--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 16:30:02 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0281/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -911.20 -914.43 2 -911.28 -916.00 -------------------------------------- TOTAL -911.23 -915.49 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902984 0.093183 0.377322 1.472407 0.870641 1286.03 1319.25 1.000 r(A<->C){all} 0.170021 0.020927 0.000062 0.465713 0.134141 195.34 211.60 1.002 r(A<->G){all} 0.163324 0.019721 0.000071 0.449213 0.124156 239.43 268.40 1.003 r(A<->T){all} 0.157597 0.017391 0.000083 0.424753 0.121688 258.46 283.24 1.003 r(C<->G){all} 0.176440 0.022759 0.000095 0.492436 0.135039 111.43 144.83 1.000 r(C<->T){all} 0.173828 0.020621 0.000029 0.466342 0.134784 111.46 175.48 1.002 r(G<->T){all} 0.158791 0.018534 0.000020 0.433757 0.125554 147.05 215.97 1.000 pi(A){all} 0.159018 0.000187 0.130953 0.185129 0.158636 915.80 1129.90 1.000 pi(C){all} 0.323201 0.000314 0.287969 0.356461 0.323524 1081.58 1275.35 1.000 pi(G){all} 0.349612 0.000328 0.311799 0.382806 0.349183 1215.05 1291.80 1.001 pi(T){all} 0.168169 0.000205 0.140139 0.195731 0.167742 1251.74 1321.15 1.000 alpha{1,2} 0.438181 0.243597 0.000109 1.481592 0.259960 1188.72 1210.77 1.003 alpha{3} 0.448864 0.227720 0.000256 1.455069 0.293928 1138.68 1282.38 1.000 pinvar{all} 0.997726 0.000007 0.992220 1.000000 0.998601 1088.49 1154.61 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -888.021535 Model 2: PositiveSelection -888.021533 Model 0: one-ratio -888.021536 Model 7: beta -888.021556 Model 8: beta&w>1 -888.021529 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 5.400000009103678E-5
>C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=229 C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP ************************************************** C1 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C2 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C3 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C4 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C5 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C6 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR ************************************************** C1 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C2 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C3 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C4 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C5 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C6 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP ************************************************** C1 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C2 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C3 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C4 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C5 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C6 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV ************************************************** C1 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C2 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C3 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C4 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C5 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C6 AVVRDGVPTRRRERRSTFYRNVEGWMLVR ***************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] Relaxation Summary: [6870]--->[6870] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.488 Mb, Max= 30.778 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP ************************************************** C1 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C2 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C3 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C4 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C5 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C6 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR ************************************************** C1 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C2 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C3 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C4 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C5 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C6 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP ************************************************** C1 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C2 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C3 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C4 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C5 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C6 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV ************************************************** C1 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C2 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C3 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C4 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C5 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C6 AVVRDGVPTRRRERRSTFYRNVEGWMLVR ***************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C2 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C3 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C4 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C5 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C6 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA ************************************************** C1 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C2 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C3 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C4 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C5 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C6 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC ************************************************** C1 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C2 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C3 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C4 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C5 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C6 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG ************************************************** C1 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C2 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C3 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C4 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C5 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C6 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT ************************************************** C1 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C2 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C3 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C4 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C5 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C6 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC ************************************************** C1 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C2 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C3 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C4 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C5 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C6 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC ************************************************** C1 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C2 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C3 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C4 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C5 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C6 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT ************************************************** C1 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C2 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C3 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C4 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C5 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C6 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG ************************************************** C1 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C2 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C3 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C4 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C5 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C6 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG ************************************************** C1 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C2 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C3 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C4 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C5 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C6 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT ************************************************** C1 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C2 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C3 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C4 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C5 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C6 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT ************************************************** C1 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C2 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C3 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C4 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C5 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C6 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC ************************************************** C1 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C2 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C3 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C4 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C5 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C6 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC ************************************************** C1 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C2 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C3 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C4 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C5 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C6 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG ************************************* >C1 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C2 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C3 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C4 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C5 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C6 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 687 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579796927 Setting output file names to "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 299928934 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0409461546 Seed = 2062896686 Swapseed = 1579796927 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1537.538934 -- -24.965149 Chain 2 -- -1537.538934 -- -24.965149 Chain 3 -- -1537.538934 -- -24.965149 Chain 4 -- -1537.538700 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1537.538934 -- -24.965149 Chain 2 -- -1537.538846 -- -24.965149 Chain 3 -- -1537.538700 -- -24.965149 Chain 4 -- -1537.538846 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1537.539] (-1537.539) (-1537.539) (-1537.539) * [-1537.539] (-1537.539) (-1537.539) (-1537.539) 500 -- (-925.911) (-958.462) (-918.410) [-935.968] * [-942.271] (-934.767) (-937.791) (-942.034) -- 0:00:00 1000 -- [-918.722] (-932.088) (-927.883) (-920.798) * [-928.223] (-924.709) (-942.473) (-916.184) -- 0:00:00 1500 -- (-930.715) (-926.402) [-916.513] (-918.388) * (-916.133) (-926.106) (-936.127) [-921.655] -- 0:00:00 2000 -- (-921.812) (-928.304) (-924.207) [-918.360] * [-920.531] (-924.288) (-918.499) (-916.713) -- 0:00:00 2500 -- (-918.295) [-917.265] (-921.672) (-925.333) * (-924.967) (-919.785) (-919.630) [-916.276] -- 0:00:00 3000 -- (-920.424) (-915.803) (-924.285) [-922.634] * [-921.313] (-918.950) (-920.575) (-922.067) -- 0:00:00 3500 -- (-912.894) (-928.754) (-925.539) [-914.906] * (-918.569) [-920.278] (-916.709) (-920.004) -- 0:00:00 4000 -- (-920.294) (-914.427) (-925.139) [-921.832] * (-923.319) (-919.654) [-916.777] (-922.233) -- 0:00:00 4500 -- (-918.434) (-922.689) [-916.552] (-921.745) * (-918.311) [-920.274] (-918.480) (-922.339) -- 0:00:00 5000 -- (-920.446) (-916.597) [-920.812] (-919.018) * (-924.044) (-922.411) [-921.913] (-924.288) -- 0:00:00 Average standard deviation of split frequencies: 0.091662 5500 -- (-918.858) (-921.761) [-915.882] (-922.467) * (-922.595) (-921.933) [-930.063] (-917.958) -- 0:00:00 6000 -- (-919.751) (-920.952) [-924.037] (-921.619) * [-919.701] (-917.017) (-917.035) (-924.548) -- 0:00:00 6500 -- [-919.436] (-917.091) (-919.369) (-924.101) * [-919.877] (-926.639) (-917.255) (-922.518) -- 0:00:00 7000 -- (-922.438) (-917.120) (-917.629) [-926.528] * (-912.700) (-916.628) (-925.032) [-920.247] -- 0:00:00 7500 -- (-922.252) (-921.799) (-924.406) [-919.993] * (-923.755) (-921.457) (-919.373) [-916.359] -- 0:00:00 8000 -- [-916.687] (-924.243) (-921.831) (-920.736) * [-930.446] (-925.824) (-925.878) (-918.222) -- 0:00:00 8500 -- (-918.218) [-924.772] (-922.967) (-923.005) * (-925.421) (-918.885) (-923.522) [-915.915] -- 0:00:00 9000 -- (-927.881) (-918.947) [-929.824] (-920.858) * (-927.194) (-923.133) [-918.963] (-916.913) -- 0:01:50 9500 -- (-931.498) (-918.926) [-925.188] (-922.174) * (-926.089) (-925.157) (-926.864) [-919.328] -- 0:01:44 10000 -- (-923.730) (-918.946) (-923.021) [-916.154] * (-918.950) (-917.827) (-928.749) [-920.131] -- 0:01:39 Average standard deviation of split frequencies: 0.067344 10500 -- (-925.951) (-918.130) [-914.989] (-916.082) * (-920.135) (-927.799) [-920.793] (-926.571) -- 0:01:34 11000 -- [-927.854] (-923.741) (-923.825) (-924.319) * (-920.739) (-923.536) [-921.243] (-923.150) -- 0:01:29 11500 -- (-919.981) (-922.436) [-916.390] (-917.729) * (-922.802) (-916.165) [-917.666] (-923.941) -- 0:01:25 12000 -- [-924.296] (-923.625) (-913.248) (-923.436) * [-916.590] (-918.065) (-941.776) (-916.431) -- 0:01:22 12500 -- (-924.673) [-918.042] (-910.986) (-921.891) * (-923.312) (-920.463) (-923.069) [-918.927] -- 0:01:19 13000 -- (-914.955) (-919.776) (-911.584) [-924.145] * [-915.713] (-928.002) (-923.152) (-921.936) -- 0:01:15 13500 -- (-919.676) (-920.771) [-914.793] (-918.752) * (-919.555) (-917.134) (-920.323) [-923.155] -- 0:01:13 14000 -- (-918.994) [-917.427] (-911.839) (-930.315) * [-919.161] (-920.565) (-923.439) (-918.637) -- 0:01:10 14500 -- (-921.873) (-919.953) (-913.989) [-923.680] * [-918.574] (-922.795) (-921.072) (-916.752) -- 0:01:07 15000 -- (-924.962) [-919.391] (-912.815) (-922.807) * (-927.563) [-924.419] (-916.450) (-923.617) -- 0:01:05 Average standard deviation of split frequencies: 0.044970 15500 -- (-919.017) (-918.248) (-912.474) [-921.319] * (-921.023) (-918.111) (-918.897) [-923.268] -- 0:01:03 16000 -- (-918.526) (-923.715) [-910.537] (-925.747) * (-921.437) (-919.587) [-920.034] (-924.820) -- 0:01:01 16500 -- (-922.168) (-924.358) [-909.854] (-924.838) * [-925.379] (-924.772) (-927.785) (-924.565) -- 0:00:59 17000 -- (-922.819) (-915.115) (-912.288) [-919.066] * (-912.715) (-920.106) [-916.935] (-923.092) -- 0:00:57 17500 -- (-920.701) (-922.504) [-911.067] (-922.490) * (-911.217) (-923.314) [-920.144] (-918.734) -- 0:00:56 18000 -- (-922.954) [-918.094] (-912.000) (-921.609) * (-911.228) (-919.853) (-920.453) [-919.009] -- 0:00:54 18500 -- (-923.244) (-919.158) [-911.603] (-918.932) * (-910.899) [-916.783] (-920.497) (-918.575) -- 0:00:53 19000 -- [-918.223] (-924.110) (-912.502) (-916.843) * (-912.471) (-920.013) (-933.177) [-927.792] -- 0:00:51 19500 -- (-929.962) (-930.185) [-911.736] (-918.948) * (-911.652) (-916.939) (-920.947) [-916.844] -- 0:00:50 20000 -- (-924.275) [-923.603] (-910.330) (-916.397) * (-912.403) [-924.071] (-923.437) (-922.105) -- 0:00:49 Average standard deviation of split frequencies: 0.056264 20500 -- [-920.276] (-930.687) (-910.610) (-915.188) * (-910.656) [-925.426] (-924.526) (-917.854) -- 0:00:47 21000 -- (-921.249) (-926.391) [-910.275] (-914.501) * (-910.489) (-913.563) [-916.643] (-921.452) -- 0:00:46 21500 -- [-921.111] (-920.514) (-911.982) (-915.011) * (-910.907) (-913.716) [-920.985] (-921.850) -- 0:00:45 22000 -- [-921.748] (-922.641) (-910.736) (-911.665) * (-910.441) [-911.261] (-920.850) (-918.772) -- 0:00:44 22500 -- (-917.149) [-918.762] (-913.896) (-912.289) * (-912.415) [-913.670] (-924.064) (-924.390) -- 