-490.554] (-490.096) (-490.400) (-487.608) -- 0:00:06
898500 -- (-489.373) (-490.079) [-489.381] (-492.236) * (-494.026) (-493.286) (-489.737) [-488.223] -- 0:00:05
899000 -- (-490.878) [-493.311] (-491.008) (-488.838) * (-498.381) (-489.942) [-488.012] (-490.865) -- 0:00:05
899500 -- (-488.532) (-493.785) [-489.422] (-490.854) * [-489.026] (-488.056) (-488.079) (-488.344) -- 0:00:05
900000 -- [-488.397] (-488.129) (-488.985) (-490.632) * (-488.389) (-488.350) [-489.531] (-489.621) -- 0:00:05
Average standard deviation of split frequencies: 0.004955
900500 -- [-490.489] (-488.214) (-489.238) (-490.831) * (-488.485) (-490.047) (-492.878) [-489.587] -- 0:00:05
901000 -- (-488.370) (-493.997) [-488.282] (-489.022) * [-488.566] (-492.887) (-487.858) (-488.410) -- 0:00:05
901500 -- (-489.250) (-490.082) [-490.122] (-488.499) * (-488.675) [-490.826] (-489.869) (-488.628) -- 0:00:05
902000 -- (-493.087) (-489.934) [-489.801] (-492.849) * (-490.978) (-493.950) [-490.447] (-489.249) -- 0:00:05
902500 -- [-490.231] (-490.100) (-491.133) (-489.548) * (-491.740) (-495.805) (-489.348) [-491.152] -- 0:00:05
903000 -- (-490.168) (-489.512) (-491.686) [-489.974] * (-491.495) [-492.043] (-489.072) (-489.796) -- 0:00:05
903500 -- [-488.199] (-489.435) (-491.231) (-489.426) * (-491.160) (-490.179) (-488.647) [-488.004] -- 0:00:05
904000 -- (-489.522) [-489.739] (-489.500) (-491.417) * (-492.306) (-492.311) [-489.975] (-487.972) -- 0:00:05
904500 -- (-490.011) (-488.739) (-488.826) [-490.019] * (-490.014) (-492.635) [-489.465] (-487.419) -- 0:00:05
905000 -- [-488.999] (-488.488) (-491.435) (-489.201) * (-490.194) (-490.058) (-490.116) [-487.943] -- 0:00:05
Average standard deviation of split frequencies: 0.004995
905500 -- (-491.519) (-490.426) (-491.573) [-489.884] * (-493.444) [-488.056] (-487.942) (-493.829) -- 0:00:05
906000 -- (-489.426) (-488.109) (-490.627) [-487.936] * [-491.026] (-488.868) (-490.696) (-488.081) -- 0:00:05
906500 -- (-488.988) (-489.666) (-490.702) [-488.059] * (-491.922) [-488.545] (-490.889) (-488.493) -- 0:00:05
907000 -- [-488.988] (-488.838) (-490.075) (-488.439) * (-490.682) [-488.491] (-491.110) (-489.728) -- 0:00:05
907500 -- (-489.863) [-489.182] (-488.640) (-488.224) * (-493.235) [-489.408] (-489.800) (-489.377) -- 0:00:05
908000 -- (-491.971) (-487.951) (-489.619) [-488.259] * (-491.166) (-494.648) (-488.470) [-490.850] -- 0:00:05
908500 -- (-489.556) (-495.879) (-489.431) [-489.881] * [-491.076] (-488.104) (-490.233) (-492.480) -- 0:00:05
909000 -- (-489.019) (-489.285) (-490.302) [-488.720] * (-493.275) (-489.845) (-489.872) [-489.779] -- 0:00:05
909500 -- (-488.797) (-489.356) (-488.191) [-489.045] * (-491.886) [-488.701] (-489.548) (-490.785) -- 0:00:05
910000 -- [-490.804] (-491.507) (-488.973) (-489.898) * (-489.115) (-488.100) (-488.852) [-492.840] -- 0:00:05
Average standard deviation of split frequencies: 0.005142
910500 -- (-491.780) [-488.697] (-489.715) (-489.645) * (-488.655) [-489.780] (-488.445) (-494.666) -- 0:00:05
911000 -- (-491.134) (-488.509) (-490.375) [-487.919] * (-489.944) [-489.078] (-489.510) (-490.422) -- 0:00:05
911500 -- (-490.669) (-488.135) [-489.319] (-488.680) * (-492.094) (-496.787) (-488.265) [-488.265] -- 0:00:05
912000 -- [-491.669] (-489.994) (-493.068) (-491.381) * [-490.250] (-490.171) (-488.265) (-489.455) -- 0:00:05
912500 -- (-490.951) (-491.122) (-495.843) [-488.662] * (-491.044) (-489.630) [-494.273] (-492.107) -- 0:00:05
913000 -- [-493.791] (-489.411) (-491.701) (-493.800) * (-492.790) [-489.911] (-492.789) (-494.161) -- 0:00:05
913500 -- [-489.081] (-488.484) (-492.815) (-492.127) * (-490.725) (-489.512) (-493.107) [-489.939] -- 0:00:05
914000 -- (-488.013) [-490.113] (-489.807) (-488.991) * [-489.686] (-492.940) (-489.712) (-490.348) -- 0:00:05
914500 -- [-490.478] (-488.051) (-487.963) (-492.698) * (-491.045) (-492.330) (-488.727) [-488.083] -- 0:00:05
915000 -- (-489.415) (-488.863) [-490.724] (-487.853) * [-488.693] (-492.338) (-489.764) (-490.006) -- 0:00:05
Average standard deviation of split frequencies: 0.005043
915500 -- (-490.338) (-488.660) [-488.400] (-490.315) * (-489.064) (-491.943) (-490.051) [-490.398] -- 0:00:04
916000 -- (-489.320) (-488.167) (-488.282) [-488.682] * (-489.233) [-488.205] (-490.873) (-489.971) -- 0:00:04
916500 -- (-489.490) (-489.220) [-487.998] (-490.789) * (-492.358) [-488.688] (-490.790) (-490.459) -- 0:00:04
917000 -- (-491.101) (-489.265) (-488.735) [-488.982] * (-489.974) (-490.157) (-490.508) [-487.594] -- 0:00:04
917500 -- (-489.768) [-490.058] (-489.579) (-491.108) * (-490.523) (-489.595) (-489.224) [-488.095] -- 0:00:04
918000 -- [-488.309] (-488.825) (-493.915) (-489.164) * (-492.233) (-489.870) [-488.425] (-488.603) -- 0:00:04
918500 -- (-494.756) [-493.131] (-488.654) (-488.000) * (-491.032) (-488.621) [-489.894] (-490.724) -- 0:00:04
919000 -- [-490.704] (-488.344) (-490.982) (-487.644) * (-493.609) (-490.812) [-490.651] (-494.513) -- 0:00:04
919500 -- (-489.726) (-490.163) [-490.940] (-488.905) * (-492.254) (-489.112) [-494.380] (-490.347) -- 0:00:04
920000 -- [-488.747] (-489.098) (-489.760) (-488.078) * (-490.605) (-490.341) (-490.084) [-488.239] -- 0:00:04
Average standard deviation of split frequencies: 0.004711
920500 -- [-492.222] (-491.938) (-491.170) (-488.792) * (-493.662) (-488.402) (-489.646) [-489.395] -- 0:00:04
921000 -- [-493.558] (-490.037) (-496.042) (-490.409) * [-490.124] (-488.865) (-490.388) (-490.103) -- 0:00:04
921500 -- (-487.986) [-488.594] (-492.767) (-490.875) * (-489.623) (-490.353) [-488.793] (-491.486) -- 0:00:04
922000 -- [-491.908] (-488.988) (-488.814) (-490.819) * (-489.558) (-490.756) [-490.460] (-489.067) -- 0:00:04
922500 -- [-488.391] (-489.542) (-490.800) (-490.213) * [-493.127] (-489.840) (-489.344) (-489.000) -- 0:00:04
923000 -- (-490.902) [-488.519] (-493.352) (-492.317) * [-489.678] (-490.270) (-489.427) (-488.670) -- 0:00:04
923500 -- (-489.728) (-490.535) (-494.981) [-489.037] * [-489.085] (-489.300) (-495.474) (-490.678) -- 0:00:04
924000 -- (-492.340) (-489.769) (-491.953) [-489.525] * [-488.961] (-488.509) (-489.628) (-488.031) -- 0:00:04
924500 -- (-489.327) (-489.794) [-488.632] (-497.412) * (-493.171) (-489.786) (-489.326) [-488.891] -- 0:00:04
925000 -- (-489.521) [-490.381] (-489.754) (-493.279) * [-488.731] (-492.481) (-488.479) (-488.463) -- 0:00:04