0:00:43 23000 -- (-926.731) [-919.815] (-916.530) (-910.967) * (-911.378) [-913.824] (-925.995) (-920.883) -- 0:00:42 23500 -- (-925.918) (-916.429) (-915.189) [-910.762] * (-912.988) (-915.123) [-924.725] (-932.716) -- 0:00:41 24000 -- (-918.398) [-918.524] (-914.447) (-911.331) * (-914.904) [-912.831] (-922.055) (-921.445) -- 0:00:40 24500 -- (-922.446) (-921.311) (-911.969) [-910.546] * [-915.919] (-912.752) (-922.025) (-919.194) -- 0:00:39 25000 -- (-921.335) (-925.764) [-913.198] (-910.882) * (-911.635) (-910.180) [-918.947] (-921.451) -- 0:01:18 Average standard deviation of split frequencies: 0.040039 25500 -- (-932.308) [-916.930] (-911.405) (-913.755) * (-911.274) [-910.538] (-918.978) (-919.425) -- 0:01:16 26000 -- (-923.997) [-921.685] (-910.336) (-912.683) * (-911.575) (-915.854) (-929.032) [-915.880] -- 0:01:14 26500 -- (-927.437) [-918.964] (-913.462) (-914.302) * (-911.127) (-912.390) [-919.111] (-921.743) -- 0:01:13 27000 -- (-918.118) [-915.896] (-912.162) (-916.303) * [-912.814] (-912.723) (-918.353) (-927.374) -- 0:01:12 27500 -- (-916.400) [-917.391] (-911.308) (-918.259) * (-914.916) (-912.782) (-920.920) [-919.097] -- 0:01:10 28000 -- (-930.756) [-918.403] (-911.963) (-914.137) * [-912.712] (-914.569) (-925.034) (-920.695) -- 0:01:09 28500 -- [-919.740] (-917.871) (-913.684) (-913.155) * (-911.133) (-914.191) (-921.096) [-920.723] -- 0:01:08 29000 -- [-919.666] (-927.342) (-912.273) (-915.755) * [-910.842] (-915.216) (-918.321) (-919.880) -- 0:01:06 29500 -- (-928.288) (-926.878) (-914.044) [-913.426] * (-913.028) (-913.312) [-920.442] (-920.044) -- 0:01:05 30000 -- (-922.607) (-925.301) [-911.997] (-911.622) * (-911.654) [-912.830] (-920.863) (-920.144) -- 0:01:04 Average standard deviation of split frequencies: 0.040992 30500 -- (-920.967) [-921.711] (-910.158) (-916.543) * (-913.863) (-911.353) [-917.323] (-922.479) -- 0:01:03 31000 -- (-928.396) [-915.973] (-911.435) (-915.851) * (-914.766) [-910.834] (-921.350) (-921.761) -- 0:01:02 31500 -- (-919.385) (-921.250) [-911.498] (-911.604) * [-912.672] (-911.428) (-913.279) (-919.405) -- 0:01:01 32000 -- (-921.921) (-922.977) (-918.622) [-909.966] * (-913.293) (-916.304) [-915.008] (-916.419) -- 0:01:00 32500 -- (-919.658) [-918.391] (-912.247) (-922.925) * (-914.760) (-913.785) (-911.014) [-919.953] -- 0:00:59 33000 -- (-920.060) (-921.055) (-912.276) [-914.575] * (-912.127) (-910.207) (-911.812) [-914.867] -- 0:00:58 33500 -- [-916.533] (-925.140) (-912.167) (-913.181) * (-912.719) (-911.082) (-910.544) [-914.996] -- 0:00:57 34000 -- (-928.262) [-921.846] (-912.099) (-910.009) * (-911.923) (-912.778) (-911.469) [-925.256] -- 0:00:56 34500 -- [-917.414] (-921.623) (-914.915) (-910.166) * (-910.278) [-913.629] (-910.702) (-919.767) -- 0:00:55 35000 -- (-941.509) (-932.660) (-914.276) [-911.369] * (-912.213) (-911.038) [-912.248] (-927.469) -- 0:00:55 Average standard deviation of split frequencies: 0.041351 35500 -- (-922.888) [-920.232] (-914.859) (-917.042) * [-911.180] (-909.973) (-912.941) (-917.602) -- 0:00:54 36000 -- (-914.767) (-920.588) [-915.435] (-913.391) * (-911.536) [-911.091] (-915.197) (-928.074) -- 0:00:53 36500 -- (-910.984) [-918.551] (-912.291) (-912.972) * (-911.039) (-912.577) (-912.592) [-916.154] -- 0:00:52 37000 -- (-913.091) [-917.376] (-913.215) (-918.186) * [-910.617] (-912.103) (-910.785) (-925.631) -- 0:00:52 37500 -- (-911.953) (-932.922) [-911.048] (-915.906) * [-911.158] (-909.998) (-910.814) (-922.735) -- 0:00:51 38000 -- (-911.880) (-929.277) (-913.154) [-911.648] * [-912.782] (-910.999) (-911.973) (-924.234) -- 0:00:50 38500 -- (-910.914) (-921.783) [-910.083] (-915.087) * (-913.373) (-911.480) (-910.208) [-922.122] -- 0:00:49 39000 -- (-912.013) [-920.759] (-910.584) (-910.798) * (-912.672) (-912.193) [-911.894] (-924.261) -- 0:00:49 39500 -- [-910.300] (-925.561) (-914.726) (-911.118) * (-911.736) [-910.534] (-910.961) (-925.961) -- 0:00:48 40000 -- [-910.583] (-923.378) (-920.970) (-910.963) * (-915.862) [-910.829] (-913.379) (-930.168) -- 0:00:48 Average standard deviation of split frequencies: 0.034132 40500 -- (-912.139) (-920.721) (-916.837) [-911.465] * (-912.123) (-911.088) [-911.710] (-927.358) -- 0:00:47 41000 -- (-914.058) [-925.779] (-910.017) (-911.522) * (-913.655) (-911.325) (-911.158) [-922.072] -- 0:01:10 41500 -- (-912.434) (-916.885) (-911.523) [-914.217] * (-910.897) (-912.830) [-912.613] (-927.814) -- 0:01:09 42000 -- (-912.620) (-925.561) [-910.939] (-915.750) * (-913.048) (-915.928) (-912.527) [-911.797] -- 0:01:08 42500 -- [-914.161] (-922.932) (-911.125) (-914.534) * [-913.807] (-912.983) (-912.253) (-912.398) -- 0:01:07 43000 -- [-911.390] (-922.766) (-914.776) (-914.463) * (-910.773) (-913.270) [-910.393] (-913.922) -- 0:01:06 43500 -- (-911.808) [-916.166] (-911.301) (-911.213) * [-910.936] (-912.305) (-911.590) (-915.155) -- 0:01:05 44000 -- [-910.157] (-924.132) (-910.526) (-910.724) * (-917.160) [-911.541] (-911.561) (-917.403) -- 0:01:05 44500 -- (-910.977) [-923.298] (-910.116) (-910.293) * (-913.796) [-912.112] (-910.995) (-918.230) -- 0:01:04 45000 -- [-911.592] (-920.068) (-914.761) (-914.982) * [-911.873] (-913.372) (-910.687) (-915.962) -- 0:01:03 Average standard deviation of split frequencies: 0.031720 45500 -- [-911.479] (-919.418) (-911.078) (-910.621) * (-914.065) (-913.446) [-910.155] (-913.583) -- 0:01:02 46000 -- (-911.344) (-918.056) [-910.672] (-911.355) * (-911.919) (-910.777) [-910.833] (-911.173) -- 0:01:02 46500 -- [-913.926] (-919.790) (-911.350) (-911.854) * [-912.073] (-913.291) (-911.372) (-912.110) -- 0:01:01 47000 -- (-912.808) (-915.252) (-911.491) [-913.456] * (-912.750) (-911.028) [-910.226] (-911.462) -- 0:01:00 47500 -- (-910.347) (-910.123) (-911.104) [-912.337] * (-913.771) (-914.286) [-910.195] (-913.991) -- 0:01:00 48000 -- [-911.685] (-912.529) (-914.807) (-910.621) * (-910.246) (-910.855) (-910.522) [-911.175] -- 0:00:59 48500 -- [-912.291] (-910.652) (-912.049) (-911.470) * (-910.691) (-912.545) [-911.458] (-912.209) -- 0:00:58 49000 -- [-911.908] (-910.021) (-910.244) (-911.538) * [-911.253] (-910.429) (-911.196) (-913.743) -- 0:00:58 49500 -- [-913.854] (-911.647) (-910.833) (-914.613) * (-910.558) [-912.323] (-911.310) (-912.392) -- 0:00:57 50000 -- (-910.672) (-911.543) [-910.458] (-911.129) * [-910.092] (-910.674) (-914.159) (-918.147) -- 0:00:57 Average standard deviation of split frequencies: 0.032809 50500 -- (-911.407) (-910.968) (-910.556) [-910.421] * (-912.356) (-916.932) (-909.646) [-911.675] -- 0:00:56 51000 -- (-910.769) (-911.295) (-911.205) [-910.089] * (-912.356) [-917.726] (-913.448) (-910.703) -- 0:00:55 51500 -- (-914.623) [-914.271] (-910.809) (-910.951) * (-909.663) [-914.481] (-912.725) (-910.681) -- 0:00:55 52000 -- [-912.842] (-911.569) (-910.638) (-910.587) * [-910.526] (-915.991) (-912.793) (-913.420) -- 0:00:54 52500 -- (-912.212) (-910.185) (-910.092) [-911.273] * (-910.056) (-911.994) (-914.310) [-914.127] -- 0:00:54 53000 -- (-911.433) [-911.192] (-914.830) (-911.856) * (-909.779) (-911.988) [-911.510] (-914.552) -- 0:00:53 53500 -- [-912.276] (-911.063) (-912.645) (-911.454) * (-910.648) [-910.745] (-914.663) (-914.061) -- 0:00:53 54000 -- (-914.812) (-910.064) [-912.054] (-912.161) * (-909.951) [-912.080] (-913.575) (-910.921) -- 0:00:52 54500 -- (-915.324) [-910.097] (-914.457) (-911.797) * (-909.951) (-913.535) [-912.372] (-910.864) -- 0:00:52 55000 -- (-910.929) (-910.015) (-914.914) [-911.649] * (-912.328) (-911.722) (-910.704) [-910.452] -- 0:00:51 Average standard deviation of split frequencies: 0.030570 55500 -- [-910.771] (-914.819) (-911.336) (-912.528) * (-911.307) [-910.440] (-912.319) (-912.514) -- 0:00:51 56000 -- [-909.664] (-913.850) (-914.536) (-911.318) * (-912.164) [-912.605] (-912.470) (-912.289) -- 0:00:50 56500 -- (-917.301) (-914.396) [-911.356] (-911.395) * (-910.607) [-911.399] (-912.821) (-911.506) -- 0:00:50 57000 -- [-911.021] (-913.840) (-910.778) (-911.629) * (-910.607) [-910.114] (-912.232) (-913.728) -- 0:00:49 57500 -- (-913.475) (-913.661) [-915.983] (-916.041) * (-913.547) (-910.429) (-910.952) [-915.285] -- 0:00:49 58000 -- [-910.539] (-913.526) (-918.083) (-914.164) * [-922.327] (-910.872) (-911.099) (-911.509) -- 0:01:04 58500 -- [-910.597] (-911.858) (-912.821) (-910.533) * (-914.546) (-912.071) (-910.602) [-911.438] -- 0:01:04 59000 -- (-915.453) [-911.708] (-911.976) (-911.587) * [-912.383] (-911.870) (-912.039) (-912.753) -- 0:01:03 59500 -- (-917.112) (-911.501) [-910.054] (-911.838) * (-914.557) [-911.825] (-911.135) (-912.763) -- 0:01:03 60000 -- (-915.894) [-910.701] (-911.030) (-913.968) * (-910.715) (-913.329) [-912.133] (-912.521) -- 0:01:02 Average standard deviation of split frequencies: 0.033024 60500 -- (-911.196) (-910.924) [-911.603] (-914.957) * (-910.857) (-912.867) [-913.289] (-918.996) -- 0:01:02 61000 -- (-911.468) (-909.979) (-913.350) [-918.375] * (-911.311) (-910.956) [-912.433] (-911.003) -- 0:01:01 61500 -- (-915.642) (-910.506) [-912.520] (-916.619) * [-912.885] (-910.140) (-914.487) (-912.506) -- 0:01:01 62000 -- (-911.222) (-913.188) [-913.243] (-915.456) * (-914.139) (-912.763) (-912.141) [-914.182] -- 0:01:00 62500 -- (-912.418) [-911.828] (-911.318) (-914.331) * (-911.626) (-914.389) (-912.223) [-911.559] -- 0:01:00 63000 -- (-912.281) (-914.021) (-912.929) [-911.256] * (-912.678) (-910.766) [-911.775] (-914.156) -- 0:00:59 63500 -- (-910.966) (-912.829) (-911.883) [-912.787] * (-914.194) (-911.947) [-912.044] (-914.237) -- 0:00:58 64000 -- [-911.794] (-910.266) (-910.123) (-913.080) * (-914.867) (-911.140) [-912.897] (-914.690) -- 0:00:58 64500 -- (-910.218) (-909.913) [-909.547] (-913.333) * (-913.674) (-911.057) (-911.476) [-915.331] -- 0:00:58 65000 -- (-911.022) (-912.132) (-910.677) [-914.265] * (-912.550) (-913.972) [-913.443] (-911.091) -- 0:00:57 Average standard deviation of split frequencies: 0.026784 65500 -- (-914.448) [-911.466] (-911.672) (-912.329) * (-911.652) [-910.710] (-913.746) (-913.261) -- 0:00:57 66000 -- (-917.622) (-913.976) [-910.775] (-911.058) * [-910.262] (-911.333) (-913.503) (-912.275) -- 0:00:56 66500 -- [-913.434] (-915.826) (-910.775) (-913.136) * [-911.150] (-912.405) (-912.317) (-912.455) -- 0:00:56 67000 -- (-913.476) (-911.407) [-910.996] (-913.511) * [-910.761] (-914.751) (-911.281) (-912.942) -- 0:00:55 67500 -- (-910.818) (-915.011) (-911.696) [-914.849] * (-910.795) (-913.548) [-910.985] (-913.588) -- 0:00:55 68000 -- (-913.109) [-910.961] (-910.966) (-912.733) * [-912.806] (-918.150) (-911.108) (-913.510) -- 0:00:54 68500 -- (-912.636) (-912.093) [-913.590] (-914.445) * [-911.920] (-915.163) (-911.222) (-910.933) -- 0:00:54 69000 -- (-911.846) (-911.243) [-912.522] (-911.146) * (-911.047) (-910.679) (-910.769) [-911.959] -- 0:00:53 69500 -- [-910.218] (-912.249) (-911.594) (-912.071) * (-912.944) (-910.432) [-910.164] (-913.208) -- 0:00:53 70000 -- (-909.887) [-911.384] (-913.946) (-913.587) * (-911.175) (-910.634) [-911.476] (-913.550) -- 0:00:53 Average standard deviation of split frequencies: 0.026350 70500 -- (-910.933) [-912.317] (-909.977) (-915.920) * (-911.751) [-914.137] (-910.225) (-918.596) -- 0:00:52 71000 -- [-910.766] (-913.800) (-910.415) (-911.403) * [-911.067] (-913.960) (-914.902) (-915.376) -- 0:00:52 71500 -- (-910.654) [-913.030] (-910.643) (-912.176) * [-911.860] (-911.698) (-911.022) (-911.850) -- 0:00:51 72000 -- (-910.440) (-912.874) (-913.206) [-910.365] * [-912.539] (-914.463) (-915.941) (-910.507) -- 0:00:51 72500 -- (-911.715) (-911.259) (-911.489) [-911.071] * (-913.495) (-911.078) [-910.519] (-911.333) -- 0:00:51 73000 -- (-911.346) (-912.956) (-910.442) [-913.674] * [-911.862] (-911.498) (-911.144) (-910.408) -- 0:00:50 73500 -- (-911.059) [-909.700] (-913.243) (-913.593) * (-912.162) (-911.691) (-910.743) [-910.498] -- 0:00:50 74000 -- (-911.753) [-911.388] (-910.821) (-914.875) * [-911.820] (-910.780) (-912.864) (-913.648) -- 0:00:50 74500 -- (-909.866) (-911.055) [-910.520] (-911.623) * (-912.766) (-912.040) [-910.664] (-912.910) -- 0:01:02 75000 -- (-910.590) (-911.224) [-910.343] (-912.927) * (-914.327) (-912.028) [-911.928] (-914.300) -- 0:01:01 Average standard deviation of split frequencies: 0.026051 75500 -- [-909.767] (-910.977) (-910.077) (-912.721) * (-916.054) (-909.914) (-913.604) [-910.597] -- 0:01:01 76000 -- (-913.426) (-910.255) [-909.865] (-912.769) * (-912.610) (-910.171) [-915.167] (-911.886) -- 0:01:00 76500 -- [-910.751] (-914.203) (-911.141) (-911.743) * [-912.240] (-910.164) (-912.712) (-911.496) -- 0:01:00 77000 -- (-912.623) (-910.980) (-912.346) [-912.671] * (-911.728) (-911.298) [-910.825] (-913.295) -- 0:00:59 77500 -- (-911.219) (-911.447) (-913.428) [-911.775] * (-913.314) (-915.512) (-911.091) [-913.004] -- 0:00:59 78000 -- (-910.259) (-910.213) (-910.785) [-912.154] * (-914.364) (-910.541) [-910.080] (-913.336) -- 0:00:59 78500 -- (-912.266) [-911.281] (-911.502) (-910.124) * (-911.434) [-910.671] (-913.397) (-912.114) -- 0:00:58 79000 -- (-914.113) (-910.899) (-915.395) [-909.937] * (-912.683) [-913.144] (-911.230) (-910.510) -- 0:00:58 79500 -- [-910.015] (-915.500) (-910.516) (-912.830) * (-912.311) (-910.834) (-914.401) [-910.456] -- 0:00:57 80000 -- [-909.731] (-915.042) (-914.255) (-914.833) * [-913.168] (-912.394) (-913.077) (-911.325) -- 0:00:57 Average standard deviation of split frequencies: 0.020746 80500 -- (-910.105) (-918.141) (-913.972) [-915.129] * [-911.898] (-912.524) (-910.425) (-914.930) -- 0:00:57 81000 -- (-911.541) (-913.646) [-912.473] (-913.384) * (-910.630) [-911.756] (-911.106) (-910.514) -- 0:00:56 81500 -- [-911.769] (-910.422) (-913.816) (-914.593) * (-915.790) (-915.748) (-913.668) [-910.755] -- 0:00:56 82000 -- [-909.878] (-909.943) (-911.138) (-911.588) * (-914.452) [-914.464] (-916.104) (-910.361) -- 0:00:55 82500 -- (-910.004) (-914.278) [-913.351] (-911.058) * [-915.325] (-914.614) (-910.501) (-910.547) -- 0:00:55 83000 -- (-912.273) [-911.707] (-910.285) (-913.707) * (-913.108) (-911.892) [-910.003] (-911.630) -- 0:00:55 83500 -- (-911.457) [-909.718] (-910.680) (-911.794) * (-911.434) (-911.968) [-909.781] (-915.529) -- 0:00:54 84000 -- (-911.442) (-911.760) [-910.616] (-912.236) * [-911.909] (-911.864) (-912.577) (-911.852) -- 0:00:54 84500 -- [-911.448] (-912.549) (-913.683) (-916.262) * (-910.804) (-911.277) (-912.403) [-918.418] -- 0:00:54 85000 -- (-913.320) (-913.390) [-915.247] (-913.570) * [-912.109] (-911.978) (-911.793) (-912.875) -- 0:00:53 Average standard deviation of split frequencies: 0.022748 85500 -- (-916.450) (-917.855) (-913.099) [-912.700] * [-912.167] (-912.931) (-912.330) (-911.265) -- 0:00:53 86000 -- [-912.276] (-913.586) (-914.585) (-912.544) * (-909.949) (-916.209) (-913.155) [-911.508] -- 0:00:53 86500 -- [-911.483] (-913.769) (-912.580) (-910.711) * (-910.543) (-917.252) [-912.325] (-916.393) -- 0:00:52 87000 -- [-909.944] (-911.980) (-910.794) (-915.128) * (-910.738) [-909.981] (-913.124) (-920.099) -- 0:00:52 87500 -- (-911.328) (-912.414) (-911.029) [-917.439] * (-910.389) [-910.250] (-913.892) (-915.162) -- 0:00:52 88000 -- (-911.405) (-911.614) (-910.410) [-912.536] * [-910.677] (-911.619) (-912.314) (-916.014) -- 0:00:51 88500 -- (-911.327) (-910.665) (-912.186) [-912.691] * [-909.764] (-910.675) (-913.428) (-910.665) -- 0:00:51 89000 -- [-909.678] (-911.684) (-910.708) (-911.104) * (-909.766) [-910.747] (-912.840) (-914.329) -- 0:00:51 89500 -- (-911.835) [-910.389] (-911.033) (-910.927) * (-912.628) (-910.150) (-915.014) [-913.000] -- 0:00:50 90000 -- (-911.689) (-910.176) [-912.094] (-910.368) * (-912.461) [-909.966] (-917.095) (-909.568) -- 0:00:50 Average standard deviation of split frequencies: 0.022713 90500 -- (-914.529) (-910.355) [-912.818] (-912.201) * (-914.859) (-914.011) (-912.106) [-910.220] -- 0:01:00 91000 -- [-911.474] (-912.492) (-911.680) (-916.116) * (-911.548) (-914.730) (-910.408) [-911.775] -- 0:00:59 91500 -- (-911.493) (-912.161) [-910.356] (-911.102) * (-913.732) [-911.141] (-915.473) (-912.290) -- 0:00:59 92000 -- (-910.202) (-910.629) (-914.512) [-911.666] * (-915.097) [-911.507] (-910.885) (-917.860) -- 0:00:59 92500 -- [-910.851] (-910.469) (-911.252) (-914.755) * (-914.466) (-912.685) [-912.173] (-914.433) -- 0:00:58 93000 -- (-910.841) (-911.054) (-911.054) [-913.259] * (-909.952) [-916.447] (-911.748) (-914.872) -- 0:00:58 93500 -- [-910.257] (-910.441) (-912.118) (-911.542) * (-912.737) (-915.679) [-915.067] (-914.497) -- 0:00:58 94000 -- (-914.175) [-913.184] (-914.133) (-911.233) * (-918.518) (-913.660) [-911.947] (-911.643) -- 0:00:57 94500 -- [-915.846] (-910.587) (-913.479) (-910.166) * [-913.061] (-912.921) (-911.567) (-914.438) -- 0:00:57 95000 -- [-916.261] (-913.900) (-915.515) (-913.009) * [-911.331] (-911.075) (-911.005) (-916.905) -- 