Average standard deviation of split frequencies: 0.004446
925500 -- (-488.799) [-488.418] (-488.594) (-497.329) * (-488.584) [-487.517] (-493.035) (-488.171) -- 0:00:04
926000 -- (-487.837) [-487.685] (-488.400) (-489.509) * (-491.110) (-487.554) (-488.777) [-488.224] -- 0:00:04
926500 -- (-489.028) (-487.874) (-488.845) [-487.553] * (-497.464) [-488.808] (-488.023) (-489.830) -- 0:00:04
927000 -- (-493.355) (-489.028) (-489.059) [-489.189] * (-492.899) [-491.442] (-489.272) (-489.093) -- 0:00:04
927500 -- [-489.662] (-488.221) (-488.655) (-490.612) * [-490.384] (-492.266) (-490.799) (-491.477) -- 0:00:04
928000 -- (-489.788) (-488.496) (-488.341) [-490.297] * [-489.076] (-489.289) (-487.835) (-489.908) -- 0:00:04
928500 -- (-489.185) (-490.645) [-488.348] (-490.514) * (-490.644) (-488.269) (-489.011) [-491.031] -- 0:00:04
929000 -- (-488.195) [-491.253] (-489.472) (-490.576) * [-489.532] (-491.475) (-498.483) (-489.147) -- 0:00:04
929500 -- [-487.824] (-490.765) (-487.584) (-490.866) * (-489.582) (-492.673) (-490.638) [-492.781] -- 0:00:04
930000 -- (-487.510) (-490.345) [-489.331] (-491.480) * (-489.366) [-491.284] (-492.531) (-488.884) -- 0:00:04
Average standard deviation of split frequencies: 0.004491
930500 -- (-487.671) [-489.386] (-492.201) (-493.344) * (-490.143) [-489.411] (-488.482) (-488.796) -- 0:00:04
931000 -- [-487.862] (-491.645) (-488.463) (-491.047) * [-489.004] (-488.533) (-488.866) (-487.832) -- 0:00:04
931500 -- (-489.359) (-496.479) [-488.170] (-492.015) * [-489.624] (-488.135) (-490.425) (-492.111) -- 0:00:04
932000 -- [-489.147] (-490.872) (-488.903) (-490.946) * [-489.373] (-489.146) (-490.577) (-489.814) -- 0:00:04
932500 -- [-491.002] (-492.074) (-493.194) (-487.930) * (-488.850) (-491.341) [-488.693] (-493.786) -- 0:00:03
933000 -- (-489.167) (-489.356) (-491.169) [-490.367] * (-492.523) [-490.124] (-494.259) (-490.427) -- 0:00:03
933500 -- (-489.166) [-488.408] (-489.046) (-489.138) * (-489.181) (-488.245) (-490.374) [-489.755] -- 0:00:03
934000 -- (-490.056) (-489.022) (-488.340) [-489.895] * (-489.662) (-489.878) [-490.719] (-489.569) -- 0:00:03
934500 -- [-489.623] (-490.186) (-489.353) (-488.950) * (-489.269) (-490.210) [-491.644] (-489.642) -- 0:00:03
935000 -- (-492.393) [-489.309] (-492.954) (-494.936) * (-489.426) [-491.027] (-489.025) (-490.561) -- 0:00:03
Average standard deviation of split frequencies: 0.004566
935500 -- (-488.530) [-488.913] (-491.722) (-488.918) * (-490.147) (-489.250) (-490.284) [-493.135] -- 0:00:03
936000 -- (-489.485) (-488.143) (-492.080) [-488.793] * (-488.192) (-488.821) [-490.953] (-488.492) -- 0:00:03
936500 -- (-488.295) [-489.347] (-493.078) (-493.825) * (-488.190) [-489.182] (-490.884) (-488.663) -- 0:00:03
937000 -- (-491.517) (-490.619) [-495.365] (-490.506) * (-490.065) (-487.744) (-488.185) [-489.450] -- 0:00:03
937500 -- (-492.255) (-490.882) (-492.734) [-490.385] * [-488.306] (-489.316) (-488.122) (-488.007) -- 0:00:03
938000 -- [-489.669] (-489.516) (-491.886) (-490.861) * (-489.869) (-490.217) [-489.636] (-490.359) -- 0:00:03
938500 -- (-488.821) (-488.807) [-489.570] (-488.771) * (-489.812) (-489.986) [-490.545] (-489.946) -- 0:00:03
939000 -- [-490.202] (-495.802) (-490.752) (-488.840) * (-490.026) (-488.494) [-490.028] (-494.414) -- 0:00:03
939500 -- (-488.635) (-495.228) (-487.631) [-489.512] * (-490.976) (-489.497) (-488.985) [-491.672] -- 0:00:03
940000 -- [-489.981] (-489.431) (-489.483) (-491.302) * (-494.695) (-489.880) (-492.975) [-491.847] -- 0:00:03
Average standard deviation of split frequencies: 0.004577
940500 -- (-490.957) (-488.084) (-489.485) [-490.335] * (-489.232) (-488.049) [-492.997] (-490.839) -- 0:00:03
941000 -- (-490.172) [-489.102] (-488.736) (-488.261) * (-488.740) [-488.294] (-493.835) (-492.176) -- 0:00:03
941500 -- [-488.566] (-488.740) (-491.713) (-491.251) * (-489.329) (-492.318) (-492.357) [-492.162] -- 0:00:03
942000 -- (-491.690) (-490.623) [-493.976] (-498.700) * (-489.659) [-487.984] (-491.587) (-491.708) -- 0:00:03
942500 -- (-491.623) (-491.866) [-489.700] (-490.983) * (-491.531) [-487.671] (-492.064) (-488.222) -- 0:00:03
943000 -- [-489.272] (-495.651) (-489.579) (-490.098) * (-489.667) [-487.981] (-489.636) (-493.390) -- 0:00:03
943500 -- [-487.696] (-488.976) (-490.572) (-489.162) * (-487.730) (-487.928) [-489.279] (-488.480) -- 0:00:03
944000 -- [-488.038] (-487.931) (-491.021) (-488.863) * [-487.675] (-489.157) (-489.457) (-488.514) -- 0:00:03
944500 -- [-488.162] (-489.190) (-494.597) (-488.895) * (-490.740) (-491.254) (-490.041) [-487.851] -- 0:00:03
945000 -- (-487.862) (-487.970) (-489.870) [-489.530] * (-488.787) [-490.030] (-491.862) (-494.378) -- 0:00:03
Average standard deviation of split frequencies: 0.004950
945500 -- [-488.687] (-487.903) (-489.675) (-487.701) * (-488.150) (-489.114) [-488.490] (-494.334) -- 0:00:03
946000 -- [-489.718] (-493.692) (-488.380) (-489.631) * (-490.320) (-488.037) (-487.963) [-487.745] -- 0:00:03
946500 -- (-490.540) (-491.169) [-488.472] (-493.003) * (-490.609) (-487.945) [-489.778] (-487.747) -- 0:00:03
947000 -- (-489.606) [-489.895] (-489.889) (-496.099) * (-490.845) [-489.949] (-488.542) (-489.132) -- 0:00:03
947500 -- [-490.373] (-490.022) (-489.146) (-492.940) * (-492.333) [-490.175] (-488.584) (-491.934) -- 0:00:03
948000 -- (-492.225) [-489.790] (-489.795) (-490.139) * (-487.967) (-493.623) [-488.622] (-488.809) -- 0:00:03
948500 -- (-488.791) [-488.730] (-489.295) (-487.827) * (-488.564) (-490.961) [-489.055] (-489.293) -- 0:00:03
949000 -- [-490.196] (-488.894) (-488.756) (-488.001) * (-487.802) [-491.754] (-490.773) (-489.940) -- 0:00:03
949500 -- (-490.508) [-488.173] (-489.020) (-488.502) * (-487.742) [-488.338] (-494.167) (-493.623) -- 0:00:02
950000 -- (-494.625) (-488.691) [-492.433] (-492.772) * [-489.441] (-487.658) (-491.469) (-490.019) -- 0:00:02
Average standard deviation of split frequencies: 0.004298
950500 -- (-489.162) (-489.373) [-489.419] (-493.498) * (-493.330) [-492.870] (-488.841) (-488.363) -- 0:00:02
951000 -- [-489.543] (-490.146) (-489.940) (-489.124) * (-489.339) (-488.147) [-488.488] (-490.877) -- 0:00:02
951500 -- (-489.947) [-488.594] (-492.267) (-489.962) * (-490.307) (-489.844) (-489.629) [-490.442] -- 0:00:02
952000 -- (-488.711) [-488.544] (-494.223) (-487.512) * (-490.129) [-488.620] (-487.619) (-490.003) -- 0:00:02
952500 -- (-491.496) (-489.403) (-490.142) [-489.054] * (-490.066) (-490.427) [-487.840] (-489.930) -- 0:00:02
953000 -- [-488.797] (-488.454) (-491.420) (-491.098) * (-492.878) (-498.177) [-492.899] (-488.380) -- 0:00:02
953500 -- (-488.047) (-488.651) (-491.757) [-488.935] * [-490.266] (-490.899) (-491.281) (-491.546) -- 0:00:02
954000 -- (-488.532) (-487.757) [-492.155] (-487.377) * [-488.236] (-489.136) (-492.786) (-492.051) -- 0:00:02
954500 -- (-488.860) [-487.652] (-490.991) (-490.041) * (-492.803) (-490.893) (-490.523) [-490.524] -- 0:00:02
955000 -- [-492.200] (-489.371) (-489.221) (-492.686) * [-488.512] (-493.707) (-490.466) (-488.878) -- 0:00:02
Average standard deviation of split frequencies: 0.004504
955500 -- (-489.792) (-489.375) [-489.041] (-495.454) * (-489.191) (-490.102) (-489.616) [-488.742] -- 0:00:02
956000 -- (-488.974) [-491.485] (-489.983) (-491.780) * [-490.322] (-488.126) (-488.617) (-488.742) -- 0:00:02
956500 -- (-489.135) (-489.294) (-489.487) [-491.194] * (-489.811) (-488.111) [-489.741] (-490.102) -- 0:00:02
957000 -- (-492.677) (-488.992) (-491.815) [-490.614] * [-487.959] (-490.725) (-491.592) (-491.748) -- 0:00:02
957500 -- [-488.306] (-492.596) (-489.803) (-491.911) * (-488.108) [-490.576] (-489.889) (-488.656) -- 0:00:02
958000 -- [-490.349] (-488.445) (-490.056) (-492.163) * [-489.128] (-491.578) (-489.319) (-494.183) -- 0:00:02
958500 -- (-490.859) (-490.134) [-491.601] (-489.776) * [-489.528] (-492.708) (-492.702) (-498.662) -- 0:00:02
959000 -- (-490.403) (-489.627) [-488.541] (-490.780) * (-487.850) (-488.347) [-493.218] (-492.065) -- 0:00:02
959500 -- (-492.007) (-490.972) (-488.508) [-488.886] * [-488.910] (-489.184) (-488.749) (-488.090) -- 0:00:02
960000 -- (-490.134) [-488.783] (-490.649) (-490.097) * [-489.326] (-492.712) (-489.729) (-489.206) -- 0:00:02
Average standard deviation of split frequencies: 0.004449
960500 -- [-487.698] (-489.920) (-493.109) (-489.665) * (-492.577) (-489.789) [-494.744] (-488.064) -- 0:00:02
961000 -- [-487.981] (-491.018) (-490.062) (-493.370) * [-492.486] (-492.670) (-494.370) (-487.801) -- 0:00:02
961500 -- [-487.930] (-489.096) (-489.544) (-494.868) * (-492.201) (-490.848) (-488.199) [-490.390] -- 0:00:02
962000 -- (-488.875) (-491.556) [-490.478] (-487.953) * [-488.244] (-501.326) (-489.407) (-489.268) -- 0:00:02
962500 -- [-488.436] (-488.843) (-490.619) (-488.608) * (-488.370) (-492.492) [-489.083] (-488.236) -- 0:00:02
963000 -- (-490.250) (-494.268) [-488.592] (-491.598) * (-489.153) [-488.566] (-492.917) (-488.878) -- 0:00:02
963500 -- (-490.950) (-489.287) (-488.101) [-491.176] * (-488.080) [-493.395] (-489.545) (-488.903) -- 0:00:02
964000 -- [-489.379] (-490.075) (-489.078) (-491.731) * (-492.630) [-488.655] (-489.588) (-492.666) -- 0:00:02
964500 -- (-489.612) (-489.565) [-488.660] (-491.578) * (-489.122) [-487.626] (-488.064) (-491.290) -- 0:00:02
965000 -- [-489.136] (-492.619) (-489.801) (-492.746) * (-488.973) (-489.616) [-488.339] (-491.053) -- 0:00:02
Average standard deviation of split frequencies: 0.004425
965500 -- (-492.872) (-487.921) [-489.268] (-494.259) * [-487.882] (-489.563) (-487.859) (-489.213) -- 0:00:02
966000 -- [-491.685] (-489.846) (-489.060) (-491.913) * (-488.277) [-490.942] (-487.631) (-489.436) -- 0:00:02
966500 -- (-490.165) (-490.287) (-491.460) [-488.941] * (-488.089) (-490.579) (-488.760) [-488.986] -- 0:00:01
967000 -- [-488.608] (-492.945) (-491.763) (-491.277) * (-489.307) (-487.586) (-490.047) [-489.786] -- 0:00:01
967500 -- (-495.120) [-488.546] (-491.854) (-488.952) * [-490.187] (-490.890) (-488.228) (-489.560) -- 0:00:01
968000 -- (-488.252) [-493.724] (-488.256) (-490.155) * (-492.196) [-488.802] (-493.809) (-488.981) -- 0:00:01
968500 -- (-490.790) [-491.377] (-489.011) (-489.590) * (-489.334) (-490.976) [-489.620] (-488.257) -- 0:00:01
969000 -- [-489.896] (-489.593) (-488.556) (-488.556) * (-489.172) [-490.740] (-488.260) (-487.921) -- 0:00:01
969500 -- (-490.681) [-489.153] (-489.924) (-488.641) * (-491.568) [-489.353] (-488.432) (-490.367) -- 0:00:01
970000 -- (-488.680) (-489.526) [-487.808] (-491.321) * (-490.079) [-490.442] (-490.288) (-490.150) -- 0:00:01
Average standard deviation of split frequencies: 0.004241
970500 -- [-487.831] (-489.752) (-490.009) (-494.538) * (-490.635) (-488.060) (-488.780) [-490.834] -- 0:00:01
971000 -- (-488.341) (-492.296) (-490.668) [-489.040] * (-487.741) [-492.551] (-488.285) (-489.344) -- 0:00:01
971500 -- (-489.983) [-492.021] (-489.914) (-490.722) * (-488.739) (-491.429) [-492.171] (-492.519) -- 0:00:01
972000 -- [-489.364] (-494.174) (-489.222) (-490.028) * (-488.721) (-487.556) (-489.886) [-489.057] -- 0:00:01
972500 -- (-487.615) (-494.012) [-489.720] (-488.049) * (-489.971) (-487.819) [-488.529] (-488.661) -- 0:00:01
973000 -- (-488.285) (-492.003) (-488.544) [-488.187] * (-491.001) [-487.701] (-491.087) (-488.737) -- 0:00:01
973500 -- (-489.085) (-489.135) [-490.325] (-488.243) * (-488.823) (-489.920) [-489.110] (-487.593) -- 0:00:01
974000 -- (-490.821) (-491.930) [-487.875] (-489.891) * (-488.778) (-492.134) (-489.871) [-494.143] -- 0:00:01
974500 -- [-492.171] (-489.432) (-491.546) (-489.919) * (-490.014) [-489.375] (-493.506) (-489.034) -- 0:00:01
975000 -- [-491.422] (-488.243) (-492.596) (-488.341) * (-490.140) (-490.083) (-491.787) [-489.512] -- 0:00:01
Average standard deviation of split frequencies: 0.004057
975500 -- (-490.792) [-488.981] (-490.700) (-487.747) * [-491.097] (-490.556) (-488.135) (-489.194) -- 0:00:01
976000 -- (-495.652) (-488.637) (-489.479) [-488.541] * (-489.138) (-488.033) [-490.043] (-487.989) -- 0:00:01
976500 -- (-495.947) (-492.613) [-488.920] (-489.821) * [-488.864] (-488.817) (-491.534) (-488.044) -- 0:00:01
977000 -- (-488.872) (-488.598) [-489.027] (-490.708) * (-488.802) (-488.553) (-491.228) [-489.592] -- 0:00:01
977500 -- (-490.146) (-488.964) (-488.623) [-489.158] * (-491.031) (-492.146) [-487.798] (-491.365) -- 0:00:01
978000 -- (-488.961) [-488.397] (-488.629) (-491.059) * (-490.501) [-490.196] (-489.370) (-488.669) -- 0:00:01
978500 -- (-489.234) [-488.580] (-491.052) (-489.536) * (-490.538) [-490.110] (-489.219) (-494.799) -- 0:00:01