0:00:57 Average standard deviation of split frequencies: 0.024841 95500 -- (-910.744) (-912.786) [-910.309] (-911.296) * (-911.250) [-911.267] (-910.922) (-918.262) -- 0:00:56 96000 -- (-912.234) (-910.617) (-920.144) [-910.987] * (-912.069) [-911.742] (-913.383) (-915.433) -- 0:00:56 96500 -- [-910.341] (-911.906) (-923.510) (-913.923) * (-911.956) [-910.219] (-915.054) (-911.924) -- 0:00:56 97000 -- (-911.636) (-912.144) (-914.864) [-912.665] * [-910.288] (-911.638) (-913.122) (-911.130) -- 0:00:55 97500 -- (-913.530) (-912.066) [-912.440] (-919.981) * [-912.328] (-912.838) (-911.298) (-911.075) -- 0:00:55 98000 -- (-911.370) [-911.742] (-915.634) (-916.244) * [-915.982] (-910.122) (-916.720) (-913.077) -- 0:00:55 98500 -- (-915.563) (-910.218) [-911.696] (-918.352) * [-912.965] (-913.014) (-912.790) (-913.620) -- 0:00:54 99000 -- (-914.920) [-910.430] (-913.313) (-910.243) * (-911.168) (-910.439) [-912.660] (-913.087) -- 0:00:54 99500 -- (-913.475) (-913.251) [-911.750] (-911.924) * (-911.306) [-909.916] (-911.465) (-910.914) -- 0:00:54 100000 -- (-910.075) (-910.945) [-911.262] (-913.086) * (-911.362) (-913.189) (-913.597) [-910.786] -- 0:00:54 Average standard deviation of split frequencies: 0.023414 100500 -- (-910.455) [-911.262] (-912.764) (-910.651) * [-911.737] (-910.395) (-911.829) (-910.371) -- 0:00:53 101000 -- (-910.748) (-914.096) [-910.981] (-910.230) * (-912.754) (-914.151) (-912.304) [-911.724] -- 0:00:53 101500 -- (-911.295) [-912.827] (-910.594) (-909.971) * (-911.711) (-915.143) [-913.171] (-913.199) -- 0:00:53 102000 -- (-912.175) (-909.884) [-911.198] (-911.348) * [-913.414] (-913.949) (-912.737) (-912.208) -- 0:00:52 102500 -- (-910.482) (-911.037) [-912.403] (-910.468) * (-910.475) (-911.056) (-912.573) [-910.899] -- 0:00:52 103000 -- [-910.425] (-910.969) (-910.417) (-914.585) * (-911.819) [-911.440] (-913.998) (-912.202) -- 0:00:52 103500 -- (-912.768) (-911.262) [-915.207] (-912.938) * (-909.800) [-910.903] (-915.124) (-913.405) -- 0:00:51 104000 -- (-913.902) [-911.358] (-911.447) (-912.115) * [-914.239] (-911.502) (-913.498) (-913.563) -- 0:00:51 104500 -- (-911.091) [-911.070] (-910.839) (-912.818) * (-911.558) (-912.350) [-915.501] (-911.182) -- 0:00:51 105000 -- (-913.741) (-910.263) (-911.136) [-911.690] * [-910.513] (-911.456) (-912.168) (-915.900) -- 0:00:51 Average standard deviation of split frequencies: 0.023793 105500 -- (-910.483) (-910.770) [-911.830] (-910.619) * (-910.764) (-909.808) [-910.177] (-913.169) -- 0:00:50 106000 -- (-912.119) [-910.052] (-915.488) (-910.500) * (-912.769) (-910.608) [-910.040] (-912.954) -- 0:00:50 106500 -- [-910.339] (-917.464) (-910.452) (-910.455) * (-911.922) (-910.083) (-910.643) [-914.145] -- 0:00:50 107000 -- (-913.395) [-909.876] (-914.259) (-911.990) * (-913.962) (-913.304) [-911.628] (-914.379) -- 0:00:58 107500 -- (-911.498) (-910.656) [-914.861] (-914.559) * (-913.892) (-911.436) [-914.926] (-914.677) -- 0:00:58 108000 -- (-910.460) (-910.528) [-918.978] (-910.916) * (-921.250) (-913.791) (-910.730) [-911.885] -- 0:00:57 108500 -- [-910.442] (-909.945) (-911.702) (-911.201) * (-915.421) (-911.772) [-909.586] (-912.192) -- 0:00:57 109000 -- (-916.075) [-911.202] (-912.573) (-910.747) * [-912.184] (-912.035) (-911.930) (-911.041) -- 0:00:57 109500 -- (-912.370) (-912.823) [-911.565] (-913.635) * [-910.493] (-913.046) (-912.066) (-913.548) -- 0:00:56 110000 -- (-916.022) (-912.979) [-911.555] (-911.328) * (-910.717) (-912.322) (-911.429) [-910.912] -- 0:00:56 Average standard deviation of split frequencies: 0.024138 110500 -- (-912.000) (-912.801) (-916.294) [-912.757] * (-910.432) [-912.078] (-918.167) (-912.375) -- 0:00:56 111000 -- (-914.410) (-910.545) (-912.318) [-911.960] * (-910.443) (-915.373) [-912.913] (-911.869) -- 0:00:56 111500 -- (-910.823) [-910.551] (-914.883) (-912.357) * (-909.991) [-913.936] (-912.442) (-914.538) -- 0:00:55 112000 -- [-912.856] (-909.810) (-915.020) (-912.236) * (-910.413) (-911.150) [-914.708] (-913.426) -- 0:00:55 112500 -- (-911.708) [-909.847] (-918.082) (-910.617) * [-914.900] (-915.663) (-913.043) (-912.789) -- 0:00:55 113000 -- [-912.216] (-912.679) (-915.600) (-910.961) * (-912.984) (-913.164) [-911.902] (-912.424) -- 0:00:54 113500 -- (-912.984) (-911.379) (-915.216) [-911.217] * (-910.442) [-912.380] (-914.795) (-910.248) -- 0:00:54 114000 -- (-914.556) (-911.926) (-911.470) [-910.986] * (-911.118) (-910.636) [-915.309] (-912.234) -- 0:00:54 114500 -- (-913.321) (-918.229) (-912.870) [-915.459] * (-911.419) [-916.066] (-912.951) (-912.284) -- 0:00:54 115000 -- (-910.529) (-912.475) [-911.191] (-915.044) * (-911.684) (-911.360) (-914.547) [-912.940] -- 0:00:53 Average standard deviation of split frequencies: 0.024383 115500 -- (-910.837) [-910.893] (-914.032) (-919.377) * (-914.445) (-914.418) [-913.411] (-915.765) -- 0:00:53 116000 -- (-910.085) (-910.124) (-912.720) [-912.937] * (-909.610) [-910.046] (-913.592) (-910.446) -- 0:00:53 116500 -- [-913.326] (-911.752) (-911.759) (-911.354) * [-914.517] (-911.656) (-915.030) (-909.964) -- 0:00:53 117000 -- (-911.730) (-911.301) [-915.277] (-911.129) * (-915.663) (-911.316) (-914.609) [-912.355] -- 0:00:52 117500 -- [-913.847] (-913.100) (-913.779) (-914.183) * (-910.166) (-911.164) [-913.500] (-910.933) -- 0:00:52 118000 -- [-916.531] (-914.428) (-911.029) (-911.180) * (-909.684) [-910.748] (-910.532) (-910.914) -- 0:00:52 118500 -- (-917.390) (-916.723) [-910.345] (-911.816) * [-911.538] (-911.577) (-912.760) (-913.960) -- 0:00:52 119000 -- (-913.804) (-912.834) (-910.302) [-913.678] * (-912.079) (-911.434) (-913.512) [-911.504] -- 0:00:51 119500 -- [-913.438] (-911.905) (-914.748) (-912.328) * (-913.835) (-910.674) (-910.147) [-911.442] -- 0:00:51 120000 -- (-912.635) (-911.349) (-912.353) [-912.325] * (-909.801) [-910.806] (-910.509) (-914.331) -- 0:00:51 Average standard deviation of split frequencies: 0.024674 120500 -- (-914.204) (-912.672) [-915.147] (-911.695) * (-909.930) (-913.185) (-914.757) [-914.718] -- 0:00:51 121000 -- (-914.131) [-910.055] (-912.646) (-912.909) * [-912.962] (-912.263) (-914.485) (-912.362) -- 0:00:50 121500 -- [-914.250] (-909.972) (-912.321) (-913.049) * [-910.687] (-911.471) (-914.411) (-915.956) -- 0:00:50 122000 -- (-914.888) (-910.386) (-914.001) [-910.749] * (-914.096) (-910.615) (-916.035) [-919.753] -- 0:00:50 122500 -- (-911.697) [-913.965] (-913.241) (-910.416) * (-913.225) (-912.148) [-912.075] (-914.037) -- 0:00:50 123000 -- [-912.896] (-909.875) (-914.216) (-909.977) * (-910.126) (-910.581) [-911.116] (-914.093) -- 0:00:57 123500 -- (-913.946) (-910.699) (-912.736) [-910.375] * (-912.821) [-913.501] (-911.827) (-912.484) -- 0:00:56 124000 -- [-911.319] (-912.680) (-913.361) (-912.268) * (-914.513) (-913.657) (-912.288) [-911.551] -- 0:00:56 124500 -- (-911.672) (-910.963) (-919.248) [-911.783] * (-911.907) (-911.510) [-910.841] (-911.399) -- 0:00:56 125000 -- (-912.143) (-910.153) (-914.680) [-912.715] * (-914.672) [-911.559] (-913.043) (-913.753) -- 0:00:56 Average standard deviation of split frequencies: 0.024417 125500 -- [-911.425] (-912.290) (-916.497) (-911.849) * (-912.403) [-912.198] (-912.159) (-912.584) -- 0:00:55 126000 -- (-910.734) (-911.990) (-911.148) [-911.562] * (-911.508) (-915.526) (-910.473) [-910.611] -- 0:00:55 126500 -- (-909.798) [-911.719] (-910.348) (-918.998) * (-912.640) [-911.109] (-910.100) (-911.223) -- 0:00:55 127000 -- [-911.630] (-912.682) (-910.006) (-912.433) * (-912.187) (-910.871) (-911.690) [-911.704] -- 0:00:54 127500 -- [-910.822] (-912.416) (-911.720) (-913.533) * (-910.550) (-913.877) (-913.147) [-910.344] -- 0:00:54 128000 -- [-910.049] (-916.006) (-909.770) (-912.353) * (-910.766) [-912.917] (-912.403) (-911.078) -- 0:00:54 128500 -- [-910.455] (-916.006) (-911.595) (-911.204) * (-911.188) (-912.076) [-913.385] (-910.319) -- 0:00:54 129000 -- (-909.871) (-910.884) (-914.154) [-912.769] * [-915.778] (-911.176) (-920.116) (-910.387) -- 0:00:54 129500 -- (-909.959) (-912.967) (-913.600) [-911.894] * [-910.342] (-911.940) (-913.996) (-910.294) -- 0:00:53 130000 -- [-910.932] (-914.925) (-913.690) (-911.240) * (-910.840) (-911.654) [-913.521] (-914.489) -- 0:00:53 Average standard deviation of split frequencies: 0.021646 130500 -- (-910.371) (-920.848) (-910.180) [-911.881] * (-911.131) (-914.051) [-910.298] (-914.002) -- 0:00:53 131000 -- (-914.615) [-918.380] (-910.375) (-914.227) * (-910.207) (-914.238) (-914.528) [-913.532] -- 0:00:53 131500 -- (-911.619) (-915.051) [-912.023] (-913.389) * [-909.910] (-913.853) (-913.626) (-912.625) -- 0:00:52 132000 -- (-910.696) (-920.058) [-917.395] (-911.006) * (-910.769) (-911.925) [-913.063] (-910.030) -- 0:00:52 132500 -- [-911.016] (-913.748) (-913.605) (-910.760) * (-911.880) (-914.628) (-914.321) [-910.376] -- 0:00:52 133000 -- (-911.604) (-913.012) (-911.943) [-910.784] * (-910.851) (-910.513) (-913.809) [-910.536] -- 0:00:52 133500 -- (-911.663) [-911.103] (-913.107) (-913.494) * (-910.320) (-911.332) (-914.141) [-910.335] -- 0:00:51 134000 -- (-911.944) (-914.671) (-912.627) [-911.633] * (-915.846) [-911.472] (-910.933) (-912.754) -- 0:00:51 134500 -- (-910.186) (-912.629) [-910.638] (-910.856) * [-913.768] (-912.610) (-911.779) (-911.608) -- 0:00:51 135000 -- (-910.038) (-910.609) (-910.846) [-912.082] * (-916.370) (-912.295) (-911.681) [-911.068] -- 0:00:51 Average standard deviation of split frequencies: 0.019885 135500 -- [-910.715] (-910.087) (-910.819) (-910.726) * (-911.861) [-913.552] (-914.549) (-911.101) -- 0:00:51 136000 -- (-911.545) [-911.695] (-910.986) (-911.843) * (-912.245) (-915.626) [-910.985] (-912.178) -- 0:00:50 136500 -- (-913.740) [-911.157] (-910.986) (-910.441) * (-910.944) (-914.233) (-910.694) [-912.430] -- 0:00:50 137000 -- (-913.206) (-911.623) (-912.197) [-912.134] * [-911.776] (-911.026) (-910.844) (-909.937) -- 0:00:50 137500 -- (-915.522) (-912.181) (-912.633) [-912.671] * (-912.795) (-911.870) [-912.263] (-910.889) -- 0:00:50 138000 -- [-911.076] (-911.353) (-911.891) (-912.802) * (-913.776) (-910.786) (-913.184) [-911.215] -- 0:00:49 138500 -- (-911.605) (-912.395) [-914.138] (-911.039) * [-911.543] (-911.597) (-913.806) (-913.359) -- 0:00:49 139000 -- (-915.518) [-909.802] (-912.224) (-912.318) * (-910.584) [-911.597] (-914.651) (-914.198) -- 0:00:49 139500 -- (-912.465) (-910.619) [-911.464] (-911.115) * [-910.925] (-911.848) (-911.792) (-913.341) -- 0:00:49 140000 -- (-914.774) [-910.483] (-911.355) (-911.211) * (-910.083) (-912.517) [-910.244] (-915.398) -- 0:00:55 Average standard deviation of split frequencies: 0.019755 140500 -- (-912.453) (-911.691) [-912.416] (-919.949) * [-910.742] (-911.462) (-910.003) (-914.781) -- 0:00:55 141000 -- (-911.830) (-911.776) (-916.665) [-913.135] * (-911.383) (-913.707) (-910.005) [-912.493] -- 0:00:54 141500 -- (-911.128) [-910.500] (-911.709) (-913.901) * (-911.873) (-913.273) [-910.909] (-915.427) -- 0:00:54 142000 -- [-910.481] (-913.531) (-910.559) (-913.606) * (-910.626) (-913.636) [-910.551] (-912.213) -- 0:00:54 142500 -- [-912.901] (-912.299) (-911.053) (-911.191) * (-910.673) (-910.166) [-910.961] (-911.220) -- 0:00:54 143000 -- (-911.580) (-911.796) (-913.767) [-911.241] * (-910.673) (-911.655) (-910.470) [-911.942] -- 0:00:53 143500 -- (-913.935) [-913.813] (-914.207) (-912.960) * (-910.645) (-909.812) (-909.953) [-911.451] -- 0:00:53 144000 -- (-911.794) (-911.673) [-910.716] (-911.524) * (-910.474) [-915.405] (-911.472) (-911.703) -- 0:00:53 144500 -- [-917.356] (-914.413) (-911.431) (-912.846) * (-913.276) (-914.411) [-912.603] (-910.129) -- 0:00:53 145000 -- (-911.578) (-911.602) [-909.946] (-912.667) * (-911.702) (-915.125) (-918.580) [-909.643] -- 0:00:53 Average standard deviation of split frequencies: 0.019883 145500 -- (-911.789) (-912.131) (-909.766) [-911.633] * (-913.582) [-912.966] (-914.224) (-910.486) -- 0:00:52 146000 -- (-912.758) (-910.912) (-909.891) [-910.952] * (-911.693) (-910.858) (-914.989) [-912.920] -- 0:00:52 146500 -- (-912.796) (-911.789) (-909.897) [-910.059] * [-911.192] (-912.782) (-914.362) (-922.037) -- 0:00:52 147000 -- (-912.793) (-911.476) [-909.897] (-911.838) * (-915.438) (-915.714) (-911.699) [-914.408] -- 0:00:52 147500 -- (-910.600) [-913.471] (-913.039) (-913.810) * (-917.553) [-911.310] (-912.005) (-915.417) -- 0:00:52 148000 -- [-911.227] (-913.655) (-910.520) (-913.134) * (-913.298) [-910.398] (-912.201) (-911.845) -- 0:00:51 148500 -- [-912.097] (-910.569) (-911.693) (-914.445) * [-911.493] (-912.811) (-909.976) (-911.478) -- 0:00:51 149000 -- [-911.951] (-910.508) (-910.913) (-914.210) * (-911.236) [-910.486] (-910.081) (-912.436) -- 0:00:51 149500 -- (-914.624) (-913.513) [-912.685] (-917.426) * (-911.377) [-911.611] (-912.410) (-913.907) -- 0:00:51 150000 -- [-909.740] (-914.630) (-912.754) (-913.369) * (-912.030) [-912.179] (-911.084) (-912.513) -- 0:00:51 Average standard deviation of split frequencies: 0.020749 150500 -- (-915.503) (-913.095) [-913.230] (-910.781) * (-913.232) (-912.002) (-911.882) [-910.768] -- 0:00:50 151000 -- [-910.996] (-911.792) (-917.479) (-910.987) * [-912.579] (-913.863) (-914.235) (-910.488) -- 0:00:50 151500 -- (-911.518) [-910.892] (-915.335) (-916.293) * (-915.265) (-914.381) [-911.666] (-910.436) -- 0:00:50 152000 -- (-911.890) (-911.855) (-911.713) [-911.421] * [-912.308] (-915.865) (-910.233) (-912.471) -- 0:00:50 152500 -- (-913.225) (-913.899) [-911.792] (-913.421) * (-910.976) (-913.022) (-910.819) [-910.128] -- 0:00:50 153000 -- (-910.192) (-913.249) (-911.849) [-910.904] * (-909.698) (-911.908) (-914.601) [-913.185] -- 0:00:49 153500 -- (-910.176) [-911.006] (-910.886) (-915.322) * (-917.599) (-916.628) (-911.608) [-910.650] -- 0:00:49 154000 -- (-910.577) [-910.424] (-911.759) (-912.296) * [-911.484] (-912.328) (-917.894) (-909.839) -- 0:00:49 154500 -- (-914.549) (-910.459) [-911.111] (-910.580) * (-913.380) (-911.027) (-915.036) [-911.079] -- 0:00:49 155000 -- (-912.841) (-911.770) [-909.847] (-910.216) * [-913.402] (-911.839) (-911.277) (-915.242) -- 0:00:49 Average standard deviation of split frequencies: 0.023872 155500 -- (-915.882) [-912.597] (-914.031) (-910.632) * (-913.288) (-912.205) (-914.509) [-914.548] -- 0:00:48 156000 -- (-912.492) (-912.094) (-913.393) [-910.300] * [-913.789] (-911.961) (-914.045) (-912.917) -- 0:00:54 156500 -- [-913.530] (-912.449) (-914.159) (-912.831) * (-911.900) (-909.675) (-912.694) [-916.626] -- 0:00:53 157000 -- (-914.401) (-911.108) [-915.747] (-912.244) * [-912.118] (-910.055) (-912.698) (-911.943) -- 0:00:53 157500 -- [-916.487] (-912.804) (-917.028) (-911.906) * [-913.349] (-911.881) (-910.263) (-910.675) -- 0:00:53 158000 -- (-913.399) (-911.344) [-911.634] (-912.075) * [-915.302] (-910.819) (-914.116) (-912.943) -- 0:00:53 158500 -- [-913.812] (-912.052) (-913.255) (-913.712) * [-914.454] (-913.665) (-914.019) (-913.662) -- 0:00:53 159000 -- [-912.786] (-912.935) (-917.618) (-910.916) * (-912.967) [-913.764] (-912.696) (-911.104) -- 0:00:52 159500 -- [-913.965] (-910.504) (-916.339) (-910.314) * (-913.357) (-913.974) [-915.661] (-912.671) -- 0:00:52 160000 -- (-913.968) [-911.548] (-912.837) (-910.304) * (-914.603) (-912.491) [-916.284] (-910.876) -- 0:00:52 Average standard deviation of split frequencies: 0.022592 160500 -- (-913.104) (-914.241) (-910.950) [-910.594] * (-913.275) (-912.124) (-909.918) [-910.009] -- 0:00:52 161000 -- (-913.326) (-912.602) (-910.479) [-914.779] * (-914.667) (-911.643) [-913.650] (-912.031) -- 0:00:52 161500 -- [-912.182] (-912.012) (-913.094) (-910.295) * (-914.496) (-909.865) (-910.548) [-912.062] -- 0:00:51 162000 -- (-912.334) (-915.189) [-911.189] (-911.679) * (-911.729) (-909.835) (-914.623) [-912.171] -- 0:00:51 162500 -- (-914.436) (-912.305) [-912.362] (-910.357) * (-911.483) (-912.370) [-910.623] (-910.932) -- 0:00:51 163000 -- (-911.284) [-910.423] (-910.811) (-910.152) * (-911.649) [-914.640] (-910.553) (-912.881) -- 0:00:51 163500 -- (-910.959) (-914.199) [-911.970] (-910.090) * (-911.018) (-911.434) [-911.689] (-912.477) -- 0:00:51 164000 -- (-911.846) (-914.642) [-909.974] (-910.478) * [-915.178] (-909.768) (-913.385) (-913.160) -- 0:00:50 164500 -- (-910.806) (-914.588) [-910.474] (-910.041) * (-913.340) [-909.823] (-915.165) (-916.739) -- 0:00:50 165000 -- [-911.756] (-913.591) (-910.709) (-911.213) * (-916.118) [-911.496] (-911.210) (-918.188) -- 0:00:50 Average standard deviation of split frequencies: 0.020446 165500 -- (-912.296) (-912.838) [-910.717] (-913.633) * (-911.692) [-911.555] (-914.334) (-912.395) -- 0:00:50 166000 -- (-911.291) (-911.963) [-914.158] (-910.370) * (-915.334) [-913.224] (-918.679) (-910.798) -- 0:00:50 166500 -- (-914.592) [-910.646] (-913.177) (-915.207) * (-914.787) (-913.763) [-912.460] (-912.462) -- 0:00:50 