979000 -- [-488.307] (-491.870) (-489.134) (-487.716) * (-488.453) (-491.978) (-490.771) [-487.978] -- 0:00:01
979500 -- (-492.375) (-494.589) (-487.668) [-489.051] * (-491.030) (-488.947) [-489.075] (-492.152) -- 0:00:01
980000 -- (-490.119) (-491.980) [-490.869] (-487.706) * (-490.976) (-489.114) [-491.756] (-488.788) -- 0:00:01
Average standard deviation of split frequencies: 0.003878
980500 -- (-492.143) (-492.212) (-497.574) [-489.840] * (-489.174) [-492.093] (-488.097) (-489.467) -- 0:00:01
981000 -- (-488.734) [-491.543] (-491.719) (-490.673) * (-491.646) (-489.365) [-492.536] (-492.338) -- 0:00:01
981500 -- (-489.066) [-490.830] (-488.520) (-491.347) * [-488.644] (-489.698) (-492.471) (-489.533) -- 0:00:01
982000 -- [-489.544] (-490.939) (-488.924) (-489.898) * (-491.872) (-490.381) (-492.219) [-491.034] -- 0:00:01
982500 -- [-490.713] (-489.482) (-488.981) (-490.992) * (-490.730) (-490.339) (-492.612) [-489.869] -- 0:00:01
983000 -- (-488.439) (-489.413) (-493.203) [-488.647] * (-491.105) (-488.446) (-488.964) [-490.747] -- 0:00:01
983500 -- (-491.188) (-488.522) [-489.648] (-490.798) * (-488.657) (-490.318) [-492.906] (-488.181) -- 0:00:00
984000 -- (-490.640) (-489.536) (-491.827) [-489.430] * (-488.194) [-489.332] (-488.862) (-492.005) -- 0:00:00
984500 -- (-488.956) (-489.982) [-489.280] (-490.313) * (-491.864) (-490.304) [-487.877] (-490.177) -- 0:00:00
985000 -- (-492.924) (-493.789) [-489.926] (-488.498) * (-489.719) (-489.704) [-488.879] (-490.432) -- 0:00:00
Average standard deviation of split frequencies: 0.003920
985500 -- (-494.006) (-491.346) (-489.290) [-488.788] * (-490.146) [-489.683] (-488.516) (-492.987) -- 0:00:00
986000 -- (-488.292) (-488.241) [-489.875] (-490.446) * (-489.857) (-489.226) [-490.468] (-491.232) -- 0:00:00
986500 -- (-489.040) [-488.257] (-492.054) (-491.973) * (-494.963) (-490.476) [-488.062] (-489.840) -- 0:00:00
987000 -- [-489.196] (-488.341) (-490.104) (-493.927) * (-488.432) [-488.471] (-488.416) (-491.543) -- 0:00:00
987500 -- (-489.247) [-490.984] (-494.589) (-492.535) * (-490.728) [-487.643] (-488.717) (-490.690) -- 0:00:00
988000 -- (-491.546) (-488.024) [-489.293] (-489.683) * [-489.511] (-490.319) (-496.261) (-490.876) -- 0:00:00
988500 -- (-488.735) (-489.096) (-490.202) [-490.303] * (-490.085) (-491.415) (-488.190) [-493.712] -- 0:00:00
989000 -- (-487.565) [-490.316] (-489.714) (-488.942) * (-491.189) (-490.207) [-495.917] (-492.375) -- 0:00:00
989500 -- (-490.374) (-491.995) [-490.122] (-491.045) * (-487.929) (-491.131) [-491.635] (-490.911) -- 0:00:00
990000 -- [-489.901] (-491.700) (-490.802) (-490.962) * (-488.894) [-488.194] (-490.621) (-490.805) -- 0:00:00
Average standard deviation of split frequencies: 0.003648
990500 -- [-491.150] (-491.288) (-490.269) (-491.623) * (-490.829) (-490.665) (-488.153) [-492.436] -- 0:00:00
991000 -- (-493.252) (-491.240) [-487.849] (-488.064) * (-491.569) (-489.507) (-489.956) [-492.493] -- 0:00:00
991500 -- (-492.942) (-488.441) (-492.203) [-488.068] * (-491.084) (-488.227) [-490.916] (-492.113) -- 0:00:00
992000 -- [-490.424] (-490.233) (-488.531) (-488.605) * [-490.632] (-489.014) (-489.904) (-488.772) -- 0:00:00
992500 -- [-492.709] (-490.126) (-488.869) (-491.514) * [-488.045] (-492.250) (-491.598) (-491.454) -- 0:00:00
993000 -- [-489.420] (-488.552) (-490.511) (-491.916) * (-489.266) [-490.231] (-489.416) (-492.552) -- 0:00:00
993500 -- [-488.209] (-492.315) (-492.757) (-489.623) * (-488.266) (-490.636) (-490.065) [-491.782] -- 0:00:00
994000 -- (-493.868) (-492.563) [-490.032] (-489.135) * [-492.196] (-488.450) (-488.356) (-488.071) -- 0:00:00
994500 -- (-488.296) (-490.019) [-488.322] (-488.573) * [-490.037] (-488.496) (-488.471) (-490.946) -- 0:00:00
995000 -- (-488.679) (-493.249) (-489.116) [-489.797] * (-488.157) (-491.121) (-487.854) [-490.706] -- 0:00:00
Average standard deviation of split frequencies: 0.003534
995500 -- [-490.109] (-496.748) (-488.606) (-488.207) * (-496.528) [-487.751] (-488.167) (-493.426) -- 0:00:00
996000 -- [-488.262] (-491.352) (-491.548) (-490.211) * (-489.928) [-488.141] (-489.172) (-490.033) -- 0:00:00
996500 -- (-488.054) (-490.694) (-487.592) [-491.814] * (-492.208) (-489.471) [-490.473] (-492.041) -- 0:00:00
997000 -- [-487.532] (-491.272) (-488.744) (-491.558) * (-496.275) (-490.063) (-490.381) [-492.276] -- 0:00:00
997500 -- (-487.761) (-488.558) [-490.285] (-488.794) * (-495.352) [-488.704] (-488.260) (-491.836) -- 0:00:00
998000 -- (-489.184) (-489.921) (-491.012) [-488.374] * [-489.210] (-488.211) (-489.858) (-491.271) -- 0:00:00
998500 -- (-488.846) (-492.772) (-491.547) [-488.040] * [-489.319] (-490.591) (-488.138) (-488.793) -- 0:00:00
999000 -- [-487.667] (-491.865) (-490.129) (-489.890) * (-491.111) (-489.824) [-490.490] (-491.000) -- 0:00:00
999500 -- (-488.401) (-489.897) [-488.058] (-489.556) * (-492.062) (-488.374) [-490.040] (-489.717) -- 0:00:00
1000000 -- (-488.456) [-489.900] (-488.830) (-493.142) * (-491.442) (-488.529) (-488.765) [-488.388] -- 0:00:00
Average standard deviation of split frequencies: 0.003737
Analysis completed in 59 seconds
Analysis used 58.39 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -487.28
Likelihood of best state for "cold" chain of run 2 was -487.28
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 63 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.3 % ( 32 %) Dirichlet(Pi{all})
35.8 % ( 24 %) Slider(Pi{all})
78.7 % ( 47 %) Multiplier(Alpha{1,2})
77.5 % ( 50 %) Multiplier(Alpha{3})
25.4 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.5 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 70 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
35.9 % ( 32 %) Dirichlet(Pi{all})
35.2 % ( 29 %) Slider(Pi{all})
78.7 % ( 50 %) Multiplier(Alpha{1,2})
77.8 % ( 56 %) Multiplier(Alpha{3})
25.8 % ( 24 %) Slider(Pinvar{all})
98.5 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 19 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166852 0.82 0.67
3 | 166634 166571 0.84
4 | 166768 167012 166163
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166125 0.82 0.67
3 | 166367 167326 0.84
4 | 166341 167214 166627
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -489.07
| 2 1 |
| 1 1 1 1 1 |
| 1 1 2 2 1 |
| 2 1 * 2 1 1 11 1 1 * 11|
|21 2 2 2 1 1 22 2 1 11 |
| 2 12 2 2 1 * 21 2 2 1 2 1 1 22 |
| 21 * 1 2 2 2 2 1 * 2 2 1 2 2 21 22 |
|1 1 1 12 1 2 2* 1 2 2 1 |
| 1 122 1 2 2 2 2 |
| 1 1 1 2 |
| 1 2 1 212 |
| 2 1 2 2|
| 2 |
| 1 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -490.85
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -489.02 -492.21
2 -489.07 -494.44
--------------------------------------
TOTAL -489.05 -493.85
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900128 0.088853 0.350188 1.464683 0.863917 1349.44 1375.32 1.000
r(A<->C){all} 0.172074 0.021095 0.000014 0.467901 0.132118 357.67 359.77 1.001
r(A<->G){all} 0.175271 0.021052 0.000068 0.459692 0.137203 207.64 225.12 1.000
r(A<->T){all} 0.174066 0.021147 0.000056 0.460526 0.135433 155.93 231.43 1.003
r(C<->G){all} 0.171021 0.020471 0.000151 0.455174 0.136085 245.89 257.68 1.000
r(C<->T){all} 0.161538 0.018432 0.000021 0.428921 0.126245 301.88 328.38 1.002
r(G<->T){all} 0.146030 0.015709 0.000042 0.403690 0.110331 198.26 226.05 1.012
pi(A){all} 0.115912 0.000274 0.084297 0.149378 0.115745 1248.67 1374.83 1.000
pi(C){all} 0.276573 0.000526 0.232424 0.320675 0.275836 1386.36 1428.07 1.000
pi(G){all} 0.348058 0.000601 0.301757 0.397773 0.347183 1032.23 1122.93 1.000
pi(T){all} 0.259457 0.000519 0.218245 0.306431 0.258817 1367.61 1372.18 1.001
alpha{1,2} 0.413829 0.219987 0.000246 1.347485 0.248585 1158.63 1291.99 1.000
alpha{3} 0.455291 0.238589 0.000272 1.451697 0.290701 1162.86 1198.16 1.000
pinvar{all} 0.995544 0.000027 0.985214 0.999996 0.997183 1501.00 1501.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- .*..*.
9 -- ..****
10 -- .*.***
11 -- ..*.*.
12 -- ..*..*
13 -- ...**.
14 -- .***.*
15 -- ....**
16 -- ...*.*
17 -- .**...
18 -- ..**..
19 -- .*.*..
20 -- .*...*
21 -- .****.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 463 0.154231 0.001413 0.153231 0.155230 2
8 458 0.152565 0.001884 0.151233 0.153897 2
9 444 0.147901 0.003769 0.145237 0.150566 2
10 443 0.147568 0.000471 0.147235 0.147901 2
11 441 0.146902 0.005182 0.143238 0.150566 2
12 440 0.146569 0.005653 0.142572 0.150566 2
13 434 0.144570 0.000000 0.144570 0.144570 2
14 432 0.143904 0.004711 0.140573 0.147235 2
15 431 0.143571 0.002355 0.141905 0.145237 2
16 430 0.143238 0.002827 0.141239 0.145237 2
17 428 0.142572 0.005653 0.138574 0.146569 2
18 410 0.136576 0.006595 0.131912 0.141239 2
19 406 0.135243 0.002827 0.133245 0.137242 2
20 402 0.133911 0.007537 0.128581 0.139241 2
21 377 0.125583 0.005182 0.121919 0.129247 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099720 0.009978 0.000005 0.300375 0.070324 1.000 2
length{all}[2] 0.098944 0.010236 0.000064 0.307456 0.065746 1.000 2
length{all}[3] 0.098702 0.009795 0.000009 0.299147 0.066670 1.000 2
length{all}[4] 0.100764 0.010030 0.000047 0.298488 0.071176 1.000 2
length{all}[5] 0.099018 0.010236 0.000023 0.300458 0.066182 1.000 2
length{all}[6] 0.099177 0.009098 0.000061 0.289120 0.071316 1.000 2
length{all}[7] 0.094367 0.008939 0.000282 0.287977 0.067084 0.998 2
length{all}[8] 0.109937 0.011707 0.000026 0.318012 0.076834 0.998 2
length{all}[9] 0.101093 0.010651 0.000069 0.314403 0.070546 0.998 2
length{all}[10] 0.101121 0.010341 0.000094 0.302841 0.069025 0.999 2
length{all}[11] 0.091596 0.008466 0.000062 0.273369 0.065282 0.998 2
length{all}[12] 0.105646 0.010129 0.000369 0.296044 0.080672 0.998 2
length{all}[13] 0.106233 0.008791 0.000371 0.309352 0.080002 0.998 2
length{all}[14] 0.102485 0.009205 0.000013 0.296865 0.072014 0.998 2
length{all}[15] 0.103736 0.009196 0.000086 0.286235 0.076323 0.998 2
length{all}[16] 0.093846 0.008495 0.000489 0.264472 0.067380 0.998 2
length{all}[17] 0.093514 0.008345 0.001025 0.254873 0.068079 0.999 2
length{all}[18] 0.104679 0.009880 0.000368 0.282476 0.085063 0.999 2
length{all}[19] 0.096228 0.008354 0.000314 0.261429 0.073059 0.998 2
length{all}[20] 0.099621 0.010848 0.000421 0.299009 0.069567 0.998 2
length{all}[21] 0.098807 0.008935 0.000132 0.291092 0.070415 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.003737
Maximum standard deviation of split frequencies = 0.007537
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 369
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 123 / 123 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 123 / 123 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.016512 0.011598 0.048481 0.042203 0.057537 0.045939 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -500.925070
Iterating by ming2
Initial: fx= 500.925070
x= 0.01651 0.01160 0.04848 0.04220 0.05754 0.04594 0.30000 1.30000
1 h-m-p 0.0000 0.0001 296.4464 ++ 492.537960 m 0.0001 13 | 1/8
2 h-m-p 0.0010 0.0126 25.8952 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 270.9502 ++ 489.566821 m 0.0000 44 | 2/8
4 h-m-p 0.0005 0.0160 21.0346 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 242.2748 +++ 477.063779 m 0.0002 76 | 3/8
6 h-m-p 0.0029 0.0237 15.3486 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 210.7594 ++ 475.689877 m 0.0000 108 | 4/8
8 h-m-p 0.0005 0.0433 10.1216 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 172.1294 ++ 475.066025 m 0.0000 139 | 5/8
10 h-m-p 0.0004 0.0665 6.9026 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 121.6676 ++ 473.952979 m 0.0001 169 | 6/8
12 h-m-p 0.2066 8.0000 0.0000 +++ 473.952979 m 8.0000 181 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 ++ 473.952979 m 8.0000 194 | 6/8
14 h-m-p 0.0160 8.0000 0.0048 ----C 473.952979 0 0.0000 211 | 6/8
15 h-m-p 0.0160 8.0000 0.0002 +++++ 473.952979 m 8.0000 227 | 6/8
16 h-m-p 0.0059 2.9687 0.4147 ------Y 473.952979 0 0.0000 246 | 6/8
17 h-m-p 0.0193 8.0000 0.0000 Y 473.952979 0 0.0048 259 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 Y 473.952979 0 0.0160 272 | 6/8
19 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
20 h-m-p 0.0160 8.0000 0.0000 +++++ 473.952979 m 8.0000 312 | 6/8
21 h-m-p 0.0160 8.0000 0.2047 --------Y 473.952979 0 0.0000 333 | 6/8
22 h-m-p 0.0160 8.0000 0.0000 +++++ 473.952979 m 8.0000 349 | 6/8
23 h-m-p 0.0011 0.5685 0.5465 +++++ 473.952976 m 0.5685 365 | 7/8
24 h-m-p 1.6000 8.0000 0.0367 ++ 473.952975 m 8.0000 378 | 7/8
25 h-m-p 0.2938 8.0000 1.0005 --------------Y 473.952975 0 0.0000 404 | 7/8
26 h-m-p 0.1622 8.0000 0.0000 -----Y 473.952975 0 0.0000 420 | 7/8
27 h-m-p 0.1927 8.0000 0.0000 Y 473.952975 0 0.0482 432
Out..