167000 -- (-910.499) [-909.974] (-910.062) (-913.670) * (-914.017) (-913.626) (-913.735) [-911.640] -- 0:00:49 167500 -- [-912.875] (-910.713) (-912.977) (-913.074) * (-912.727) (-912.258) (-912.999) [-911.390] -- 0:00:49 168000 -- (-910.808) (-912.614) [-914.763] (-915.010) * [-914.238] (-915.443) (-910.864) (-911.037) -- 0:00:49 168500 -- (-910.993) (-914.423) (-921.444) [-911.527] * (-911.175) (-912.447) (-911.568) [-910.255] -- 0:00:49 169000 -- (-910.545) (-918.011) [-913.199] (-911.992) * [-911.761] (-911.517) (-912.780) (-917.048) -- 0:00:49 169500 -- (-912.742) (-922.857) [-910.895] (-912.336) * (-911.762) (-913.924) (-911.647) [-916.052] -- 0:00:48 170000 -- (-913.321) [-914.324] (-910.879) (-910.668) * (-912.331) [-914.366] (-912.355) (-914.600) -- 0:00:48 Average standard deviation of split frequencies: 0.019887 170500 -- [-912.196] (-911.898) (-909.914) (-913.205) * (-912.363) (-911.723) [-912.077] (-910.497) -- 0:00:48 171000 -- (-912.174) (-911.923) [-911.395] (-914.193) * [-916.304] (-910.536) (-911.296) (-911.664) -- 0:00:48 171500 -- (-912.418) (-910.423) (-913.477) [-914.888] * (-914.680) (-910.958) (-915.990) [-912.026] -- 0:00:48 172000 -- (-910.638) (-910.928) (-910.401) [-911.327] * (-912.783) [-914.421] (-914.002) (-911.561) -- 0:00:48 172500 -- (-910.892) (-915.359) [-911.170] (-913.083) * (-912.122) (-914.653) (-914.087) [-910.679] -- 0:00:52 173000 -- (-911.180) (-912.617) (-912.302) [-913.291] * (-911.729) (-912.071) (-915.036) [-913.365] -- 0:00:52 173500 -- (-912.867) [-913.946] (-910.632) (-913.420) * (-911.658) (-910.820) (-911.783) [-912.185] -- 0:00:52 174000 -- [-911.024] (-915.779) (-914.365) (-911.507) * (-910.670) (-911.432) (-913.129) [-912.487] -- 0:00:52 174500 -- [-911.266] (-910.205) (-910.820) (-915.339) * (-909.760) (-913.014) (-912.761) [-913.451] -- 0:00:52 175000 -- (-912.247) (-910.149) (-911.860) [-910.068] * (-911.475) (-911.210) [-912.162] (-910.239) -- 0:00:51 Average standard deviation of split frequencies: 0.018326 175500 -- (-915.150) [-910.183] (-912.352) (-911.096) * (-915.862) (-910.631) (-913.229) [-912.332] -- 0:00:51 176000 -- [-915.245] (-911.677) (-915.254) (-910.981) * (-914.692) [-910.217] (-912.094) (-911.384) -- 0:00:51 176500 -- (-914.367) (-911.672) [-913.341] (-910.733) * (-910.288) (-910.220) [-911.201] (-913.890) -- 0:00:51 177000 -- [-911.909] (-910.825) (-915.452) (-911.405) * (-910.971) (-910.135) (-913.611) [-914.125] -- 0:00:51 177500 -- (-912.058) (-912.582) (-913.009) [-911.734] * (-910.761) (-910.202) [-911.609] (-910.290) -- 0:00:50 178000 -- (-913.662) (-911.519) (-912.241) [-910.528] * [-914.822] (-912.135) (-911.141) (-912.681) -- 0:00:50 178500 -- (-913.056) [-912.739] (-912.864) (-911.596) * (-912.949) (-917.434) [-911.197] (-913.807) -- 0:00:50 179000 -- [-911.737] (-912.868) (-913.830) (-911.716) * (-922.982) [-914.024] (-913.130) (-915.055) -- 0:00:50 179500 -- (-911.603) (-913.838) (-913.969) [-915.403] * (-911.824) (-913.626) (-913.631) [-912.075] -- 0:00:50 180000 -- (-910.027) (-915.692) (-913.434) [-912.197] * (-911.137) (-913.131) (-912.854) [-911.057] -- 0:00:50 Average standard deviation of split frequencies: 0.017303 180500 -- [-912.733] (-911.801) (-912.845) (-911.052) * [-912.409] (-917.976) (-913.431) (-910.426) -- 0:00:49 181000 -- [-910.259] (-915.356) (-913.202) (-911.816) * (-912.643) (-910.943) [-910.480] (-913.237) -- 0:00:49 181500 -- (-912.862) [-913.478] (-910.329) (-910.727) * (-912.584) (-913.770) (-910.629) [-914.521] -- 0:00:49 182000 -- [-917.409] (-913.837) (-911.034) (-911.648) * (-912.507) (-912.950) [-910.793] (-914.416) -- 0:00:49 182500 -- (-912.365) (-913.841) (-911.349) [-912.131] * (-914.305) (-917.754) (-911.885) [-914.329] -- 0:00:49 183000 -- (-911.239) (-914.017) (-911.867) [-910.314] * (-911.947) (-918.141) [-912.406] (-914.739) -- 0:00:49 183500 -- (-910.656) (-912.064) (-911.732) [-910.065] * [-912.018] (-914.604) (-912.536) (-912.356) -- 0:00:48 184000 -- (-914.188) [-912.361] (-911.338) (-910.846) * (-912.081) [-914.180] (-913.699) (-911.594) -- 0:00:48 184500 -- (-913.911) (-913.548) [-914.705] (-915.222) * [-913.376] (-912.098) (-912.082) (-915.803) -- 0:00:48 185000 -- [-911.292] (-916.058) (-911.994) (-910.847) * [-911.299] (-917.579) (-911.481) (-918.333) -- 0:00:48 Average standard deviation of split frequencies: 0.019135 185500 -- (-910.558) [-910.690] (-913.658) (-909.677) * (-914.636) (-910.165) (-915.505) [-912.214] -- 0:00:48 186000 -- (-915.807) [-909.943] (-913.198) (-911.443) * (-914.459) (-909.765) [-913.800] (-909.987) -- 0:00:48 186500 -- (-910.576) (-910.234) (-913.513) [-910.054] * [-910.070] (-911.585) (-912.026) (-918.787) -- 0:00:47 187000 -- (-919.283) (-910.492) [-911.187] (-911.145) * [-910.048] (-910.787) (-912.867) (-914.560) -- 0:00:47 187500 -- (-910.851) (-911.287) [-911.829] (-909.621) * (-914.393) [-909.913] (-911.703) (-910.385) -- 0:00:47 188000 -- (-911.076) (-911.377) (-912.327) [-911.450] * [-910.535] (-916.116) (-910.687) (-910.090) -- 0:00:47 188500 -- (-915.027) [-910.947] (-914.250) (-920.086) * (-916.365) (-915.385) [-914.779] (-911.451) -- 0:00:47 189000 -- (-911.704) [-912.447] (-917.568) (-912.364) * (-914.019) (-911.148) [-911.439] (-913.083) -- 0:00:51 189500 -- (-911.643) (-911.414) [-912.841] (-917.993) * (-909.714) [-911.891] (-912.422) (-913.883) -- 0:00:51 190000 -- [-911.519] (-914.549) (-914.963) (-911.926) * (-910.917) (-911.350) (-912.677) [-912.795] -- 0:00:51 Average standard deviation of split frequencies: 0.020768 190500 -- [-910.687] (-913.927) (-910.585) (-914.300) * (-911.354) (-911.827) [-913.739] (-911.641) -- 0:00:50 191000 -- (-910.000) (-916.646) (-909.685) [-914.259] * (-911.738) [-910.617] (-911.038) (-913.471) -- 0:00:50 191500 -- (-911.318) [-916.585] (-912.180) (-914.644) * (-911.947) (-910.105) (-910.476) [-913.213] -- 0:00:50 192000 -- (-911.320) (-914.483) [-912.388] (-911.322) * (-910.480) (-912.026) [-914.862] (-911.351) -- 0:00:50 192500 -- (-910.246) (-915.040) [-913.816] (-910.255) * (-910.591) (-911.291) (-914.287) [-912.172] -- 0:00:50 193000 -- (-910.050) (-910.404) (-911.366) [-910.327] * (-914.257) [-912.087] (-912.827) (-913.974) -- 0:00:50 193500 -- [-911.129] (-912.738) (-911.149) (-912.659) * (-918.618) (-911.230) [-910.531] (-912.094) -- 0:00:50 194000 -- (-912.440) [-911.173] (-914.293) (-913.212) * (-912.215) [-910.467] (-913.055) (-911.401) -- 0:00:49 194500 -- (-911.928) (-913.874) (-913.852) [-910.706] * (-914.862) (-910.467) (-914.358) [-914.098] -- 0:00:49 195000 -- (-911.081) [-912.722] (-910.478) (-914.528) * (-916.230) [-911.188] (-913.252) (-913.117) -- 0:00:49 Average standard deviation of split frequencies: 0.019963 195500 -- (-911.293) [-912.371] (-910.809) (-912.343) * (-915.142) (-912.797) (-911.971) [-911.334] -- 0:00:49 196000 -- (-913.445) (-909.615) (-911.697) [-912.321] * (-912.686) [-909.808] (-911.667) (-911.626) -- 0:00:49 196500 -- (-911.234) [-909.925] (-912.958) (-914.506) * (-918.293) (-911.741) [-910.636] (-912.562) -- 0:00:49 197000 -- (-914.430) (-912.333) [-910.465] (-911.833) * (-923.685) (-911.741) (-910.985) [-912.675] -- 0:00:48 197500 -- (-913.267) (-913.220) [-911.074] (-912.419) * [-912.060] (-912.673) (-911.421) (-910.190) -- 0:00:48 198000 -- (-917.623) (-911.057) [-913.613] (-913.473) * (-911.017) [-911.274] (-910.823) (-912.349) -- 0:00:48 198500 -- (-915.998) (-914.258) (-913.101) [-910.595] * (-910.877) (-910.636) (-911.462) [-912.356] -- 0:00:48 199000 -- (-915.407) (-913.383) (-910.918) [-911.546] * (-912.321) [-910.748] (-911.678) (-911.908) -- 0:00:48 199500 -- (-909.597) (-911.921) (-910.875) [-911.893] * [-911.137] (-913.187) (-915.332) (-911.414) -- 0:00:48 200000 -- (-909.575) [-915.920] (-911.674) (-913.455) * (-913.524) (-912.605) [-913.519] (-911.929) -- 0:00:48 Average standard deviation of split frequencies: 0.018676 200500 -- (-912.786) (-911.185) (-913.320) [-913.835] * (-917.911) (-911.204) (-915.339) [-911.940] -- 0:00:47 201000 -- (-912.622) [-911.362] (-911.575) (-912.325) * [-912.828] (-912.303) (-913.837) (-913.221) -- 0:00:47 201500 -- [-911.537] (-912.469) (-914.312) (-911.626) * (-910.512) [-912.323] (-914.152) (-918.479) -- 0:00:47 202000 -- (-910.714) (-912.198) (-916.196) [-911.272] * (-916.647) (-914.626) [-911.941] (-916.473) -- 0:00:47 202500 -- (-911.259) (-912.236) (-913.987) [-912.972] * (-914.051) (-917.142) [-912.525] (-915.484) -- 0:00:47 203000 -- [-910.251] (-912.871) (-911.947) (-910.684) * (-918.859) (-915.008) (-913.080) [-912.853] -- 0:00:47 203500 -- (-910.186) (-915.431) (-916.052) [-912.934] * (-910.241) (-914.813) (-919.388) [-910.584] -- 0:00:46 204000 -- (-910.929) (-913.912) [-912.891] (-912.217) * (-911.932) [-912.222] (-915.519) (-911.672) -- 0:00:46 204500 -- [-910.252] (-913.261) (-913.726) (-914.063) * [-913.427] (-912.900) (-912.130) (-915.011) -- 0:00:46 205000 -- (-911.750) (-911.617) [-912.028] (-912.352) * [-911.520] (-916.493) (-911.816) (-917.051) -- 0:00:50 Average standard deviation of split frequencies: 0.018421 205500 -- (-915.149) (-911.887) [-910.052] (-910.851) * (-913.776) (-912.653) [-912.895] (-913.069) -- 0:00:50 206000 -- (-911.707) [-912.579] (-911.623) (-913.756) * (-914.858) [-910.749] (-911.483) (-913.598) -- 0:00:50 206500 -- (-914.770) (-913.657) [-909.971] (-912.741) * [-912.931] (-911.432) (-914.237) (-910.882) -- 0:00:49 207000 -- (-913.411) [-911.162] (-909.876) (-910.981) * (-910.632) (-912.727) (-912.408) [-910.197] -- 0:00:49 207500 -- (-912.860) [-910.813] (-910.762) (-911.696) * (-911.623) (-910.405) [-910.170] (-912.010) -- 0:00:49 208000 -- (-912.698) (-910.898) [-911.634] (-913.712) * (-910.179) (-910.968) [-914.617] (-914.584) -- 0:00:49 208500 -- (-912.470) (-911.877) (-911.906) [-911.234] * [-911.677] (-909.674) (-914.725) (-914.063) -- 0:00:49 209000 -- (-917.864) (-911.384) (-910.253) [-914.121] * (-911.574) [-911.126] (-911.536) (-913.777) -- 0:00:49 209500 -- (-914.761) (-911.832) [-910.208] (-913.232) * (-917.812) (-911.079) [-910.272] (-911.775) -- 0:00:49 210000 -- (-913.542) (-910.691) (-910.767) [-912.106] * (-920.196) [-911.962] (-913.622) (-910.311) -- 0:00:48 Average standard deviation of split frequencies: 0.018844 210500 -- [-914.630] (-909.687) (-912.124) (-911.871) * (-910.021) (-912.946) (-911.692) [-914.623] -- 0:00:48 211000 -- (-912.582) [-909.781] (-911.615) (-913.051) * (-910.401) [-911.208] (-914.338) (-916.243) -- 0:00:48 211500 -- [-912.135] (-910.857) (-911.725) (-914.060) * (-912.778) (-912.821) (-914.722) [-910.831] -- 0:00:48 212000 -- (-911.861) (-914.780) (-911.392) [-911.608] * (-913.269) [-914.845] (-916.488) (-911.375) -- 0:00:48 212500 -- [-911.349] (-913.953) (-910.970) (-913.453) * (-912.546) (-911.730) (-912.749) [-910.971] -- 0:00:48 213000 -- (-912.306) (-913.133) [-910.550] (-911.012) * (-910.946) [-911.154] (-917.474) (-909.970) -- 0:00:48 213500 -- [-913.288] (-910.678) (-912.239) (-912.495) * (-911.041) [-911.817] (-915.411) (-913.690) -- 0:00:47 214000 -- (-913.721) [-911.035] (-917.002) (-913.440) * [-912.560] (-913.525) (-913.712) (-911.152) -- 0:00:47 214500 -- (-914.472) (-911.051) (-911.253) [-911.149] * [-912.518] (-909.805) (-912.324) (-910.249) -- 0:00:47 215000 -- [-912.344] (-912.458) (-912.409) (-912.924) * (-911.153) (-910.192) (-913.781) [-909.951] -- 0:00:47 Average standard deviation of split frequencies: 0.016974 215500 -- (-913.114) (-911.467) (-913.095) [-914.603] * (-914.309) (-912.774) (-911.492) [-915.717] -- 0:00:47 216000 -- (-914.158) (-911.456) [-911.322] (-910.940) * (-913.898) [-913.748] (-910.630) (-914.872) -- 0:00:47 216500 -- (-913.511) [-914.392] (-911.966) (-912.312) * [-912.903] (-913.974) (-910.034) (-915.390) -- 0:00:47 217000 -- (-917.932) [-911.874] (-913.012) (-912.646) * [-915.709] (-911.703) (-911.399) (-913.586) -- 0:00:46 217500 -- (-914.699) (-910.757) (-912.703) [-910.273] * [-916.513] (-910.185) (-910.598) (-918.035) -- 0:00:46 218000 -- (-914.408) [-911.954] (-911.543) (-911.155) * (-912.730) [-910.134] (-913.694) (-912.626) -- 0:00:46 218500 -- [-915.141] (-910.561) (-913.032) (-912.872) * (-909.987) [-909.984] (-912.422) (-913.985) -- 0:00:46 219000 -- [-914.173] (-912.798) (-911.556) (-914.610) * [-914.210] (-913.572) (-912.963) (-913.477) -- 0:00:46 219500 -- [-913.689] (-911.128) (-912.943) (-913.008) * (-911.929) (-910.241) [-911.343] (-911.279) -- 0:00:46 220000 -- (-912.085) (-913.157) (-919.302) [-911.784] * (-914.303) (-911.242) [-909.916] (-912.162) -- 0:00:46 Average standard deviation of split frequencies: 0.016022 220500 -- (-912.189) [-912.998] (-913.886) (-911.312) * (-912.464) [-911.840] (-910.695) (-912.676) -- 0:00:45 221000 -- (-913.369) (-910.140) [-911.418] (-915.006) * [-913.001] (-911.412) (-911.021) (-910.723) -- 0:00:45 221500 -- (-916.028) [-910.144] (-911.603) (-916.396) * (-911.584) (-916.099) (-912.392) [-910.555] -- 0:00:49 222000 -- (-913.266) (-912.063) [-910.307] (-912.427) * (-912.624) (-911.864) [-910.992] (-914.469) -- 0:00:49 222500 -- (-912.490) (-911.765) [-910.242] (-910.003) * (-911.423) (-913.444) (-913.975) [-911.059] -- 0:00:48 223000 -- (-915.236) [-911.673] (-914.282) (-913.215) * [-910.049] (-912.491) (-913.776) (-913.540) -- 0:00:48 223500 -- [-911.983] (-912.643) (-911.619) (-913.810) * (-912.947) (-914.312) [-912.323] (-911.050) -- 0:00:48 224000 -- (-910.964) (-912.957) (-911.920) [-913.488] * (-911.170) (-910.482) [-912.650] (-910.842) -- 0:00:48 224500 -- (-913.829) (-910.126) [-913.316] (-910.935) * (-913.032) [-910.099] (-912.751) (-913.221) -- 0:00:48 225000 -- (-913.358) (-912.429) (-912.539) [-914.135] * (-911.284) (-910.956) (-912.269) [-910.265] -- 0:00:48 Average standard deviation of split frequencies: 0.016223 225500 -- [-912.111] (-912.905) (-912.057) (-916.705) * (-911.950) (-910.503) [-912.039] (-909.820) -- 0:00:48 226000 -- [-911.903] (-914.052) (-911.193) (-918.212) * (-916.280) [-916.203] (-910.495) (-911.884) -- 0:00:47 226500 -- (-913.717) [-911.773] (-911.566) (-913.261) * [-917.182] (-913.584) (-912.587) (-909.863) -- 0:00:47 227000 -- (-914.532) (-911.760) [-910.727] (-912.578) * [-915.583] (-910.506) (-912.951) (-913.151) -- 0:00:47 227500 -- [-910.836] (-913.114) (-910.541) (-911.883) * [-910.676] (-910.360) (-912.581) (-910.409) -- 0:00:47 228000 -- (-912.196) [-911.370] (-911.951) (-911.802) * (-913.006) (-910.200) [-910.965] (-911.879) -- 0:00:47 228500 -- (-912.158) (-913.834) (-912.144) [-910.787] * (-911.508) (-911.697) [-909.837] (-913.007) -- 0:00:47 229000 -- (-911.581) (-912.986) (-912.035) [-911.883] * (-912.214) (-912.668) (-911.679) [-911.663] -- 0:00:47 229500 -- (-914.721) (-910.674) (-913.915) [-911.816] * (-912.983) (-915.567) (-911.793) [-910.934] -- 0:00:47 230000 -- (-918.644) (-911.081) (-913.418) [-911.012] * (-911.559) [-911.688] (-914.032) (-913.434) -- 0:00:46 Average standard deviation of split frequencies: 0.016690 230500 -- [-910.810] (-911.034) (-914.275) (-910.938) * [-911.777] (-910.228) (-913.231) (-916.614) -- 0:00:46 231000 -- [-910.094] (-912.068) (-913.475) (-910.285) * (-912.306) (-911.346) (-910.338) [-913.926] -- 0:00:46 231500 -- (-913.270) [-911.829] (-913.631) (-912.882) * (-910.905) (-913.924) (-910.358) [-912.472] -- 0:00:46 232000 -- (-911.602) [-910.680] (-912.384) (-910.120) * (-915.480) (-911.977) (-911.068) [-910.169] -- 0:00:46 232500 -- (-912.333) (-909.975) [-910.366] (-911.535) * (-911.351) (-911.081) [-909.830] (-909.809) -- 0:00:46 233000 -- (-912.071) [-910.584] (-914.432) (-914.181) * (-914.098) (-910.521) (-912.529) [-913.301] -- 0:00:46 233500 -- (-911.188) [-910.695] (-916.133) (-911.967) * [-913.860] (-910.932) (-912.066) (-912.249) -- 0:00:45 234000 -- (-913.607) [-912.541] (-914.007) (-914.231) * (-910.820) [-909.990] (-912.117) (-917.643) -- 0:00:45 234500 -- (-913.187) (-911.926) (-913.179) [-912.580] * (-910.839) (-909.671) (-913.596) [-912.631] -- 0:00:45 235000 -- [-909.984] (-912.745) (-910.437) (-910.315) * (-914.108) [-913.582] (-912.446) (-914.907) -- 0:00:45 Average standard deviation of split frequencies: 0.016091 235500 -- (-910.941) (-913.237) (-910.604) [-910.968] * (-910.815) (-912.884) (-914.305) [-912.142] -- 0:00:45 236000 -- (-910.645) (-913.814) (-909.530) [-910.194] * (-912.107) (-915.600) [-914.641] (-911.749) -- 0:00:45 236500 -- (-911.838) (-911.323) (-909.920) [-910.466] * [-911.615] (-917.019) (-914.797) (-913.322) -- 0:00:45 237000 -- (-910.809) [-911.187] (-909.646) (-912.757) * [-912.398] (-916.330) (-911.742) (-912.332) -- 0:00:45 237500 -- (-910.206) (-911.319) [-910.030] (-911.789) * (-913.213) [-910.933] (-912.553) (-910.945) -- 0:00:44 238000 -- [-911.621] (-912.268) (-911.006) (-913.643) * (-910.768) (-915.469) [-911.153] (-914.079) -- 0:00:48 238500 -- (-913.184) [-909.969] (-911.801) (-914.463) * (-911.845) (-913.189) (-912.881) [-913.439] -- 