lnL = -473.952975
433 lfun, 433 eigenQcodon, 2598 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067280 0.097078 0.075718 0.084500 0.073412 0.107462 0.000100 0.574236 0.326476
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.922839
np = 9
lnL0 = -533.069673
Iterating by ming2
Initial: fx= 533.069673
x= 0.06728 0.09708 0.07572 0.08450 0.07341 0.10746 0.00011 0.57424 0.32648
1 h-m-p 0.0000 0.0000 275.7980 ++ 532.835989 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0014 224.0239 ++++ 486.134957 m 0.0014 28 | 2/9
3 h-m-p 0.0000 0.0000 94836.4394 ++ 482.522577 m 0.0000 40 | 3/9
4 h-m-p 0.0002 0.0008 58.2211 ++ 481.009219 m 0.0008 52 | 4/9
5 h-m-p 0.0000 0.0000 73.2852 ++ 480.931262 m 0.0000 64 | 5/9
6 h-m-p 0.0000 0.0004 175.6282 +++ 474.800073 m 0.0004 77 | 6/9
7 h-m-p 0.0001 0.0003 16.8242 ++ 474.798046 m 0.0003 89 | 7/9
8 h-m-p 0.0009 0.0927 5.2591 -----------.. | 7/9
9 h-m-p 0.0000 0.0001 120.9665 ++ 473.952972 m 0.0001 122 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ---C 473.952972 0 0.0063 137 | 8/9
11 h-m-p 0.0160 8.0000 0.0000 N 473.952972 0 0.0040 150
Out..
lnL = -473.952972
151 lfun, 453 eigenQcodon, 1812 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010969 0.107311 0.086565 0.096105 0.010430 0.011742 0.000100 1.182526 0.448345 0.388555 1.209999
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.162127
np = 11
lnL0 = -512.142239
Iterating by ming2
Initial: fx= 512.142239
x= 0.01097 0.10731 0.08657 0.09611 0.01043 0.01174 0.00011 1.18253 0.44835 0.38856 1.21000
1 h-m-p 0.0000 0.0000 284.1646 ++ 511.711350 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 118.8047 +++ 504.587623 m 0.0006 31 | 2/11
3 h-m-p 0.0000 0.0000 66.2556 ++ 504.382250 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0072 52.1735 +++++ 475.687125 m 0.0072 62 | 4/11
5 h-m-p 0.0000 0.0002 49.3728 ++ 475.188560 m 0.0002 76 | 5/11
6 h-m-p 0.0000 0.0000 301.5742 ++ 474.807004 m 0.0000 90 | 6/11
7 h-m-p 0.0000 0.0000 1242.5454 ++ 474.436176 m 0.0000 104 | 7/11
8 h-m-p 0.0003 0.0015 17.0986 ++ 473.952972 m 0.0015 118 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 -----Y 473.952972 0 0.0002 137
Out..
lnL = -473.952972
138 lfun, 552 eigenQcodon, 2484 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -473.959670 S = -473.951713 -0.003043
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:02
did 20 / 47 patterns 0:02
did 30 / 47 patterns 0:02
did 40 / 47 patterns 0:02
did 47 / 47 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075761 0.037994 0.104600 0.104906 0.068261 0.109223 0.000100 0.222903 1.859004
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.789504
np = 9
lnL0 = -531.792609
Iterating by ming2
Initial: fx= 531.792609
x= 0.07576 0.03799 0.10460 0.10491 0.06826 0.10922 0.00011 0.22290 1.85900
1 h-m-p 0.0000 0.0000 270.7344 ++ 531.688473 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0599 29.0727 +++++ 520.445452 m 0.0599 29 | 2/9
3 h-m-p 0.0003 0.0016 577.5026 ++ 492.734897 m 0.0016 41 | 3/9
4 h-m-p 0.0002 0.0012 112.6228 ++ 491.699849 m 0.0012 53 | 4/9
5 h-m-p 0.0003 0.0013 250.6831 ++ 486.638527 m 0.0013 65 | 5/9
6 h-m-p 0.0001 0.0003 203.9556 ++ 484.108200 m 0.0003 77 | 6/9
7 h-m-p 0.0000 0.0006 4818.7371 +++ 477.630621 m 0.0006 90 | 7/9
8 h-m-p 0.0016 0.0081 122.0803
QuantileBeta(0.15, 0.00500, 2.14988) = 1.229352e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.74056) = 9.114367e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.93746) = 8.389020e-161 2000 rounds
+ 473.952965 m 0.0081 102
QuantileBeta(0.15, 0.00500, 2.93746) = 8.389020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93746) = 8.389020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93746) = 8.389020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93746) = 8.389020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93746) = 8.389020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93746) = 8.389020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93746) = 8.389020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93746) = 8.681878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93746) = 8.389014e-161 2000 rounds
| 8/9
9 h-m-p 1.6000 8.0000 0.3281
QuantileBeta(0.15, 0.00500, 2.41242) = 1.064569e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80620) = 8.859120e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.90464) = 8.501835e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.92925) = 8.416944e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93541) = 8.395984e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93618) = 8.393371e-161 2000 rounds
Y 473.952965 0 0.0039 117
QuantileBeta(0.15, 0.00500, 2.93618) = 8.393371e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93618) = 8.393371e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93618) = 8.393371e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93618) = 8.393371e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93618) = 8.393371e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93618) = 8.393371e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93618) = 8.393371e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93618) = 8.686381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93632) = 8.392896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93604) = 8.393847e-161 2000 rounds
| 8/9
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93615) = 8.393460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393385e-161 2000 rounds
Y 473.952965 0 1.6000 130
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.686404e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93631) = 8.392918e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93603) = 8.393869e-161 2000 rounds
| 8/9
11 h-m-p 0.5000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.93618) = 8.393371e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93620) = 8.393305e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
N 473.952965 0 0.2500 143
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.686392e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93631) = 8.392907e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93603) = 8.393858e-161 2000 rounds
| 8/9
12 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393384e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393383e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
N 473.952965 0 0.0000 165
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
Out..