0:00:47 239000 -- (-911.521) (-909.858) [-912.694] (-912.692) * [-912.243] (-911.551) (-912.154) (-913.391) -- 0:00:47 239500 -- (-913.442) (-909.842) (-913.844) [-911.901] * (-911.124) (-913.838) (-910.043) [-911.556] -- 0:00:47 240000 -- (-911.286) [-911.586] (-911.096) (-912.875) * (-910.457) [-911.735] (-910.043) (-914.461) -- 0:00:47 Average standard deviation of split frequencies: 0.015670 240500 -- [-910.276] (-912.271) (-911.157) (-914.796) * (-912.734) [-911.905] (-909.995) (-912.480) -- 0:00:47 241000 -- (-914.127) (-912.370) (-911.036) [-912.699] * [-911.476] (-910.449) (-909.995) (-911.899) -- 0:00:47 241500 -- [-914.449] (-912.226) (-911.466) (-912.069) * (-911.807) (-913.524) [-909.992] (-913.351) -- 0:00:47 242000 -- [-912.142] (-912.214) (-911.332) (-912.429) * [-912.088] (-911.839) (-913.958) (-912.313) -- 0:00:46 242500 -- (-911.961) [-910.454] (-913.329) (-914.743) * (-910.950) (-913.709) [-914.245] (-915.279) -- 0:00:46 243000 -- (-917.328) (-910.454) [-910.846] (-914.788) * (-913.597) [-911.877] (-910.627) (-916.812) -- 0:00:46 243500 -- (-913.888) [-909.827] (-914.961) (-910.102) * (-915.536) (-914.440) [-910.620] (-916.455) -- 0:00:46 244000 -- (-915.498) (-911.273) [-913.096] (-910.127) * (-913.007) [-914.051] (-912.337) (-912.266) -- 0:00:46 244500 -- [-911.146] (-912.151) (-911.176) (-911.251) * (-910.242) (-916.407) [-913.151] (-910.759) -- 0:00:46 245000 -- (-912.850) [-910.170] (-911.616) (-911.017) * (-910.874) [-911.385] (-914.421) (-910.774) -- 0:00:46 Average standard deviation of split frequencies: 0.015028 245500 -- [-914.113] (-914.163) (-912.672) (-911.813) * [-916.954] (-914.626) (-913.465) (-910.528) -- 0:00:46 246000 -- [-912.994] (-913.508) (-910.349) (-910.977) * [-911.797] (-912.107) (-912.505) (-911.317) -- 0:00:45 246500 -- [-913.640] (-911.894) (-910.510) (-914.417) * (-910.342) (-911.885) [-914.824] (-911.504) -- 0:00:45 247000 -- (-915.327) (-911.748) [-911.283] (-911.385) * (-911.184) (-910.675) (-916.246) [-911.767] -- 0:00:45 247500 -- (-911.158) (-913.154) (-911.040) [-911.416] * [-916.912] (-914.120) (-919.658) (-911.067) -- 0:00:45 248000 -- (-911.695) (-914.776) [-914.856] (-912.180) * (-911.485) [-912.988] (-916.829) (-911.568) -- 0:00:45 248500 -- (-914.455) (-911.759) [-914.280] (-913.355) * (-911.296) (-910.813) [-915.850] (-916.287) -- 0:00:45 249000 -- (-914.115) [-912.221] (-911.300) (-911.848) * (-910.141) [-912.646] (-911.018) (-912.573) -- 0:00:45 249500 -- (-916.050) (-911.886) (-915.217) [-912.577] * (-913.380) [-911.199] (-916.841) (-914.469) -- 0:00:45 250000 -- (-913.377) [-911.155] (-913.491) (-913.090) * (-912.780) (-910.782) [-910.242] (-913.579) -- 0:00:45 Average standard deviation of split frequencies: 0.014313 250500 -- (-913.956) [-910.659] (-913.780) (-910.414) * (-915.265) (-910.732) (-912.032) [-912.606] -- 0:00:44 251000 -- (-913.785) [-911.416] (-911.364) (-912.122) * (-910.131) (-911.105) [-912.432] (-913.487) -- 0:00:44 251500 -- (-912.782) (-910.899) [-911.429] (-914.299) * (-910.642) (-911.533) [-912.447] (-912.017) -- 0:00:44 252000 -- [-911.222] (-911.011) (-910.527) (-912.101) * (-912.095) [-911.284] (-911.752) (-911.340) -- 0:00:44 252500 -- (-912.567) [-912.320] (-911.664) (-912.967) * (-911.483) (-913.211) (-910.282) [-910.469] -- 0:00:44 253000 -- (-910.371) [-911.447] (-912.433) (-911.632) * [-913.802] (-911.633) (-912.711) (-913.491) -- 0:00:44 253500 -- (-911.930) (-911.939) (-912.968) [-911.062] * (-911.936) (-911.547) (-912.393) [-913.110] -- 0:00:44 254000 -- (-910.981) [-913.914] (-911.981) (-911.008) * [-915.079] (-912.919) (-911.327) (-912.060) -- 0:00:44 254500 -- (-911.810) (-911.163) (-911.082) [-913.940] * (-915.029) (-910.879) [-911.969] (-911.496) -- 0:00:46 255000 -- (-911.229) [-911.533] (-910.740) (-919.338) * (-911.851) (-912.118) (-909.973) [-911.903] -- 0:00:46 Average standard deviation of split frequencies: 0.013811 255500 -- (-911.277) (-912.610) [-911.919] (-914.821) * [-911.086] (-912.127) (-912.371) (-911.019) -- 0:00:46 256000 -- (-914.746) [-912.252] (-910.347) (-919.043) * (-910.907) (-912.099) (-912.749) [-910.080] -- 0:00:46 256500 -- (-912.438) [-912.960] (-910.494) (-912.620) * (-910.518) (-910.150) (-913.949) [-912.848] -- 0:00:46 257000 -- (-911.278) (-910.513) [-911.160] (-915.377) * (-911.015) (-913.885) (-914.769) [-910.048] -- 0:00:46 257500 -- (-912.197) [-910.393] (-910.809) (-912.728) * (-910.974) (-910.510) (-914.315) [-912.130] -- 0:00:46 258000 -- [-910.759] (-911.215) (-917.321) (-911.498) * (-914.160) (-910.666) (-913.181) [-911.062] -- 0:00:46 258500 -- (-910.943) (-914.569) (-910.115) [-911.957] * (-911.094) (-912.175) [-912.585] (-911.473) -- 0:00:45 259000 -- (-910.213) (-914.768) [-910.282] (-911.197) * (-911.027) (-911.512) [-912.598] (-914.933) -- 0:00:45 259500 -- (-911.104) (-911.873) (-911.497) [-912.762] * (-911.278) (-910.967) (-911.702) [-911.209] -- 0:00:45 260000 -- [-910.744] (-910.184) (-911.517) (-912.087) * (-912.007) (-912.318) (-910.723) [-911.609] -- 0:00:45 Average standard deviation of split frequencies: 0.013897 260500 -- (-911.458) (-910.477) (-910.586) [-910.445] * (-912.823) [-911.477] (-910.225) (-914.373) -- 0:00:45 261000 -- (-913.164) [-910.379] (-911.401) (-911.311) * (-913.003) (-914.863) [-912.548] (-914.221) -- 0:00:45 261500 -- (-910.189) [-910.307] (-911.497) (-911.334) * (-911.677) (-910.530) (-910.109) [-916.590] -- 0:00:45 262000 -- (-913.650) (-911.694) (-910.824) [-909.949] * (-912.533) (-911.998) [-909.965] (-912.298) -- 0:00:45 262500 -- (-911.075) (-912.109) (-911.272) [-910.029] * [-913.783] (-909.980) (-910.853) (-910.994) -- 0:00:44 263000 -- [-909.998] (-910.957) (-912.022) (-910.064) * (-912.204) [-910.490] (-909.799) (-910.958) -- 0:00:44 263500 -- (-910.687) (-913.496) (-910.727) [-909.847] * [-912.515] (-910.644) (-913.022) (-914.571) -- 0:00:44 264000 -- [-911.619] (-912.904) (-910.757) (-910.897) * [-910.483] (-913.914) (-913.114) (-912.758) -- 0:00:44 264500 -- (-911.054) (-910.406) [-911.638] (-913.413) * (-911.243) (-911.388) [-915.830] (-916.984) -- 0:00:44 265000 -- (-913.352) (-911.538) [-911.548] (-913.264) * [-909.854] (-911.698) (-910.263) (-915.334) -- 0:00:44 Average standard deviation of split frequencies: 0.013618 265500 -- [-912.729] (-912.576) (-910.177) (-913.274) * (-911.788) (-913.343) (-911.978) [-916.653] -- 0:00:44 266000 -- (-916.550) (-912.944) (-913.894) [-912.018] * (-910.823) [-910.570] (-911.936) (-912.927) -- 0:00:44 266500 -- (-910.764) (-913.864) [-914.861] (-915.296) * (-912.014) [-910.348] (-911.210) (-913.328) -- 0:00:44 267000 -- (-911.568) (-913.375) [-913.768] (-910.774) * (-913.820) [-911.275] (-910.611) (-913.500) -- 0:00:43 267500 -- (-910.863) (-911.741) [-910.382] (-910.389) * (-912.001) (-913.750) [-911.590] (-912.486) -- 0:00:43 268000 -- (-911.082) (-910.491) [-911.871] (-911.991) * [-911.495] (-915.025) (-914.582) (-910.193) -- 0:00:43 268500 -- (-910.900) (-910.454) [-915.861] (-912.089) * (-909.986) (-924.448) (-911.389) [-911.144] -- 0:00:43 269000 -- (-910.392) (-912.187) (-914.038) [-914.561] * [-910.490] (-914.732) (-913.752) (-911.746) -- 0:00:43 269500 -- [-913.007] (-912.258) (-912.729) (-912.871) * (-916.208) (-909.963) (-911.462) [-912.855] -- 0:00:43 270000 -- (-912.392) (-911.273) (-913.981) [-910.753] * (-914.068) (-914.062) [-910.242] (-911.838) -- 0:00:43 Average standard deviation of split frequencies: 0.011372 270500 -- (-910.682) (-912.003) [-911.204] (-911.681) * (-912.003) [-911.145] (-912.630) (-912.649) -- 0:00:43 271000 -- (-911.207) (-915.402) [-911.621] (-912.050) * (-911.318) (-913.613) [-913.304] (-916.303) -- 0:00:45 271500 -- (-912.600) (-911.149) (-911.382) [-914.236] * (-911.163) [-911.726] (-913.122) (-912.557) -- 0:00:45 272000 -- [-917.464] (-911.368) (-913.908) (-914.350) * (-914.926) (-913.307) [-913.302] (-910.516) -- 0:00:45 272500 -- (-912.488) [-911.348] (-914.819) (-910.806) * (-919.859) [-910.284] (-910.913) (-910.178) -- 0:00:45 273000 -- (-916.371) (-911.311) (-911.718) [-912.193] * (-916.225) (-910.940) (-911.271) [-911.165] -- 0:00:45 273500 -- (-912.575) (-914.550) [-911.442] (-913.465) * (-913.469) (-910.880) [-911.522] (-912.271) -- 0:00:45 274000 -- (-913.427) (-913.726) [-910.939] (-910.352) * (-914.507) [-910.339] (-910.285) (-911.858) -- 0:00:45 274500 -- (-912.071) (-910.466) (-911.354) [-910.503] * (-921.011) [-909.880] (-910.836) (-912.193) -- 0:00:44 275000 -- (-911.655) [-911.875] (-911.974) (-912.135) * [-911.838] (-913.945) (-913.699) (-915.598) -- 0:00:44 Average standard deviation of split frequencies: 0.011253 275500 -- (-915.800) (-909.827) (-910.395) [-910.148] * (-912.345) (-912.416) [-909.759] (-910.683) -- 0:00:44 276000 -- (-915.551) (-912.394) [-910.138] (-910.819) * (-919.419) (-912.158) (-910.580) [-910.986] -- 0:00:44 276500 -- (-920.057) (-911.747) (-911.408) [-911.714] * (-912.627) [-912.739] (-913.175) (-912.201) -- 0:00:44 277000 -- (-917.618) (-910.021) (-912.621) [-910.023] * (-912.962) (-911.229) [-913.235] (-909.904) -- 0:00:44 277500 -- (-915.168) (-911.555) (-913.966) [-909.660] * (-913.937) [-911.804] (-912.926) (-911.193) -- 0:00:44 278000 -- (-911.434) (-910.354) (-912.069) [-911.657] * (-914.331) (-913.853) [-914.808] (-910.769) -- 0:00:44 278500 -- [-912.945] (-910.494) (-913.542) (-912.047) * (-913.362) [-912.302] (-912.247) (-912.923) -- 0:00:44 279000 -- (-914.368) [-911.192] (-916.044) (-912.247) * (-911.498) [-910.127] (-914.014) (-909.883) -- 0:00:43 279500 -- [-912.802] (-912.541) (-915.877) (-913.131) * (-911.159) [-910.810] (-913.000) (-910.368) -- 0:00:43 280000 -- (-910.961) [-911.257] (-911.801) (-911.785) * [-910.172] (-912.692) (-913.666) (-911.292) -- 0:00:43 Average standard deviation of split frequencies: 0.009781 280500 -- [-911.232] (-910.296) (-911.725) (-918.941) * [-912.746] (-912.986) (-917.449) (-910.677) -- 0:00:43 281000 -- (-911.219) [-912.444] (-910.144) (-915.424) * (-914.615) (-911.967) (-913.994) [-913.409] -- 0:00:43 281500 -- [-915.171] (-916.733) (-911.564) (-910.600) * (-911.131) (-910.761) (-910.808) [-911.744] -- 0:00:43 282000 -- (-911.580) [-915.155] (-913.427) (-912.670) * (-913.246) [-911.361] (-910.335) (-916.063) -- 0:00:43 282500 -- (-914.857) (-912.058) [-912.406] (-912.694) * (-911.573) [-911.364] (-913.054) (-914.714) -- 0:00:43 283000 -- (-914.746) (-913.494) [-913.018] (-913.274) * [-911.926] (-912.940) (-910.361) (-910.486) -- 0:00:43 283500 -- (-912.575) (-913.089) (-912.718) [-910.349] * (-912.718) [-911.713] (-910.386) (-910.189) -- 0:00:42 284000 -- (-914.378) [-912.575] (-913.173) (-910.154) * (-910.317) (-911.689) (-910.244) [-912.568] -- 0:00:42 284500 -- (-914.909) (-916.567) (-913.906) [-911.935] * (-911.731) (-910.054) (-911.248) [-913.936] -- 0:00:42 285000 -- (-915.288) [-913.253] (-914.965) (-911.306) * (-912.422) (-911.985) [-910.376] (-911.635) -- 0:00:42 Average standard deviation of split frequencies: 0.009017 285500 -- [-910.684] (-912.807) (-911.091) (-912.367) * (-912.447) (-910.313) (-910.380) [-910.785] -- 0:00:42 286000 -- (-912.197) [-910.483] (-913.298) (-911.505) * (-912.353) (-911.914) (-911.728) [-913.885] -- 0:00:42 286500 -- (-911.049) (-910.466) (-911.120) [-912.414] * (-914.452) [-912.816] (-913.973) (-913.945) -- 0:00:42 287000 -- (-911.204) [-910.650] (-910.526) (-911.759) * [-910.844] (-911.413) (-914.468) (-912.142) -- 0:00:42 287500 -- (-911.298) [-912.399] (-912.541) (-910.978) * (-910.135) (-910.573) [-910.956] (-910.885) -- 0:00:44 288000 -- (-911.140) (-912.853) (-910.921) [-911.243] * (-909.936) (-910.479) [-913.632] (-910.536) -- 0:00:44 288500 -- [-911.587] (-911.180) (-912.201) (-911.945) * [-911.223] (-913.101) (-913.269) (-910.588) -- 0:00:44 289000 -- [-912.369] (-916.681) (-911.879) (-910.171) * (-911.057) (-913.653) (-915.307) [-910.322] -- 0:00:44 289500 -- (-912.977) (-920.961) (-911.216) [-913.431] * (-912.277) (-913.207) [-911.815] (-910.464) -- 0:00:44 290000 -- (-914.145) [-911.970] (-912.684) (-914.368) * [-912.717] (-912.553) (-910.941) (-915.137) -- 0:00:44 Average standard deviation of split frequencies: 0.008586 290500 -- (-916.239) (-911.003) (-911.350) [-914.170] * [-910.810] (-912.789) (-911.346) (-911.950) -- 0:00:43 291000 -- (-911.464) (-911.893) [-913.123] (-912.337) * [-911.243] (-912.465) (-917.327) (-911.475) -- 0:00:43 291500 -- (-912.071) (-911.775) [-911.329] (-914.791) * [-912.541] (-918.462) (-916.688) (-912.848) -- 0:00:43 292000 -- (-912.764) [-915.333] (-909.756) (-911.467) * (-911.421) (-919.383) [-911.977] (-911.049) -- 0:00:43 292500 -- (-911.834) (-912.175) [-909.887] (-911.560) * (-913.773) [-914.097] (-910.512) (-912.014) -- 0:00:43 293000 -- (-914.116) (-913.988) [-910.061] (-911.606) * (-911.361) (-911.125) [-910.933] (-910.820) -- 0:00:43 293500 -- (-919.420) [-912.081] (-912.533) (-913.083) * [-912.239] (-911.415) (-912.378) (-913.982) -- 0:00:43 294000 -- [-913.456] (-910.928) (-917.776) (-911.974) * (-912.726) [-910.840] (-914.700) (-911.901) -- 0:00:43 294500 -- (-910.599) [-912.037] (-911.218) (-911.789) * (-912.652) (-910.925) [-911.358] (-909.762) -- 0:00:43 295000 -- (-910.211) (-913.311) (-911.212) [-911.395] * [-910.275] (-910.661) (-910.841) (-914.475) -- 0:00:43 Average standard deviation of split frequencies: 0.008806 295500 -- (-912.317) (-912.070) (-911.154) [-910.621] * (-912.103) (-914.130) [-911.002] (-912.067) -- 0:00:42 296000 -- [-912.832] (-912.488) (-912.516) (-912.485) * (-913.760) (-913.163) (-912.374) [-913.319] -- 0:00:42 296500 -- (-916.091) (-913.175) [-913.514] (-914.256) * (-914.536) (-911.621) (-912.728) [-911.785] -- 0:00:42 297000 -- (-910.482) (-913.058) [-910.131] (-913.570) * (-911.638) (-913.921) [-910.307] (-914.110) -- 0:00:42 297500 -- (-910.323) (-910.490) [-911.082] (-911.408) * (-911.205) [-910.968] (-913.493) (-911.016) -- 0:00:42 298000 -- (-915.804) (-911.881) [-913.846] (-911.754) * (-911.466) [-910.410] (-910.794) (-910.820) -- 0:00:42 298500 -- (-914.064) (-911.769) (-916.176) [-910.263] * (-916.798) (-911.828) (-911.060) [-913.923] -- 0:00:42 299000 -- [-912.495] (-910.454) (-912.206) (-914.199) * [-911.620] (-910.961) (-910.636) (-912.823) -- 0:00:42 299500 -- (-911.877) (-910.396) (-913.867) [-911.463] * (-915.218) [-910.668] (-916.231) (-913.170) -- 0:00:42 300000 -- (-911.454) (-910.147) (-911.409) [-911.556] * [-911.119] (-911.041) (-912.768) (-913.705) -- 0:00:42 Average standard deviation of split frequencies: 0.008035 300500 -- [-909.792] (-912.345) (-914.809) (-911.793) * (-911.090) (-910.857) [-911.246] (-914.486) -- 0:00:41 301000 -- (-910.483) (-910.275) (-912.744) [-911.791] * (-911.754) (-911.790) (-911.335) [-911.634] -- 0:00:41 301500 -- (-912.605) [-912.011] (-910.573) (-912.422) * (-913.286) [-911.584] (-910.863) (-911.809) -- 0:00:41 302000 -- [-911.596] (-914.992) (-910.992) (-913.727) * (-911.411) [-910.848] (-912.470) (-913.371) -- 0:00:41 302500 -- [-911.121] (-911.448) (-910.506) (-914.538) * (-910.565) (-914.743) (-912.035) [-911.914] -- 0:00:41 303000 -- [-910.381] (-911.346) (-913.529) (-912.372) * (-910.392) (-911.360) (-914.941) [-910.669] -- 0:00:41 303500 -- (-913.433) [-911.307] (-913.506) (-915.119) * (-911.243) (-911.812) (-918.370) [-910.504] -- 0:00:43 304000 -- (-910.865) (-913.538) [-909.646] (-914.161) * (-910.496) [-911.508] (-912.347) (-912.276) -- 0:00:43 304500 -- (-910.876) (-911.715) [-911.086] (-913.764) * (-910.597) [-912.531] (-913.627) (-910.947) -- 0:00:43 305000 -- [-910.852] (-911.786) (-910.939) (-914.586) * (-910.821) [-914.316] (-910.849) (-916.593) -- 0:00:43 Average standard deviation of split frequencies: 0.010013 305500 -- (-916.649) (-910.363) [-913.629] (-913.817) * (-911.221) [-912.441] (-914.214) (-912.436) -- 0:00:43 306000 -- (-911.852) (-914.190) [-911.375] (-914.133) * [-910.977] (-912.450) (-913.573) (-910.529) -- 0:00:43 306500 -- (-912.714) (-915.086) (-917.230) [-912.501] * [-912.913] (-912.024) (-914.336) (-911.827) -- 0:00:42 307000 -- (-916.169) (-915.306) (-916.367) [-911.885] * (-911.943) (-913.712) (-914.267) [-910.562] -- 0:00:42 307500 -- (-912.726) [-912.857] (-912.133) (-911.568) * (-912.046) [-911.651] (-913.385) (-913.318) -- 0:00:42 308000 -- (-911.168) (-914.054) [-912.018] (-915.654) * (-911.890) (-913.402) [-911.396] (-913.057) -- 0:00:42 308500 -- (-910.701) [-913.212] (-912.498) (-914.835) * (-912.055) (-910.823) [-911.356] (-910.980) -- 0:00:42 309000 -- (-910.530) (-911.496) [-910.232] (-911.719) * [-914.215] (-910.848) (-915.283) (-914.986) -- 0:00:42 309500 -- (-912.347) [-911.296] (-910.118) (-912.859) * (-915.402) [-910.682] (-913.994) (-910.913) -- 0:00:42 310000 -- (-911.152) [-915.839] (-910.287) (-913.329) * (-911.891) (-910.693) [-912.955] (-914.284) -- 0:00:42 Average standard deviation of split