lnL = -473.952965
166 lfun, 1826 eigenQcodon, 9960 P(t)
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93617) = 8.393382e-161 2000 rounds
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065342 0.105501 0.062673 0.081341 0.047568 0.075274 0.000100 0.900000 0.470909 1.412640 1.089263
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.787844
np = 11
lnL0 = -524.080435
Iterating by ming2
Initial: fx= 524.080435
x= 0.06534 0.10550 0.06267 0.08134 0.04757 0.07527 0.00011 0.90000 0.47091 1.41264 1.08926
1 h-m-p 0.0000 0.0000 265.2728 ++ 523.906151 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0037 100.3608 +++++ 492.378123 m 0.0037 33 | 2/11
3 h-m-p 0.0000 0.0000 6275.2585 ++ 483.313964 m 0.0000 47 | 3/11
4 h-m-p 0.0003 0.0014 22.2338 ++ 482.950949 m 0.0014 61 | 4/11
5 h-m-p 0.0000 0.0002 1002.3036 ++ 481.003321 m 0.0002 75 | 5/11
6 h-m-p 0.0000 0.0000 54887.3266 ++ 480.363176 m 0.0000 89 | 6/11
7 h-m-p 0.0000 0.0001 59.1078 ++ 480.258373 m 0.0001 103 | 7/11
8 h-m-p 0.0018 0.1452 4.2029 ++++ 479.999916 m 0.1452 119 | 7/11
9 h-m-p 0.1034 0.5170 2.2101 --------------.. | 7/11
10 h-m-p 0.0000 0.0004 118.1551 +++ 473.952973 m 0.0004 160 | 8/11
11 h-m-p 0.3791 1.8955 0.0000 ++ 473.952973 m 1.8955 174 | 9/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 473.952973 m 8.0000 194 | 9/11
13 h-m-p 0.0015 0.7539 0.5255 ----------N 473.952973 0 0.0000 220 | 9/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 473.952973 m 8.0000 239 | 9/11
15 h-m-p 0.0160 8.0000 0.0139 +++++ 473.952973 m 8.0000 258 | 9/11
16 h-m-p 0.0349 0.7766 3.1864 ---------Y 473.952973 0 0.0000 283 | 9/11
17 h-m-p 0.0886 8.0000 0.0000 C 473.952973 0 0.0222 297 | 9/11
18 h-m-p 0.0160 8.0000 0.0000 ---Y 473.952973 0 0.0001 316
Out..
lnL = -473.952973
317 lfun, 3804 eigenQcodon, 20922 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -473.960386 S = -473.951477 -0.003907
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:10
did 20 / 47 patterns 0:10
did 30 / 47 patterns 0:10
did 40 / 47 patterns 0:11
did 47 / 47 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=123
NC_011896_1_WP_010907641_1_283_MLBR_RS01385 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
NC_002677_1_NP_301317_1_189_ML0271 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI
**************************************************
NC_011896_1_WP_010907641_1_283_MLBR_RS01385 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
NC_002677_1_NP_301317_1_189_ML0271 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520 GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS
**************************************************
NC_011896_1_WP_010907641_1_283_MLBR_RS01385 TTAALFLGWRAVVELILRRRSTR
NC_002677_1_NP_301317_1_189_ML0271 TTAALFLGWRAVVELILRRRSTR
NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345 TTAALFLGWRAVVELILRRRSTR
NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470 TTAALFLGWRAVVELILRRRSTR
NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470 TTAALFLGWRAVVELILRRRSTR
NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520 TTAALFLGWRAVVELILRRRSTR
***********************
>NC_011896_1_WP_010907641_1_283_MLBR_RS01385 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT GAGGCGTCGCTCAACGCGT >NC_002677_1_NP_301317_1_189_ML0271 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT GAGGCGTCGCTCAACGCGT >NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT GAGGCGTCGCTCAACGCGT >NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT GAGGCGTCGCTCAACGCGT >NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT GAGGCGTCGCTCAACGCGT >NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520 ATGCGGCTGGGGCAAGCGCTGGCATGGCTAGCTACCGACATCGTCGCTGT GTCGGTGTTCTGCGCTGTCGGGCGCTGCAGTCATGCCGAAGGCCTCACCG TCGCCGACCTCGCAGTTACTTTGTGGCCGTTTCTTACCGGAACGGCTATT GGGTGGCTGGCGTCTCGCGGCTGGCAGCGGCCCACGGCTGTTGTCCCCAC CGGTGTCGTTGTCTGGTTGTGCACCGTGGTGGTCGGTGTGGCGTTGCGCA AAGCTAGCTCCGCAGGTGTGGTCGCGAATTTCATGGTGGTAGCTGCATCG ACTACCGCGGCATTGTTCCTTGGTTGGCGTGCTGTCGTTGAGCTGATCTT GAGGCGTCGCTCAACGCGT
>NC_011896_1_WP_010907641_1_283_MLBR_RS01385 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS TTAALFLGWRAVVELILRRRSTR >NC_002677_1_NP_301317_1_189_ML0271 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS TTAALFLGWRAVVELILRRRSTR >NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS TTAALFLGWRAVVELILRRRSTR >NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS TTAALFLGWRAVVELILRRRSTR >NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS TTAALFLGWRAVVELILRRRSTR >NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520 MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAI GWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAAS TTAALFLGWRAVVELILRRRSTR
#NEXUS
[ID: 0539252201]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907641_1_283_MLBR_RS01385
NC_002677_1_NP_301317_1_189_ML0271
NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345
NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470
NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470
NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907641_1_283_MLBR_RS01385,
2 NC_002677_1_NP_301317_1_189_ML0271,
3 NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345,
4 NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470,
5 NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470,
6 NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07032424,2:0.06574619,3:0.06666953,4:0.07117556,5:0.0661815,6:0.07131617);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07032424,2:0.06574619,3:0.06666953,4:0.07117556,5:0.0661815,6:0.07131617);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -489.02 -492.21
2 -489.07 -494.44
--------------------------------------
TOTAL -489.05 -493.85
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0271/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900128 0.088853 0.350188 1.464683 0.863917 1349.44 1375.32 1.000
r(A<->C){all} 0.172074 0.021095 0.000014 0.467901 0.132118 357.67 359.77 1.001
r(A<->G){all} 0.175271 0.021052 0.000068 0.459692 0.137203 207.64 225.12 1.000
r(A<->T){all} 0.174066 0.021147 0.000056 0.460526 0.135433 155.93 231.43 1.003
r(C<->G){all} 0.171021 0.020471 0.000151 0.455174 0.136085 245.89 257.68 1.000
r(C<->T){all} 0.161538 0.018432 0.000021 0.428921 0.126245 301.88 328.38 1.002
r(G<->T){all} 0.146030 0.015709 0.000042 0.403690 0.110331 198.26 226.05 1.012
pi(A){all} 0.115912 0.000274 0.084297 0.149378 0.115745 1248.67 1374.83 1.000
pi(C){all} 0.276573 0.000526 0.232424 0.320675 0.275836 1386.36 1428.07 1.000
pi(G){all} 0.348058 0.000601 0.301757 0.397773 0.347183 1032.23 1122.93 1.000
pi(T){all} 0.259457 0.000519 0.218245 0.306431 0.258817 1367.61 1372.18 1.001
alpha{1,2} 0.413829 0.219987 0.000246 1.347485 0.248585 1158.63 1291.99 1.000
alpha{3} 0.455291 0.238589 0.000272 1.451697 0.290701 1162.86 1198.16 1.000
pinvar{all} 0.995544 0.000027 0.985214 0.999996 0.997183 1501.00 1501.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0271/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 123
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 0 0 0 0 0 0 | CGC 4 4 4 4 4 4
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 4 4 4 4 4 4 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 6 6 6 6 6 6 | AAC 0 0 0 0 0 0 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 3 3 3 3 3 3 | AAG 0 0 0 0 0 0 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 8 8 8 8 8 8 | Asp GAT 0 0 0 0 0 0 | Gly GGT 4 4 4 4 4 4
GTC 9 9 9 9 9 9 | GCC 2 2 2 2 2 2 | GAC 2 2 2 2 2 2 | GGC 2 2 2 2 2 2
GTA 1 1 1 1 1 1 | GCA 5 5 5 5 5 5 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 7 7 7 7 7 7 | GCG 5 5 5 5 5 5 | GAG 1 1 1 1 1 1 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907641_1_283_MLBR_RS01385