frequencies: 0.010453 310500 -- (-913.564) (-913.422) [-912.715] (-912.787) * [-912.635] (-910.570) (-912.651) (-911.637) -- 0:00:42 311000 -- (-909.987) (-913.468) (-913.897) [-911.733] * [-910.910] (-913.528) (-910.046) (-912.179) -- 0:00:42 311500 -- (-911.825) [-912.398] (-914.579) (-912.163) * (-915.771) (-913.611) [-910.500] (-911.965) -- 0:00:41 312000 -- (-911.510) (-912.667) (-910.120) [-911.867] * [-912.340] (-913.427) (-911.507) (-911.584) -- 0:00:41 312500 -- (-911.503) (-913.816) [-910.352] (-910.939) * (-912.674) (-913.226) (-912.446) [-910.821] -- 0:00:41 313000 -- [-912.482] (-912.394) (-909.881) (-911.136) * (-912.163) (-912.413) (-911.468) [-911.339] -- 0:00:41 313500 -- (-913.748) (-914.971) [-911.198] (-915.848) * (-911.100) (-912.235) [-911.003] (-911.456) -- 0:00:41 314000 -- (-911.498) [-915.812] (-911.068) (-912.756) * (-910.465) (-914.286) [-911.061] (-916.234) -- 0:00:41 314500 -- (-910.648) (-913.760) [-911.488] (-914.512) * [-914.015] (-915.325) (-913.734) (-912.379) -- 0:00:41 315000 -- (-912.883) [-910.622] (-913.229) (-911.997) * (-913.813) (-910.927) (-911.446) [-910.597] -- 0:00:41 Average standard deviation of split frequencies: 0.011520 315500 -- (-912.213) (-910.700) [-913.975] (-911.057) * [-911.218] (-916.490) (-911.716) (-910.844) -- 0:00:41 316000 -- (-910.369) [-910.666] (-914.253) (-912.146) * (-910.886) (-912.304) [-911.509] (-910.633) -- 0:00:41 316500 -- (-910.352) [-910.224] (-913.661) (-914.604) * (-912.035) (-913.629) (-914.657) [-910.714] -- 0:00:41 317000 -- [-911.428] (-909.658) (-911.851) (-911.683) * [-910.364] (-910.070) (-915.564) (-910.241) -- 0:00:40 317500 -- (-913.130) [-911.199] (-910.959) (-913.794) * (-910.772) (-910.740) [-911.115] (-912.633) -- 0:00:40 318000 -- (-913.301) [-910.828] (-910.440) (-914.825) * (-912.546) (-910.788) [-909.840] (-911.440) -- 0:00:40 318500 -- (-911.608) [-912.770] (-911.750) (-914.333) * (-915.834) [-910.267] (-912.693) (-914.525) -- 0:00:40 319000 -- (-913.480) [-912.745] (-915.720) (-911.387) * (-911.263) (-911.681) [-909.834] (-911.717) -- 0:00:40 319500 -- (-911.785) [-913.010] (-911.304) (-911.751) * [-911.264] (-911.824) (-910.947) (-912.484) -- 0:00:40 320000 -- (-914.434) (-910.056) (-913.517) [-911.517] * (-910.647) [-911.910] (-910.753) (-911.310) -- 0:00:42 Average standard deviation of split frequencies: 0.009719 320500 -- (-910.994) (-910.112) (-911.559) [-910.433] * [-911.476] (-914.144) (-910.443) (-910.812) -- 0:00:42 321000 -- (-911.662) [-909.758] (-913.358) (-910.443) * (-911.845) (-913.085) [-913.566] (-911.308) -- 0:00:42 321500 -- (-912.785) [-909.899] (-911.422) (-913.385) * (-914.532) (-910.960) (-912.248) [-911.834] -- 0:00:42 322000 -- [-913.730] (-910.239) (-911.583) (-912.799) * (-912.611) (-912.096) (-913.195) [-911.434] -- 0:00:42 322500 -- (-912.007) [-911.303] (-911.455) (-912.703) * (-909.908) [-912.501] (-910.673) (-911.538) -- 0:00:42 323000 -- (-913.376) [-910.413] (-915.473) (-912.015) * (-910.470) [-910.813] (-913.491) (-914.336) -- 0:00:41 323500 -- (-909.986) (-911.724) [-914.772] (-913.379) * [-910.471] (-914.118) (-913.015) (-918.649) -- 0:00:41 324000 -- (-911.185) [-911.979] (-916.477) (-911.067) * [-910.938] (-912.237) (-913.453) (-913.115) -- 0:00:41 324500 -- [-910.031] (-910.319) (-913.238) (-912.684) * (-912.593) (-911.967) (-911.411) [-910.530] -- 0:00:41 325000 -- (-911.334) (-911.654) [-915.189] (-911.611) * [-915.445] (-914.330) (-912.112) (-913.793) -- 0:00:41 Average standard deviation of split frequencies: 0.009640 325500 -- [-911.409] (-912.198) (-917.237) (-911.617) * (-911.400) [-911.505] (-912.525) (-912.032) -- 0:00:41 326000 -- (-912.711) (-913.014) (-913.765) [-911.594] * [-912.824] (-912.331) (-911.516) (-912.119) -- 0:00:41 326500 -- (-909.596) (-913.373) [-912.693] (-914.556) * [-913.200] (-913.355) (-920.081) (-915.730) -- 0:00:41 327000 -- (-910.355) (-910.819) (-911.576) [-919.943] * (-912.373) [-912.969] (-916.541) (-910.923) -- 0:00:41 327500 -- (-916.066) (-910.485) (-913.330) [-911.832] * (-912.006) (-912.338) (-913.299) [-911.715] -- 0:00:41 328000 -- [-913.234] (-909.872) (-917.687) (-912.010) * [-913.631] (-910.255) (-912.372) (-911.293) -- 0:00:40 328500 -- [-912.093] (-911.009) (-912.507) (-910.869) * (-913.085) (-911.148) (-913.436) [-911.720] -- 0:00:40 329000 -- (-913.780) (-912.731) [-909.942] (-911.918) * (-910.632) (-910.235) [-911.850] (-911.774) -- 0:00:40 329500 -- [-911.687] (-910.846) (-913.365) (-913.393) * (-912.623) (-911.370) [-913.954] (-914.288) -- 0:00:40 330000 -- (-911.290) (-910.877) [-911.638] (-910.205) * (-914.054) [-911.521] (-911.215) (-912.638) -- 0:00:40 Average standard deviation of split frequencies: 0.010217 330500 -- (-909.962) (-910.113) (-916.455) [-910.191] * (-911.596) (-912.620) [-912.708] (-911.200) -- 0:00:40 331000 -- (-909.870) [-914.320] (-915.983) (-911.218) * (-911.188) (-912.985) [-914.469] (-915.574) -- 0:00:40 331500 -- [-911.672] (-914.106) (-912.423) (-911.769) * (-912.690) [-913.623] (-912.680) (-911.743) -- 0:00:40 332000 -- (-911.291) (-910.962) [-911.445] (-911.407) * (-910.557) [-910.536] (-911.554) (-910.367) -- 0:00:40 332500 -- (-911.959) (-914.037) [-917.837] (-914.686) * (-911.016) (-911.267) [-910.153] (-912.184) -- 0:00:40 333000 -- [-910.030] (-911.251) (-912.730) (-911.770) * (-911.217) [-910.974] (-915.931) (-911.621) -- 0:00:40 333500 -- [-911.661] (-915.057) (-912.486) (-912.218) * (-911.035) [-910.365] (-912.496) (-911.140) -- 0:00:39 334000 -- [-910.696] (-912.588) (-915.348) (-912.592) * (-910.187) (-910.906) [-910.881] (-910.928) -- 0:00:39 334500 -- (-910.844) (-912.024) (-913.227) [-912.175] * [-911.282] (-911.314) (-913.129) (-910.033) -- 0:00:39 335000 -- [-913.261] (-915.504) (-913.697) (-915.082) * [-915.581] (-913.972) (-910.030) (-911.434) -- 0:00:39 Average standard deviation of split frequencies: 0.009587 335500 -- [-912.240] (-914.106) (-912.234) (-915.029) * (-914.494) (-910.916) [-912.285] (-910.516) -- 0:00:39 336000 -- (-911.568) (-912.214) [-912.865] (-913.415) * (-911.036) [-911.956] (-910.050) (-909.970) -- 0:00:39 336500 -- (-911.012) [-911.198] (-913.433) (-910.582) * (-911.879) (-914.431) [-910.770] (-911.422) -- 0:00:41 337000 -- (-912.328) [-911.452] (-914.900) (-913.649) * (-914.482) [-910.452] (-911.429) (-911.080) -- 0:00:41 337500 -- (-910.465) (-913.145) (-912.475) [-917.716] * (-916.053) [-912.396] (-911.156) (-914.272) -- 0:00:41 338000 -- (-921.753) (-911.159) (-912.654) [-918.091] * (-911.647) [-912.069] (-910.807) (-911.952) -- 0:00:41 338500 -- (-915.865) (-910.332) (-909.847) [-913.549] * (-911.445) (-913.912) [-913.289] (-913.805) -- 0:00:41 339000 -- (-911.696) (-911.078) (-910.238) [-911.788] * [-913.953] (-915.308) (-913.103) (-910.613) -- 0:00:40 339500 -- (-910.658) [-910.287] (-912.940) (-911.603) * [-911.290] (-912.332) (-912.537) (-910.656) -- 0:00:40 340000 -- [-909.800] (-910.641) (-912.612) (-912.230) * [-912.071] (-913.862) (-912.765) (-912.179) -- 0:00:40 Average standard deviation of split frequencies: 0.010093 340500 -- (-912.318) (-909.960) [-913.241] (-910.276) * [-910.923] (-913.288) (-914.263) (-909.905) -- 0:00:40 341000 -- [-910.069] (-911.096) (-910.375) (-911.365) * (-911.678) (-911.648) [-910.598] (-913.699) -- 0:00:40 341500 -- (-911.888) (-910.764) [-912.677] (-911.343) * (-910.611) (-910.168) [-912.560] (-913.854) -- 0:00:40 342000 -- (-911.605) (-914.283) (-912.229) [-911.023] * (-911.144) (-910.629) (-912.243) [-912.378] -- 0:00:40 342500 -- [-911.552] (-911.909) (-912.528) (-910.371) * (-912.185) (-912.351) [-913.720] (-910.773) -- 0:00:40 343000 -- (-910.589) [-911.346] (-913.493) (-911.075) * (-911.768) (-910.020) [-912.088] (-910.409) -- 0:00:40 343500 -- (-912.639) [-913.763] (-911.900) (-910.763) * (-911.808) (-910.668) (-912.006) [-911.519] -- 0:00:40 344000 -- (-911.155) (-913.291) (-911.812) [-911.033] * [-911.886] (-915.865) (-910.552) (-911.325) -- 0:00:40 344500 -- (-909.614) (-914.425) (-913.659) [-912.222] * (-914.577) (-913.779) (-910.933) [-911.104] -- 0:00:39 345000 -- (-909.614) (-914.386) (-916.736) [-909.793] * [-911.045] (-913.832) (-912.562) (-922.315) -- 0:00:39 Average standard deviation of split frequencies: 0.009938 345500 -- (-912.580) [-913.312] (-910.909) (-910.014) * [-911.626] (-915.757) (-920.422) (-913.318) -- 0:00:39 346000 -- [-913.360] (-915.287) (-913.298) (-909.780) * [-911.859] (-911.792) (-912.949) (-910.758) -- 0:00:39 346500 -- (-910.614) [-913.407] (-913.880) (-912.544) * (-913.700) [-911.718] (-914.127) (-913.418) -- 0:00:39 347000 -- [-911.342] (-917.712) (-915.117) (-912.749) * [-913.734] (-910.776) (-910.898) (-912.638) -- 0:00:39 347500 -- (-913.105) (-912.859) [-911.035] (-910.610) * (-911.880) (-910.826) [-910.962] (-910.811) -- 0:00:39 348000 -- [-913.197] (-916.056) (-911.158) (-914.273) * (-911.557) (-913.290) [-910.679] (-911.929) -- 0:00:39 348500 -- (-913.680) [-913.147] (-911.109) (-914.092) * [-911.195] (-914.198) (-911.581) (-911.634) -- 0:00:39 349000 -- (-911.341) [-913.044] (-912.963) (-910.464) * [-914.232] (-910.249) (-911.293) (-913.134) -- 0:00:39 349500 -- [-910.739] (-912.445) (-911.765) (-912.260) * [-912.432] (-911.916) (-914.477) (-910.529) -- 0:00:39 350000 -- (-915.136) [-910.840] (-911.544) (-912.646) * (-915.276) [-910.719] (-912.339) (-913.017) -- 0:00:39 Average standard deviation of split frequencies: 0.009410 350500 -- (-912.022) (-910.766) (-910.478) [-911.962] * (-911.516) [-913.766] (-910.654) (-910.533) -- 0:00:38 351000 -- (-911.287) (-910.779) [-910.892] (-918.210) * [-912.845] (-912.273) (-911.607) (-914.487) -- 0:00:38 351500 -- (-914.798) [-912.744] (-911.436) (-914.506) * [-913.403] (-913.442) (-913.141) (-910.553) -- 0:00:38 352000 -- [-913.600] (-911.854) (-912.925) (-911.733) * (-919.296) (-911.306) [-913.300] (-911.072) -- 0:00:38 352500 -- (-910.683) [-916.698] (-913.281) (-912.983) * (-912.233) (-914.727) [-912.329] (-916.821) -- 0:00:40 353000 -- (-912.843) (-911.548) [-910.544] (-909.919) * (-910.008) [-910.806] (-913.946) (-913.971) -- 0:00:40 353500 -- [-911.730] (-911.813) (-912.794) (-913.735) * [-910.465] (-911.778) (-911.430) (-915.983) -- 0:00:40 354000 -- (-917.393) (-912.817) (-912.894) [-912.861] * [-910.510] (-917.083) (-914.657) (-913.641) -- 0:00:40 354500 -- (-911.763) [-912.621] (-913.746) (-911.130) * (-910.021) (-911.226) (-910.320) [-913.111] -- 0:00:40 355000 -- (-912.523) (-913.379) [-910.814] (-911.353) * (-912.113) [-912.127] (-912.368) (-913.825) -- 0:00:39 Average standard deviation of split frequencies: 0.009581 355500 -- [-912.509] (-913.903) (-913.155) (-912.389) * (-911.442) (-913.512) [-915.447] (-916.978) -- 0:00:39 356000 -- [-912.622] (-914.223) (-910.663) (-913.439) * [-910.711] (-911.244) (-912.177) (-911.386) -- 0:00:39 356500 -- (-909.828) (-913.890) [-912.350] (-911.942) * [-911.193] (-911.184) (-910.502) (-911.190) -- 0:00:39 357000 -- (-910.410) (-911.764) (-912.543) [-911.213] * (-910.950) (-911.158) (-914.179) [-912.747] -- 0:00:39 357500 -- [-909.943] (-911.948) (-917.479) (-911.413) * (-911.632) (-913.388) (-913.002) [-914.427] -- 0:00:39 358000 -- (-910.685) [-912.640] (-911.877) (-910.965) * (-912.948) (-912.913) (-911.036) [-913.104] -- 0:00:39 358500 -- (-911.523) (-910.253) [-910.894] (-912.164) * (-910.543) (-915.554) [-911.099] (-913.038) -- 0:00:39 359000 -- (-910.507) (-920.104) (-911.981) [-910.290] * [-911.547] (-910.354) (-910.539) (-912.349) -- 0:00:39 359500 -- [-913.947] (-912.031) (-912.271) (-914.138) * (-911.839) (-911.619) (-910.607) [-912.210] -- 0:00:39 360000 -- (-911.980) (-914.605) (-911.260) [-913.638] * (-909.856) (-918.429) (-911.022) [-913.095] -- 0:00:39 Average standard deviation of split frequencies: 0.010379 360500 -- (-909.745) [-911.632] (-911.658) (-912.683) * [-910.675] (-915.038) (-913.357) (-914.137) -- 0:00:39 361000 -- (-911.274) [-913.937] (-911.605) (-911.055) * (-911.421) (-911.090) (-912.853) [-910.368] -- 0:00:38 361500 -- (-912.491) (-912.017) (-911.965) [-912.306] * (-910.335) [-911.160] (-912.579) (-912.081) -- 0:00:38 362000 -- (-913.428) [-911.237] (-910.443) (-909.668) * (-911.186) (-912.248) (-914.684) [-910.382] -- 0:00:38 362500 -- [-910.793] (-912.044) (-914.290) (-910.757) * (-912.269) [-910.187] (-910.046) (-910.842) -- 0:00:38 363000 -- [-910.364] (-913.547) (-911.810) (-912.903) * (-911.491) (-911.007) (-918.340) [-911.828] -- 0:00:38 363500 -- [-911.199] (-910.616) (-914.591) (-911.611) * [-912.178] (-910.007) (-912.410) (-910.565) -- 0:00:38 364000 -- [-910.220] (-910.535) (-912.412) (-910.150) * (-912.378) (-912.061) (-912.756) [-910.784] -- 0:00:38 364500 -- (-910.394) (-911.418) [-910.989] (-909.936) * (-912.872) (-912.811) (-913.284) [-910.700] -- 0:00:38 365000 -- (-910.051) [-911.296] (-912.763) (-910.685) * [-911.354] (-913.920) (-911.870) (-915.464) -- 0:00:38 Average standard deviation of split frequencies: 0.011137 365500 -- [-913.784] (-911.936) (-913.658) (-914.064) * (-911.165) [-911.202] (-911.737) (-914.944) -- 0:00:38 366000 -- (-909.984) (-911.372) (-915.831) [-911.669] * (-913.441) [-911.804] (-912.559) (-910.906) -- 0:00:38 366500 -- (-912.515) (-914.038) (-911.846) [-912.776] * [-910.223] (-911.613) (-911.915) (-911.356) -- 0:00:38 367000 -- (-913.341) (-916.015) (-913.363) [-911.567] * (-910.874) [-911.664] (-912.571) (-915.237) -- 0:00:37 367500 -- (-911.098) (-913.225) (-910.501) [-911.380] * (-912.693) [-912.021] (-912.317) (-913.104) -- 0:00:37 368000 -- (-911.861) (-915.123) (-912.953) [-912.895] * [-912.153] (-912.341) (-911.740) (-912.680) -- 0:00:37 368500 -- (-913.824) (-912.826) [-913.854] (-910.287) * [-911.999] (-911.947) (-910.616) (-910.800) -- 0:00:37 369000 -- [-913.750] (-912.019) (-915.571) (-913.922) * (-911.267) (-911.153) [-913.851] (-914.978) -- 0:00:39 369500 -- [-911.294] (-910.200) (-910.953) (-909.952) * [-913.230] (-914.355) (-911.500) (-913.233) -- 0:00:39 370000 -- (-913.493) (-911.202) [-911.149] (-910.662) * [-914.824] (-912.910) (-910.557) (-910.584) -- 0:00:39 Average standard deviation of split frequencies: 0.010810 370500 -- (-914.114) [-910.772] (-911.287) (-910.123) * (-914.812) (-910.522) (-911.513) [-910.881] -- 0:00:39 371000 -- (-914.146) (-912.027) (-910.134) [-909.893] * [-910.209] (-910.911) (-912.449) (-912.224) -- 0:00:38 371500 -- (-914.615) (-912.712) [-909.826] (-910.780) * (-911.516) (-911.347) [-911.792] (-911.339) -- 0:00:38 372000 -- [-912.213] (-914.106) (-912.751) (-911.337) * (-913.353) (-912.194) (-912.779) [-913.641] -- 0:00:38 372500 -- (-910.716) (-913.848) (-910.346) [-910.213] * [-912.549] (-912.972) (-912.298) (-912.896) -- 0:00:38 373000 -- [-912.752] (-920.262) (-910.362) (-911.266) * [-911.619] (-914.804) (-914.183) (-911.569) -- 0:00:38 373500 -- (-912.998) [-912.693] (-911.569) (-912.118) * (-913.023) (-914.386) [-912.768] (-911.313) -- 0:00:38 374000 -- (-915.465) (-912.772) [-916.198] (-913.494) * (-911.912) (-910.507) (-913.794) [-910.847] -- 0:00:38 374500 -- (-913.493) [-910.685] (-910.360) (-913.312) * (-911.717) (-910.034) [-922.904] (-914.281) -- 0:00:38 375000 -- (-911.407) [-911.576] (-910.512) (-912.489) * [-911.902] (-910.698) (-916.375) (-913.847) -- 0:00:38 Average standard deviation of split frequencies: 0.010500 375500 -- [-911.054] (-913.767) (-912.262) (-912.166) * [-911.553] (-911.572) (-914.321) (-911.689) -- 0:00:38 376000 -- [-910.279] (-912.539) (-912.893) (-913.253) * [-911.582] (-913.430) (-911.615) (-911.228) -- 0:00:38 376500 -- (-912.150) (-912.238) (-910.120) [-919.902] * (-911.664) [-910.533] (-911.161) (-911.576) -- 0:00:38 377000 -- (-912.333) [-913.214] (-910.049) (-909.954) * (-913.686) [-912.003] (-912.084) (-914.607) -- 0:00:38 377500 -- (-910.914) [-909.727] (-913.069) (-911.238) * (-914.169) [-910.712] (-910.644) (-913.609) -- 0:00:37 378000 -- [-911.965] (-911.600) (-912.288) (-911.692) * (-913.453) [-910.669] (-911.832) (-912.954) -- 0:00:37 378500 -- [-911.306] (-912.954) (-912.658) (-916.518) * (-913.974) (-910.953) [-913.669] (-911.600) -- 0:00:37 379000 -- [-909.815] (-911.796) (-911.782) (-912.513) * (-914.626) (-911.641) [-913.168] (-911.717) -- 0:00:37 379500 -- [-909.683] (-909.684) (-914.012) (-913.822) * (-915.272) (-911.923) (-913.427) [-910.894] -- 0:00:37 380000 -- (-913.500) (-909.680) [-915.522] (-912.786) * [-915.363] (-911.754) (-912.823) (-917.137) -- 0:00:37 Average standard deviation of split frequencies: 0.009752 380500 -- (-912.777) [-910.435] (-913.230) (-918.622) * (-912.771) (-910.666) [-912.149] (-916.165) -- 0:00:37 381000 -- (-912.380) (-910.957) (-911.734) [-910.875] * (-911.289) (-910.790) [-911.548] (-913.453) -- 0:00:37 381500 -- (-910.357) (-911.161) (-910.228) [-910.442] * (-910.442) (-911.721) [-910.965] (-912.806) -- 0:00:37 382000 -- (-912.976) [-910.173] (-915.244) (-910.868) * (-911.190) (-912.699) (-914.335) [-913.893] -- 