position 1: T:0.18699 C:0.19512 A:0.17073 G:0.44715
position 2: T:0.35772 C:0.31707 A:0.07317 G:0.25203
position 3: T:0.23577 C:0.31707 A:0.09756 G:0.34959
Average T:0.26016 C:0.27642 A:0.11382 G:0.34959
#2: NC_002677_1_NP_301317_1_189_ML0271
position 1: T:0.18699 C:0.19512 A:0.17073 G:0.44715
position 2: T:0.35772 C:0.31707 A:0.07317 G:0.25203
position 3: T:0.23577 C:0.31707 A:0.09756 G:0.34959
Average T:0.26016 C:0.27642 A:0.11382 G:0.34959
#3: NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345
position 1: T:0.18699 C:0.19512 A:0.17073 G:0.44715
position 2: T:0.35772 C:0.31707 A:0.07317 G:0.25203
position 3: T:0.23577 C:0.31707 A:0.09756 G:0.34959
Average T:0.26016 C:0.27642 A:0.11382 G:0.34959
#4: NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470
position 1: T:0.18699 C:0.19512 A:0.17073 G:0.44715
position 2: T:0.35772 C:0.31707 A:0.07317 G:0.25203
position 3: T:0.23577 C:0.31707 A:0.09756 G:0.34959
Average T:0.26016 C:0.27642 A:0.11382 G:0.34959
#5: NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470
position 1: T:0.18699 C:0.19512 A:0.17073 G:0.44715
position 2: T:0.35772 C:0.31707 A:0.07317 G:0.25203
position 3: T:0.23577 C:0.31707 A:0.09756 G:0.34959
Average T:0.26016 C:0.27642 A:0.11382 G:0.34959
#6: NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520
position 1: T:0.18699 C:0.19512 A:0.17073 G:0.44715
position 2: T:0.35772 C:0.31707 A:0.07317 G:0.25203
position 3: T:0.23577 C:0.31707 A:0.09756 G:0.34959
Average T:0.26016 C:0.27642 A:0.11382 G:0.34959
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 6 | TAC 0 | TGC 18
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 12 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 18
CTC 12 | CCC 12 | CAC 0 | CGC 24
CTA 6 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 24 | CCG 6 | CAG 6 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 6
ATC 12 | ACC 36 | AAC 0 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 12 | ACG 18 | AAG 0 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 48 | Asp D GAT 0 | Gly G GGT 24
GTC 54 | GCC 12 | GAC 12 | GGC 12
GTA 6 | GCA 30 | Glu E GAA 6 | GGA 6
GTG 42 | GCG 30 | GAG 6 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18699 C:0.19512 A:0.17073 G:0.44715
position 2: T:0.35772 C:0.31707 A:0.07317 G:0.25203
position 3: T:0.23577 C:0.31707 A:0.09756 G:0.34959
Average T:0.26016 C:0.27642 A:0.11382 G:0.34959
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -473.952975 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.089263
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907641_1_283_MLBR_RS01385: 0.000004, NC_002677_1_NP_301317_1_189_ML0271: 0.000004, NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345: 0.000004, NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470: 0.000004, NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470: 0.000004, NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.08926
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 252.3 116.7 1.0893 0.0000 0.0000 0.0 0.0
7..2 0.000 252.3 116.7 1.0893 0.0000 0.0000 0.0 0.0
7..3 0.000 252.3 116.7 1.0893 0.0000 0.0000 0.0 0.0
7..4 0.000 252.3 116.7 1.0893 0.0000 0.0000 0.0 0.0
7..5 0.000 252.3 116.7 1.0893 0.0000 0.0000 0.0 0.0
7..6 0.000 252.3 116.7 1.0893 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -473.952972 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.562763 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907641_1_283_MLBR_RS01385: 0.000004, NC_002677_1_NP_301317_1_189_ML0271: 0.000004, NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345: 0.000004, NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470: 0.000004, NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470: 0.000004, NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.56276 0.43724
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 252.3 116.7 0.4372 0.0000 0.0000 0.0 0.0
7..2 0.000 252.3 116.7 0.4372 0.0000 0.0000 0.0 0.0
7..3 0.000 252.3 116.7 0.4372 0.0000 0.0000 0.0 0.0
7..4 0.000 252.3 116.7 0.4372 0.0000 0.0000 0.0 0.0
7..5 0.000 252.3 116.7 0.4372 0.0000 0.0000 0.0 0.0
7..6 0.000 252.3 116.7 0.4372 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -473.952972 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.592371 0.242428 0.000001 1.176706
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907641_1_283_MLBR_RS01385: 0.000004, NC_002677_1_NP_301317_1_189_ML0271: 0.000004, NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345: 0.000004, NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470: 0.000004, NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470: 0.000004, NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.59237 0.24243 0.16520
w: 0.00000 1.00000 1.17671
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 252.3 116.7 0.4368 0.0000 0.0000 0.0 0.0
7..2 0.000 252.3 116.7 0.4368 0.0000 0.0000 0.0 0.0
7..3 0.000 252.3 116.7 0.4368 0.0000 0.0000 0.0 0.0
7..4 0.000 252.3 116.7 0.4368 0.0000 0.0000 0.0 0.0
7..5 0.000 252.3 116.7 0.4368 0.0000 0.0000 0.0 0.0
7..6 0.000 252.3 116.7 0.4368 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907641_1_283_MLBR_RS01385)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907641_1_283_MLBR_RS01385)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -473.952965 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 2.936173
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907641_1_283_MLBR_RS01385: 0.000004, NC_002677_1_NP_301317_1_189_ML0271: 0.000004, NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345: 0.000004, NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470: 0.000004, NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470: 0.000004, NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 2.93617
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 252.3 116.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 252.3 116.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 252.3 116.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 252.3 116.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 252.3 116.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 252.3 116.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -473.952973 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.413828 0.005000 1.097478 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907641_1_283_MLBR_RS01385: 0.000004, NC_002677_1_NP_301317_1_189_ML0271: 0.000004, NZ_LVXE01000050_1_WP_010907641_1_2096_A3216_RS11345: 0.000004, NZ_LYPH01000059_1_WP_010907641_1_2190_A8144_RS10470: 0.000004, NZ_CP029543_1_WP_010907641_1_284_DIJ64_RS01470: 0.000004, NZ_AP014567_1_WP_010907641_1_294_JK2ML_RS01520: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.41383 p = 0.00500 q = 1.09748
(p1 = 0.58617) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.04138 0.04138 0.04138 0.04138 0.04138 0.04138 0.04138 0.04138 0.04138 0.04138 0.58617
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 252.3 116.7 0.5862 0.0000 0.0000 0.0 0.0
7..2 0.000 252.3 116.7 0.5862 0.0000 0.0000 0.0 0.0
7..3 0.000 252.3 116.7 0.5862 0.0000 0.0000 0.0 0.0
7..4 0.000 252.3 116.7 0.5862 0.0000 0.0000 0.0 0.0
7..5 0.000 252.3 116.7 0.5862 0.0000 0.0000 0.0 0.0
7..6 0.000 252.3 116.7 0.5862 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907641_1_283_MLBR_RS01385)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Time used: 0:11
Model 1: NearlyNeutral -473.952972 Model 2: PositiveSelection -473.952972 Model 0: one-ratio -473.952975 Model 7: beta -473.952965 Model 8: beta&w>1 -473.952973 Model 0 vs 1 5.999999984851456E-6 Model 2 vs 1 0.0 Model 8 vs 7 1.5999999959603883E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