0:00:37 382500 -- (-915.098) (-910.317) [-910.017] (-910.481) * (-912.794) (-911.693) [-909.858] (-913.417) -- 0:00:37 383000 -- (-911.433) [-912.318] (-911.996) (-912.104) * (-914.985) (-911.116) [-910.816] (-911.961) -- 0:00:37 383500 -- [-912.686] (-911.301) (-915.577) (-910.628) * (-911.354) (-910.973) [-910.652] (-913.560) -- 0:00:36 384000 -- (-912.742) [-910.902] (-912.208) (-911.107) * (-916.982) (-911.074) [-910.972] (-914.005) -- 0:00:36 384500 -- [-912.165] (-912.598) (-913.776) (-911.394) * [-913.574] (-920.162) (-911.299) (-910.034) -- 0:00:36 385000 -- (-910.622) (-913.551) (-910.660) [-910.219] * (-911.952) (-912.740) (-911.950) [-910.594] -- 0:00:36 Average standard deviation of split frequencies: 0.009914 385500 -- (-911.218) (-913.092) (-912.107) [-914.164] * [-911.606] (-914.278) (-911.414) (-910.852) -- 0:00:38 386000 -- [-915.323] (-911.625) (-910.373) (-911.190) * (-912.878) (-911.146) [-913.724] (-915.319) -- 0:00:38 386500 -- (-911.711) (-913.925) (-911.747) [-916.775] * (-914.943) (-911.226) (-910.646) [-915.293] -- 0:00:38 387000 -- (-911.985) (-910.976) (-913.890) [-910.568] * (-917.535) (-911.159) (-910.988) [-912.289] -- 0:00:38 387500 -- (-911.722) (-913.686) [-913.131] (-911.574) * (-912.266) (-912.115) [-910.467] (-909.912) -- 0:00:37 388000 -- (-910.144) (-916.511) [-910.764] (-911.824) * (-912.735) (-913.317) [-911.117] (-912.320) -- 0:00:37 388500 -- (-911.632) (-910.457) [-910.853] (-916.842) * (-918.264) (-916.003) (-912.595) [-911.559] -- 0:00:37 389000 -- [-911.528] (-909.976) (-912.051) (-915.150) * (-912.152) (-916.457) [-913.853] (-912.165) -- 0:00:37 389500 -- (-912.519) (-915.615) [-912.596] (-915.230) * [-914.404] (-909.984) (-914.978) (-912.099) -- 0:00:37 390000 -- [-911.645] (-916.076) (-914.418) (-917.798) * (-911.806) (-911.016) [-911.378] (-916.632) -- 0:00:37 Average standard deviation of split frequencies: 0.009015 390500 -- [-913.526] (-911.200) (-912.396) (-910.960) * (-911.013) (-914.870) (-911.525) [-918.185] -- 0:00:37 391000 -- [-913.314] (-911.148) (-913.576) (-914.619) * [-912.141] (-911.221) (-911.814) (-913.424) -- 0:00:37 391500 -- [-910.302] (-911.973) (-911.485) (-914.700) * [-912.347] (-911.940) (-911.642) (-913.078) -- 0:00:37 392000 -- (-910.673) (-911.416) (-911.078) [-910.924] * (-916.306) [-912.635] (-911.552) (-910.649) -- 0:00:37 392500 -- (-912.973) (-911.169) [-909.894] (-914.421) * (-911.759) (-911.089) [-913.183] (-916.616) -- 0:00:37 393000 -- (-911.290) (-914.284) [-911.080] (-916.864) * (-913.751) (-911.313) (-912.084) [-913.731] -- 0:00:37 393500 -- (-910.575) (-911.610) [-910.559] (-916.079) * (-911.239) (-911.495) (-912.459) [-910.706] -- 0:00:36 394000 -- [-910.552] (-911.389) (-913.744) (-911.097) * [-910.179] (-910.842) (-913.582) (-911.301) -- 0:00:36 394500 -- [-911.002] (-910.694) (-913.326) (-914.812) * [-912.536] (-910.815) (-911.335) (-912.987) -- 0:00:36 395000 -- (-911.693) (-913.285) (-911.337) [-911.846] * (-910.983) [-910.729] (-909.774) (-913.511) -- 0:00:36 Average standard deviation of split frequencies: 0.009243 395500 -- (-914.003) (-910.474) [-911.163] (-914.326) * (-911.580) (-913.946) (-912.214) [-910.475] -- 0:00:36 396000 -- (-915.829) [-912.313] (-912.354) (-910.865) * (-914.521) (-915.277) (-912.468) [-912.732] -- 0:00:36 396500 -- (-911.762) (-914.655) [-910.425] (-912.955) * (-913.671) [-911.216] (-913.671) (-913.313) -- 0:00:36 397000 -- (-910.243) [-911.799] (-911.477) (-912.309) * (-917.131) (-913.609) [-912.845] (-915.838) -- 0:00:36 397500 -- [-910.807] (-912.073) (-911.069) (-910.315) * (-911.712) (-910.984) [-913.144] (-909.738) -- 0:00:36 398000 -- [-911.121] (-916.103) (-912.856) (-911.339) * (-910.468) [-911.294] (-914.252) (-910.072) -- 0:00:36 398500 -- (-910.989) (-912.998) [-910.252] (-910.659) * [-910.976] (-911.573) (-914.106) (-910.379) -- 0:00:36 399000 -- (-909.996) (-910.065) (-909.611) [-910.287] * (-911.408) (-915.557) (-913.012) [-912.239] -- 0:00:36 399500 -- (-913.597) [-911.202] (-909.595) (-910.326) * (-911.056) (-917.012) (-915.000) [-910.849] -- 0:00:36 400000 -- (-916.791) (-911.927) (-910.106) [-910.579] * [-912.964] (-918.140) (-912.020) (-913.006) -- 0:00:36 Average standard deviation of split frequencies: 0.009620 400500 -- (-913.206) (-911.526) [-911.174] (-910.274) * [-910.173] (-915.400) (-913.330) (-912.455) -- 0:00:35 401000 -- (-910.481) (-910.215) [-912.094] (-910.274) * [-912.994] (-910.851) (-925.771) (-911.911) -- 0:00:35 401500 -- (-913.014) (-912.031) [-910.253] (-913.059) * (-912.672) [-912.856] (-913.020) (-911.856) -- 0:00:37 402000 -- (-913.107) (-912.076) [-911.402] (-911.791) * (-917.310) (-912.963) [-912.847] (-913.008) -- 0:00:37 402500 -- [-912.346] (-910.560) (-912.516) (-912.086) * (-919.451) (-917.493) (-910.054) [-911.386] -- 0:00:37 403000 -- (-910.216) [-913.722] (-910.203) (-915.645) * [-911.024] (-912.503) (-911.099) (-911.058) -- 0:00:37 403500 -- (-911.010) (-910.439) [-910.353] (-910.200) * (-913.479) [-913.374] (-912.395) (-911.031) -- 0:00:36 404000 -- (-911.472) [-911.034] (-912.637) (-911.538) * (-913.254) (-911.526) (-914.808) [-910.097] -- 0:00:36 404500 -- [-910.798] (-910.868) (-912.279) (-910.073) * (-911.485) (-910.763) (-915.081) [-911.674] -- 0:00:36 405000 -- (-910.993) (-910.754) (-911.183) [-914.904] * (-912.417) [-914.065] (-916.185) (-911.720) -- 0:00:36 Average standard deviation of split frequencies: 0.009835 405500 -- (-912.151) [-910.611] (-911.666) (-911.730) * (-910.341) [-911.371] (-914.030) (-911.910) -- 0:00:36 406000 -- (-914.628) (-911.179) [-912.325] (-910.873) * [-912.307] (-911.555) (-910.897) (-912.493) -- 0:00:36 406500 -- (-914.849) [-913.078] (-912.341) (-910.970) * (-915.154) (-911.818) (-915.639) [-911.955] -- 0:00:36 407000 -- [-913.448] (-912.732) (-911.311) (-911.728) * (-909.712) [-911.100] (-914.516) (-913.008) -- 0:00:36 407500 -- [-910.320] (-914.368) (-911.136) (-911.540) * (-910.358) (-910.518) (-912.237) [-914.483] -- 0:00:36 408000 -- (-910.290) (-910.796) (-913.656) [-911.111] * (-909.809) [-911.027] (-914.228) (-912.464) -- 0:00:36 408500 -- (-912.338) (-911.097) [-912.773] (-911.087) * (-909.743) (-914.771) (-912.045) [-916.022] -- 0:00:36 409000 -- [-910.909] (-912.504) (-912.059) (-912.901) * [-910.594] (-913.020) (-913.363) (-911.710) -- 0:00:36 409500 -- (-912.635) [-912.270] (-911.239) (-912.415) * (-913.470) [-911.956] (-915.359) (-912.206) -- 0:00:36 410000 -- (-913.004) (-917.444) [-910.875] (-914.026) * [-910.628] (-911.799) (-913.538) (-911.973) -- 0:00:35 Average standard deviation of split frequencies: 0.009723 410500 -- (-910.166) (-913.041) (-912.121) [-912.403] * (-913.386) [-912.233] (-913.597) (-911.894) -- 0:00:35 411000 -- [-912.187] (-910.918) (-910.753) (-912.017) * (-913.022) [-912.232] (-911.537) (-912.301) -- 0:00:35 411500 -- (-911.962) (-911.421) [-910.635] (-913.192) * (-914.718) [-912.266] (-911.822) (-915.759) -- 0:00:35 412000 -- (-912.973) (-913.864) (-911.965) [-910.747] * (-914.669) [-911.677] (-914.515) (-913.429) -- 0:00:35 412500 -- (-911.466) (-914.343) [-914.945] (-913.611) * (-913.672) (-913.459) [-915.768] (-911.824) -- 0:00:35 413000 -- (-911.256) (-915.428) (-913.191) [-915.173] * (-912.442) (-912.461) (-910.567) [-910.612] -- 0:00:35 413500 -- [-910.919] (-915.272) (-911.639) (-914.561) * (-911.071) [-913.953] (-911.543) (-911.877) -- 0:00:35 414000 -- [-911.069] (-910.980) (-911.436) (-914.318) * [-912.070] (-912.632) (-913.908) (-911.387) -- 0:00:35 414500 -- [-912.305] (-910.122) (-911.680) (-911.735) * (-913.265) (-913.564) [-911.909] (-910.991) -- 0:00:35 415000 -- [-912.306] (-911.575) (-911.320) (-910.997) * (-910.587) [-918.604] (-913.151) (-912.178) -- 0:00:35 Average standard deviation of split frequencies: 0.009732 415500 -- (-911.608) [-912.831] (-910.505) (-911.171) * (-911.107) (-918.208) [-911.044] (-910.915) -- 0:00:35 416000 -- (-912.664) (-910.707) (-913.564) [-911.140] * (-913.218) (-913.201) (-913.308) [-910.788] -- 0:00:35 416500 -- (-911.268) [-911.481] (-910.450) (-911.647) * (-911.708) (-911.482) [-910.014] (-912.933) -- 0:00:35 417000 -- (-910.655) (-913.597) (-912.142) [-910.677] * (-912.439) (-914.514) [-909.938] (-914.599) -- 0:00:34 417500 -- (-910.310) (-912.409) (-912.133) [-910.723] * (-911.776) [-912.618] (-910.917) (-913.866) -- 0:00:34 418000 -- [-911.236] (-916.225) (-911.643) (-912.728) * (-911.081) (-912.422) (-910.734) [-910.108] -- 0:00:36 418500 -- (-912.155) (-912.355) (-910.329) [-910.625] * (-913.227) (-912.361) (-913.473) [-911.404] -- 0:00:36 419000 -- (-911.729) (-914.167) [-912.523] (-915.831) * (-912.514) (-913.787) [-912.272] (-912.746) -- 0:00:36 419500 -- (-912.609) (-914.853) [-911.055] (-910.539) * (-912.053) (-909.616) [-912.669] (-912.707) -- 0:00:35 420000 -- (-910.959) [-910.545] (-910.935) (-910.116) * (-917.976) (-910.881) [-913.254] (-912.707) -- 0:00:35 Average standard deviation of split frequencies: 0.010217 420500 -- (-914.496) (-913.319) (-910.284) [-912.317] * (-914.470) (-913.918) [-912.996] (-910.510) -- 0:00:35 421000 -- (-914.251) (-909.680) [-910.380] (-910.618) * (-911.181) (-914.957) [-914.168] (-912.607) -- 0:00:35 421500 -- (-912.289) [-909.933] (-911.758) (-913.224) * (-911.005) (-912.970) (-910.076) [-911.653] -- 0:00:35 422000 -- (-910.721) (-911.770) [-912.799] (-911.995) * (-913.547) [-912.212] (-911.518) (-915.505) -- 0:00:35 422500 -- (-910.552) (-913.816) [-909.915] (-910.394) * (-915.713) (-913.490) (-911.506) [-911.038] -- 0:00:35 423000 -- [-910.469] (-911.211) (-912.718) (-914.701) * [-911.264] (-911.557) (-912.726) (-911.067) -- 0:00:35 423500 -- (-914.567) (-911.805) (-914.250) [-912.349] * (-910.647) (-912.128) [-913.413] (-912.840) -- 0:00:35 424000 -- (-912.420) (-914.518) [-911.245] (-911.906) * (-911.910) (-911.770) [-910.128] (-910.314) -- 0:00:35 424500 -- (-916.299) (-921.102) [-910.545] (-912.180) * [-912.197] (-911.557) (-913.915) (-913.244) -- 0:00:35 425000 -- (-911.924) [-910.682] (-912.136) (-911.813) * (-912.785) (-911.506) [-912.801] (-913.174) -- 0:00:35 Average standard deviation of split frequencies: 0.010220 425500 -- [-911.613] (-910.907) (-913.001) (-910.497) * (-911.835) [-910.647] (-910.913) (-911.039) -- 0:00:35 426000 -- [-913.155] (-913.219) (-913.796) (-916.790) * (-912.095) [-910.346] (-915.211) (-910.603) -- 0:00:35 426500 -- (-911.500) (-914.435) [-910.102] (-915.020) * (-912.115) (-913.745) [-912.197] (-911.319) -- 0:00:34 427000 -- (-911.410) [-910.676] (-912.924) (-912.765) * (-914.014) (-911.971) [-911.842] (-912.049) -- 0:00:34 427500 -- [-911.008] (-914.335) (-910.706) (-911.701) * [-913.704] (-913.392) (-911.402) (-911.419) -- 0:00:34 428000 -- (-911.510) [-912.359] (-915.320) (-913.901) * (-912.990) (-914.796) [-911.616] (-912.159) -- 0:00:34 428500 -- [-909.942] (-911.093) (-911.721) (-911.951) * (-910.354) (-913.836) [-910.235] (-911.771) -- 0:00:34 429000 -- (-911.090) (-909.980) [-910.460] (-911.386) * (-913.515) (-916.721) (-911.274) [-914.955] -- 0:00:34 429500 -- (-911.886) (-913.061) (-911.213) [-911.690] * (-911.682) [-911.935] (-914.274) (-912.936) -- 0:00:34 430000 -- (-912.047) (-911.317) [-910.786] (-913.791) * (-912.784) [-912.133] (-912.112) (-911.839) -- 0:00:34 Average standard deviation of split frequencies: 0.010560 430500 -- [-912.508] (-914.092) (-910.900) (-912.342) * [-911.695] (-911.476) (-912.265) (-912.556) -- 0:00:34 431000 -- (-917.132) (-913.466) [-910.093] (-912.429) * (-911.780) (-911.399) (-911.738) [-913.824] -- 0:00:34 431500 -- (-913.585) (-911.039) [-911.133] (-912.075) * (-911.099) [-910.264] (-910.813) (-911.351) -- 0:00:34 432000 -- (-919.044) (-913.035) (-912.534) [-912.005] * (-912.271) (-912.472) (-911.113) [-911.034] -- 0:00:34 432500 -- (-916.923) (-910.941) (-914.907) [-911.119] * [-915.375] (-911.832) (-911.471) (-914.445) -- 0:00:34 433000 -- (-912.999) (-910.700) [-911.075] (-910.806) * (-913.505) (-915.067) [-911.303] (-910.676) -- 0:00:34 433500 -- (-912.474) [-912.662] (-910.837) (-910.872) * (-911.510) [-911.075] (-912.283) (-912.843) -- 0:00:33 434000 -- (-911.990) (-911.837) [-910.972] (-911.105) * [-913.745] (-913.480) (-912.360) (-910.370) -- 0:00:33 434500 -- (-914.823) [-912.652] (-910.320) (-912.904) * (-910.296) [-912.203] (-909.649) (-912.067) -- 0:00:35 435000 -- (-911.015) (-919.323) (-909.988) [-912.933] * (-910.934) [-911.473] (-911.359) (-912.435) -- 0:00:35 Average standard deviation of split frequencies: 0.010407 435500 -- (-910.999) (-913.601) [-910.958] (-911.031) * (-913.381) [-911.728] (-912.404) (-910.889) -- 0:00:34 436000 -- [-910.745] (-912.411) (-910.727) (-911.376) * [-910.154] (-910.002) (-913.056) (-910.838) -- 0:00:34 436500 -- (-910.677) (-912.229) [-911.752] (-910.140) * (-912.224) (-909.859) [-914.279] (-911.617) -- 0:00:34 437000 -- (-912.742) (-912.728) [-911.167] (-910.898) * (-910.834) [-909.843] (-912.935) (-911.519) -- 0:00:34 437500 -- (-914.291) [-910.392] (-911.884) (-915.369) * [-910.301] (-910.591) (-914.036) (-911.411) -- 0:00:34 438000 -- (-916.908) (-912.700) [-913.078] (-910.893) * (-910.856) (-911.331) (-910.590) [-912.706] -- 0:00:34 438500 -- (-911.252) (-910.443) [-912.103] (-914.446) * (-910.608) (-911.533) (-913.662) [-910.585] -- 0:00:34 439000 -- (-916.946) [-913.664] (-911.148) (-912.950) * (-911.181) [-912.641] (-909.660) (-910.523) -- 0:00:34 439500 -- (-911.065) [-914.043] (-912.829) (-911.420) * (-909.864) [-911.329] (-909.658) (-913.369) -- 0:00:34 440000 -- (-910.264) (-911.618) (-911.026) [-913.470] * [-911.887] (-913.453) (-910.945) (-912.284) -- 0:00:34 Average standard deviation of split frequencies: 0.010497 440500 -- [-910.819] (-914.218) (-910.070) (-915.102) * (-914.803) (-917.352) [-912.976] (-912.222) -- 0:00:34 441000 -- [-911.611] (-914.389) (-910.039) (-914.699) * (-912.905) [-916.058] (-913.972) (-916.476) -- 0:00:34 441500 -- [-911.859] (-915.434) (-913.984) (-911.979) * (-911.589) [-910.046] (-911.805) (-912.534) -- 0:00:34 442000 -- (-910.848) [-912.419] (-911.072) (-911.147) * (-910.455) (-910.165) [-910.786] (-910.323) -- 0:00:34 442500 -- (-913.370) [-912.791] (-910.886) (-911.449) * (-916.277) (-912.368) (-910.459) [-910.960] -- 0:00:34 443000 -- [-912.016] (-911.167) (-913.138) (-910.334) * (-911.913) (-911.942) (-911.853) [-912.495] -- 0:00:33 443500 -- [-910.340] (-912.131) (-910.538) (-910.200) * (-911.525) (-911.973) [-911.360] (-913.218) -- 0:00:33 444000 -- [-910.530] (-911.931) (-910.610) (-910.019) * (-914.575) (-912.025) (-911.690) [-913.622] -- 0:00:33 444500 -- [-910.471] (-912.251) (-912.578) (-911.234) * (-915.122) (-911.760) [-911.827] (-911.959) -- 0:00:33 445000 -- (-912.413) (-911.902) [-911.789] (-910.258) * [-912.876] (-922.357) (-911.839) (-911.256) -- 0:00:33 Average standard deviation of split frequencies: 0.010507 445500 -- (-910.939) [-910.855] (-912.496) (-911.646) * [-911.763] (-910.622) (-911.043) (-911.471) -- 0:00:33 446000 -- (-910.661) (-909.904) (-913.129) [-911.468] * (-912.651) [-912.797] (-911.014) (-911.831) -- 0:00:33 446500 -- (-915.101) (-912.124) [-915.854] (-911.537) * (-910.618) [-910.931] (-911.098) (-911.736) -- 0:00:33 447000 -- (-912.937) [-913.422] (-912.784) (-911.425) * [-912.036] (-910.243) (-913.433) (-911.671) -- 0:00:33 447500 -- [-912.995] (-910.022) (-913.528) (-911.854) * (-916.427) [-911.684] (-911.886) (-910.701) -- 0:00:33 448000 -- [-917.368] (-914.034) (-911.175) (-911.487) * (-911.779) [-911.576] (-911.437) (-921.418) -- 0:00:33 448500 -- (-914.884) (-910.029) [-911.043] (-910.801) * (-911.129) [-909.643] (-913.789) (-910.619) -- 0:00:33 449000 -- (-913.807) (-909.602) (-910.253) [-910.097] * (-911.059) (-910.836) [-912.120] (-910.283) -- 0:00:33 449500 -- [-912.146] (-911.139) (-912.583) (-910.129) * (-913.262) [-912.534] (-913.258) (-910.679) -- 0:00:33 450000 -- (-910.992) [-912.828] (-911.338) (-910.130) * [-913.700] (-911.716) (-911.827) (-914.234) -- 0:00:33 Average standard deviation of split frequencies: 0.009906 450500 -- [-911.187] (-911.695) (-910.480) (-909.924) * (-915.767) [-910.987] (-910.649) (-910.575) -- 0:00:32 451000 -- (-910.520) (-912.635) (-911.155) [-910.543] * (-912.481) [-910.902] (-910.618) (-911.047) -- 0:00:34 451500 -- (-913.021) (-912.309) [-911.418] (-910.292) * (-911.782) (-910.957) [-913.508] (-911.447) -- 0:00:34 452000 -- (-911.837) [-914.150] (-917.923) (-910.216) * (-910.596) (-911.159) [-910.702] (-912.365) -- 0:00:33 452500 -- (-910.443) (-910.747) [-911.836] (-912.297) * (-910.209) (-909.931) (-913.582) [-912.590] -- 0:00:33 453000 -- (-910.617) [-910.472] (-913.968) (-915.897) * (-910.610) (-912.990) (-911.313) [-910.523] -- 0:00:33 453500 -- (-909.684) (-913.191) [-911.182] (-912.463) * (-911.127) [-909.646] (-910.978) (-912.533) -- 0:00:33 454000 -- (-911.112) (-910.693) (-909.781) [-910.357] * (-910.914) [-910.233] (-912.809) (-914.191) -- 0:00:33 454500 -- (-910.740) (-910.242) [-912.060] (-914.985) * (-917.758) (-909.754) (-914.035) [-912.789] -- 0:00:33 455000 -- (-914.311) (-911.541) (-910.479) [-910.985] * [-917.886] (-912.852) (-914.101) (-914.672) -- 0:00:33 Average standard deviation of split frequencies: 0.009304 455500 -- [-911.746] (-911.268) (-910.586) (-914.914) * [-910.084] (-909.773) (-912.288) (-913.410) -- 0:00:33 456000 -- (-911.992) (-911.593) [-917.342] (-914.009) * (-911.598) (-910.894) [-912.593] (-913.856) -- 0:00:33 456500 -- (-910.930) [-911.825] (-912.461) (-913.027) * [-910.641] (-911.313) (-911.330) (-913.839) -- 0:00:33 457000 -- (-910.819) (-916.992) (-920.061) [-911.283] * (-912.376) (-910.376) [-911.942] (-919.171) -- 0:00:33 457500 -- (-913.583) [-917.991] (-910.551) (-910.253) * [-910.752] (-911.350) (-913.015) (-914.013) -- 0:00:33 458000 -- (-914.587) (-917.350) [-913.172] (-909.587) * (-912.189) (-910.475) [-910.692] (-911.382) -- 0:00:33 458500 -- (-910.300) (-911.346) [-911.847] (-910.026) * (-910.428) (-911.633) [-910.613] (-910.954) -- 0:00:33 459000 -- [-911.229] (-912.905) (-910.638) (-911.372) * (-911.024) [-910.094] (-913.805) (-910.595) -- 0:00:33 459500 -- (-910.393) (-912.138) (-915.414) [-912.545] * (-915.716) [-913.616] (-911.848) (-911.068) -- 0:00:32 460000 -- [-910.070] (-915.432) (-912.860) (-910.515) * (-911.432) (-913.786) [-911.455] (-913.023) -- 0:00:32 Average standard deviation of split frequencies: 0.009270 460500 -- (-911.446) (-912.842) (-913.824) [-912.126] * [-911.778] (-911.300) (-913.002) (-913.819) -- 0:00:32 461000 -- [-911.095] (-913.635) (-912.207) (-913.061) * (-911.264) [-909.848] (-912.104) (-910.030) -- 0:00:32 461500 -- (-913.233) (-913.353) [-911.220] (-916.185) * (-913.113) (-910.785) [-910.672] (-912.604) -- 0:00:32 462000 -- (-913.922) [-911.641] (-910.492) (-914.592) * [-913.831] (-912.028) (-913.072) (-910.495) -- 0:00:32 462500 -- (-910.515) (-910.510) [-910.561] (-915.496) * [-912.866] (-912.327) (-914.267) (-910.687) -- 0:00:32 463000 -- (-910.091) [-910.473] (-912.100) (-915.306) * (-915.350) (-916.499) (-912.139) [-912.888] -- 0:00:32 463500 -- [-909.908] (-910.823) (-910.021) (-916.194) * [-910.612] (-913.598) (-917.054) (-916.023) -- 0:00:32 464000 -- [-910.102] (-910.362) (-910.702) (-912.025) * [-910.023] (-912.634) (-914.637) (-911.123) -- 0:00:32 464500 -- [-910.226] (-917.889) (-912.393) (-912.427) * (-909.746) (-910.452) (-914.388) [-910.326] -- 0:00:32 465000 -- [-912.170] (-917.282) (-912.512) (-912.146) * (-911.935) (-912.499) [-913.016] (-910.468) -- 0:00:32 Average standard deviation of split frequencies: 0.009461 465500 -- [-911.023] (-911.348) (-911.832) (-911.339) * (-911.720) [-910.237] (-912.238) (-910.223) -- 0:00:32 466000 -- (-910.210) (-910.780) (-914.981) [-911.352] * (-913.214) (-909.911) [-911.595] (-913.182) -- 0:00:32 466500 -- (-912.211) [-913.659] (-913.533) (-912.853) * [-916.605] (-911.418) (-911.598) (-911.606) -- 0:00:32 467000 -- [-910.940] (-915.955) (-915.240) (-911.079) * (-910.030) (-915.606) [-912.280] (-911.543) -- 0:00:31 467500 -- (-910.806) (-913.850) (-914.770) [-910.851] * [-910.282] (-912.866) (-911.008) (-913.259) -- 0:00:33 468000 -- (-918.596) (-912.222) [-910.496] (-912.305) * [-911.080] (-913.638) (-912.919) (-914.536) -- 0:00:32 468500 -- [-916.296] (-913.977) (-915.732) (-916.203) * (-912.570) (-913.085) [-911.514] (-912.236) -- 0:00:32 469000 -- (-912.433) (-912.003) (-911.234) [-912.196] * (-911.864) (-911.035) [-912.298] (-913.297) -- 0:00:32 469500 -- [-910.913] (-919.202) (-912.671) (-910.545) * (-911.866) (-911.933) (-909.994) [-915.897] -- 0:00:32 470000 -- (-911.185) [-910.192] (-913.433) (-911.945) * [-910.743] (-912.045) (-911.903) (-910.795) -- 0:00:32 Average standard deviation of split frequencies: 0.008764 470500 -- (-910.401) [-910.652] (-912.317) (-911.801) * (-910.553) (-911.828) [-912.593] (-911.103) -- 0:00:32 471000 -- (-911.617) (-912.887) [-912.487] (-911.687) * (-912.793) (-911.808) [-910.626] (-910.673) -- 0:00:32 471500 -- (-910.144) (-911.352) [-910.067] (-911.074) * (-911.348) [-913.411] (-911.226) (-910.592) -- 0:00:32 472000 -- (-910.506) (-910.162) [-909.924] (-910.401) * [-910.570] (-910.132) (-913.325) (-911.619) -- 0:00:32 472500 -- (-910.445) [-909.778] (-912.822) (-913.448) * (-913.852) [-910.462] (-910.350) (-913.450) -- 0:00:32 473000 -- [-910.863] (-910.239) (-910.277) (-911.706) * (-912.580) (-910.093) [-910.927] (-912.364) -- 0:00:32 473500 -- (-910.393) (-910.502) [-912.650] (-912.690) * (-912.367) (-911.655) (-910.732) [-910.561] -- 0:00:32 474000 -- [-913.759] (-914.141) (-914.826) (-911.522) * (-915.294) (-910.980) (-913.710) [-913.526] -- 0:00:32 474500 -- (-915.373) [-911.820] (-911.502) (-911.704) * (-912.776) (-911.455) (-912.045) [-913.793] -- 0:00:32 475000 -- (-915.034) [-912.410] (-910.542) (-915.836) * (-910.479) (-913.162) [-912.813] (-911.630) -- 0:00:32 Average standard deviation of split frequencies: 0.008564 475500 -- (-912.792) [-911.167] (-910.553) (-911.137) * (-911.753) (-910.183) [-913.300] (-912.425) -- 0:00:31 476000 -- (-910.764) (-910.307) (-911.606) [-911.600] * [-910.751] (-910.306) (-914.010) (-911.654) -- 0:00:31 476500 -- (-910.504) (-916.702) (-911.933) [-911.116] * [-911.430] (-912.549) (-911.500) (-910.517) -- 0:00:31 477000 -- (-912.080) (-912.586) [-911.838] (-911.600) * (-910.810) [-911.264] (-913.753) (-913.197) -- 0:00:31 477500 -- (-914.593) (-910.186) (-911.271) [-912.105] * [-912.074] (-910.773) (-912.880) (-913.123) -- 0:00:31 478000 -- (-914.253) (-911.035) (-916.731) [-912.169] * (-910.575) (-909.870) [-912.235] (-915.278) -- 0:00:31 478500 -- (-910.898) (-911.983) (-911.229) [-910.066] * (-915.341) [-911.786] (-911.229) (-911.992) -- 0:00:31 479000 -- (-912.339) [-911.779] (-911.438) (-909.763) * (-910.781) (-912.479) (-913.437) [-912.139] -- 0:00:31 479500 -- (-913.026) (-910.599) (-912.177) [-912.678] * (-910.389) [-910.948] (-912.701) (-917.055) -- 0:00:31 480000 -- (-912.010) [-915.709] (-911.807) (-910.883) * (-909.968) (-915.195) (-911.017) [-912.591] -- 0:00:31 Average standard deviation of split frequencies: 0.008459 480500 -- [-915.126] (-912.676) (-911.900) (-912.587) * (-911.471) (-917.269) (-911.763) [-911.273] -- 0:00:31 481000 -- [-912.594] (-911.532) (-915.007) (-910.569) * (-911.248) (-913.968) (-913.387) [-910.307] -- 0:00:31 481500 -- (-914.782) (-912.055) (-913.593) [-910.446] * (-912.263) (-912.867) (-912.946) [-913.125] -- 0:00:31 482000 -- (-911.279) (-913.315) [-912.126] (-910.821) * (-910.180) (-912.948) (-917.077) [-913.444] -- 0:00:31 482500 -- (-911.238) (-913.833) (-910.920) [-910.753] * [-911.220] (-910.271) (-912.262) (-912.150) -- 0:00:31 483000 -- (-912.886) (-916.168) (-910.803) [-910.920] * (-912.940) (-910.351) (-910.581) [-910.848] -- 0:00:31 483500 -- (-911.080) (-913.647) [-910.302] (-914.809) * [-912.157] (-910.701) (-910.185) (-913.169) -- 0:00:30 484000 -- (-912.369) (-913.669) [-912.157] (-912.836) * (-909.730) [-911.604] (-912.754) (-914.480) -- 0:00:31 484500 -- (-911.185) (-912.540) [-911.500] (-915.044) * (-909.888) [-912.176] (-917.853) (-914.384) -- 0:00:31 485000 -- (-910.771) (-911.151) [-912.402] (-913.564) * (-910.113) (-913.839) (-911.911) [-912.632] -- 0:00:31 Average standard deviation of split frequencies: 0.008460 485500 -- (-913.471) (-913.508) [-912.234] (-913.922) * [-910.161] (-913.561) (-911.177) (-912.163) -- 0:00:31 486000 -- [-911.923] (-913.457) (-911.992) (-911.201) * (-914.055) (-912.696) (-911.881) [-914.172] -- 0:00:31 486500 -- (-917.827) (-913.067) (-910.044) [-913.147] * (-909.571) (-913.173) [-912.222] (-913.734) -- 0:00:31 487000 -- (-912.793) (-912.204) [-910.248] (-912.618) * (-912.079) [-911.626] (-913.055) (-916.022) -- 0:00:31 487500 -- (-916.137) (-912.079) (-910.691) [-910.323] * (-915.559) (-910.383) [-914.442] (-910.458) -- 0:00:31 488000 -- (-914.070) (-912.649) [-911.291] (-914.280) * (-916.750) [-913.092] (-910.717) (-910.490) -- 0:00:31 488500 -- (-912.761) (-910.048) [-910.989] (-913.248) * [-912.280] (-910.269) (-915.250) (-917.853) -- 0:00:31 489000 -- (-911.696) [-911.468] (-915.573) (-913.208) * [-914.156] (-909.844) (-911.871) (-920.630) -- 0:00:31 489500 -- (-913.689) [-911.604] (-916.239) (-910.996) * (-911.663) (-915.107) [-910.855] (-915.921) -- 0:00:31 490000 -- (-911.394) (-913.895) [-911.035] (-910.213) * (-911.748) (-914.333) [-911.484] (-914.244) -- 0:00:31 Average standard deviation of split frequencies: 0.008967 490500 -- (-912.143) (-916.384) [-910.794] (-912.762) * (-912.702) (-911.774) (-912.159) [-911.951] -- 0:00:31 491000 -- [-911.230] (-916.814) (-910.383) (-916.556) * (-911.579) (-912.685) [-912.895] (-913.163) -- 0:00:31 491500 -- [-911.481] (-911.074) (-911.224) (-910.316) * (-911.927) [-912.503] (-912.526) (-913.036) -- 0:00:31 492000 -- (-912.556) (-913.101) (-911.825) [-910.879] * (-912.202) (-912.115) (-910.470) [-912.944] -- 0:00:30 492500 -- [-912.217] (-913.163) (-911.842) (-910.709) * (-915.801) [-911.657] (-912.624) (-912.050) -- 0:00:30 493000 -- (-910.397) [-912.405] (-911.835) (-911.089) * (-913.774) (-911.902) (-911.574) [-910.957] -- 0:00:30 493500 -- (-912.008) (-911.243) [-909.930] (-911.840) * (-911.876) (-914.484) [-912.032] (-913.754) -- 0:00:30 494000 -- (-913.870) (-911.780) (-911.028) [-911.040] * (-911.711) [-911.029] (-914.880) (-911.246) -- 0:00:30 494500 -- (-912.839) (-912.648) [-910.607] (-912.920) * (-911.571) (-910.479) (-916.615) [-910.645] -- 0:00:30 495000 -- [-914.643] (-915.132) (-909.892) (-910.930) * (-911.321) (-909.729) (-911.071) [-911.246] -- 0:00:30 Average standard deviation of split frequencies: 0.008554 495500 -- [-909.991] (-914.619) (-910.805) (-910.753) * [-912.416] (-913.373) (-914.684) (-917.671) -- 0:00:30 496000 -- (-910.027) (-912.626) [-909.974] (-911.799) * (-914.723) (-911.676) (-911.184) [-913.655] -- 0:00:30 496500 -- [-911.216] (-915.243) (-913.525) (-912.716) * (-914.963) [-909.619] (-915.039) (-909.781) -- 0:00:30 497000 -- (-910.928) [-911.643] (-912.392) (-913.054) * [-913.156] (-909.619) (-911.378) (-909.896) -- 0:00:30 497500 -- (-911.648) (-911.056) (-913.499) [-912.275] * (-910.300) (-911.097) (-911.634) [-912.193] -- 0:00:30 498000 -- (-913.943) (-910.631) (-910.423) [-911.345] * (-912.326) (-910.018) [-912.436] (-912.440) -- 0:00:30 498500 -- [-910.338] (-912.163) (-912.886) (-920.740) * (-911.095) (-910.495) (-914.484) [-913.296] -- 0:00:30 499000 -- (-910.103) [-910.835] (-911.505) (-913.817) * [-911.136] (-913.619) (-914.996) (-913.811) -- 0:00:30 499500 -- (-912.728) [-910.377] (-911.812) (-910.472) * [-911.067] (-913.349) (-914.277) (-911.856) -- 0:00:30 500000 -- [-911.489] (-916.023) (-910.071) (-910.790) * (-911.737) (-914.349) (-911.924) [-911.470] -- 0:00:30 Average standard deviation of split frequencies: 0.008197 500500 -- (-912.941) [-913.317] (-909.740) (-913.303) * [-911.224] (-913.409) (-913.497) (-910.005) -- 0:00:30 501000 -- (-911.709) [-912.913] (-910.462) (-910.890) * [-913.416] (-914.662) (-910.620) (-910.605) -- 0:00:30 501500 -- [-912.395] (-914.740) (-911.784) (-911.216) * (-910.338) (-910.797) (-913.624) [-909.829] -- 0:00:30 502000 -- (-910.828) [-912.428] (-912.027) (-913.268) * (-910.920) (-914.291) [-913.423] (-910.433) -- 0:00:30 502500 -- [-912.641] (-912.173) (-910.882) (-911.137) * [-911.355] (-911.320) (-911.784) (-910.767) -- 0:00:30 503000 -- [-912.089] (-917.893) (-911.463) (-912.968) * (-910.455) (-912.162) (-910.226) [-912.638] -- 0:00:30 503500 -- (-911.134) (-912.567) (-911.746) [-912.667] * (-911.284) (-912.664) [-911.580] (-910.342) -- 0:00:30 504000 -- (-913.566) (-911.544) [-911.320] (-910.538) * [-910.743] (-918.292) (-915.139) (-912.272) -- 0:00:30 504500 -- (-913.806) (-913.755) [-911.143] (-910.815) * (-915.839) (-919.820) [-911.828] (-911.129) -- 0:00:30 505000 -- (-912.577) (-913.580) [-914.123] (-911.352) * [-910.949] (-915.241) (-917.796) (-913.425) -- 0:00:30 Average standard deviation of split frequencies: 0.008604 505500 -- [-915.161] (-910.880) (-909.921) (-910.416) * (-913.846) (-912.072) (-920.176) [-914.950] -- 0:00:30 506000 -- (-912.484) [-911.351] (-912.256) (-910.135) * (-914.951) (-912.381) [-914.143] (-910.971) -- 0:00:30 506500 -- [-913.648] (-914.104) (-918.527) (-912.659) * (-911.554) [-914.446] (-911.997) (-912.987) -- 0:00:30 507000 -- (-911.100) [-910.336] (-915.344) (-913.293) * (-912.759) (-911.475) [-912.654] (-912.288) -- 0:00:30 507500 -- [-912.232] (-911.564) (-915.026) (-912.036) * (-915.866) (-911.613) [-911.147] (-910.862) -- 0:00:30 508000 -- (-911.619) [-911.593] (-914.294) (-910.839) * (-913.897) (-911.204) [-912.732] (-913.247) -- 0:00:30 508500 -- (-911.439) [-912.931] (-915.398) (-912.206) * (-912.146) (-912.244) [-910.509] (-910.888) -- 0:00:29 509000 -- (-912.425) (-911.111) (-913.328) [-910.953] * [-911.983] (-910.166) (-917.324) (-912.374) -- 0:00:29 509500 -- (-910.372) (-911.317) (-913.491) [-911.081] * (-910.218) (-909.762) [-912.320] (-913.157) -- 0:00:29 510000 -- (-910.372) [-912.389] (-913.272) (-911.324) * (-912.449) (-914.725) (-915.311) [-912.129] -- 0:00:29 Average standard deviation of split frequencies: 0.008634 510500 -- (-911.041) (-911.170) (-911.260) [-911.029] * (-913.210) (-920.642) (-914.578) [-910.769] -- 0:00:29 511000 -- (-911.687) (-911.282) (-911.595) [-910.354] * (-915.204) [-912.056] (-914.095) (-911.171) -- 0:00:29 511500 -- (-912.467) (-910.618) [-910.453] (-910.848) * (-917.862) (-910.659) [-913.978] (-913.324) -- 0:00:29 512000 -- [-912.871] (-911.865) (-910.587) (-911.512) * [-915.273] (-911.932) (-911.433) (-910.217) -- 0:00:29 512500 -- (-910.562) [-910.343] (-910.155) (-912.945) * (-913.129) (-911.424) (-914.165) [-911.831] -- 0:00:29 513000 -- [-913.373] (-909.547) (-909.919) (-912.614) * (-910.966) (-911.979) (-913.630) [-911.910] -- 0:00:29 513500 -- (-910.293) (-909.823) (-910.454) [-912.664] * (-910.069) (-912.201) (-911.729) [-912.388] -- 0:00:29 514000 -- [-910.085] (-910.478) (-910.697) (-909.896) * (-910.281) [-911.726] (-911.975) (-909.830) -- 0:00:29 514500 -- [-912.010] (-912.942) (-909.990) (-910.696) * (-913.968) (-913.034) [-910.787] (-910.966) -- 0:00:29 515000 -- (-913.986) [-911.464] (-910.365) (-912.486) * (-914.302) (-912.592) (-911.780) [-911.392] -- 0:00:29 Average standard deviation of split frequencies: 0.008222 515500 -- [-911.804] (-912.141) (-913.656) (-912.740) * [-911.668] (-911.434) (-911.129) (-913.104) -- 0:00:29 516000 -- (-911.432) [-910.384] (-914.087) (-911.107) * (-918.552) (-911.521) (-911.327) [-911.944] -- 0:00:29 516500 -- (-910.589) [-910.425] (-913.493) (-912.574) * (-912.134) [-912.386] (-913.946) (-913.765) -- 0:00:29 517000 -- (-911.525) [-911.823] (-912.251) (-916.838) * (-911.224) (-915.674) (-912.860) [-914.155] -- 0:00:29 517500 -- (-913.548) (-912.494) (-911.585) [-915.266] * (-910.492) [-915.124] (-910.725) (-912.451) -- 0:00:29 518000 -- (-911.765) (-911.360) [-913.542] (-916.138) * (-912.922) (-911.462) (-911.160) [-911.378] -- 0:00:29 518500 -- [-912.612] (-911.800) (-912.135) (-912.043) * (-912.065) (-910.272) (-919.077) [-910.094] -- 0:00:29 519000 -- (-910.372) (-913.590) [-912.909] (-911.779) * (-910.792) (-915.038) (-914.022) [-912.860] -- 0:00:29 519500 -- (-915.644) (-911.843) [-913.217] (-912.121) * (-911.190) (-916.427) (-910.953) [-912.254] -- 0:00:29 520000 -- (-914.664) [-913.208] (-915.207) (-913.926) * (-913.894) (-913.442) [-912.861] (-915.006) -- 0:00:29 Average standard deviation of split frequencies: 0.008828 520500 -- (-910.349) (-912.057) [-914.924] (-913.190) * (-913.913) [-912.576] (-910.686) (-912.991) -- 0:00:29 521000 -- (-910.172) [-914.291] (-911.585) (-912.705) * (-912.041) [-910.256] (-916.763) (-910.728) -- 0:00:29 521500 -- (-912.469) (-910.725) [-912.193] (-911.506) * [-912.268] (-909.713) (-915.922) (-912.771) -- 0:00:29 522000 -- (-913.129) (-910.583) (-912.123) [-910.529] * (-913.397) (-913.609) [-910.084] (-910.224) -- 0:00:29 522500 -- [-912.085] (-911.045) (-911.866) (-911.831) * (-913.926) (-912.535) [-912.093] (-913.705) -- 0:00:29 523000 -- (-910.917) (-912.242) [-912.534] (-912.401) * [-911.732] (-913.433) (-910.629) (-911.201) -- 0:00:29 523500 -- (-915.612) [-914.568] (-913.983) (-916.541) * (-910.967) (-918.288) [-911.687] (-910.715) -- 0:00:29 524000 -- (-911.780) (-910.309) [-911.260] (-912.278) * [-913.070] (-913.017) (-911.329) (-909.967) -- 0:00:29 524500 -- (-912.595) [-910.002] (-911.797) (-911.171) * (-912.485) (-912.442) [-911.157] (-910.034) -- 0:00:29 525000 -- (-910.602) [-911.091] (-913.962) (-910.248) * [-911.500] (-911.775) (-912.673) (-910.164) -- 0:00:28 Average standard deviation of split frequencies: 0.008698 525500 -- [-910.445] (-912.188) (-914.400) (-911.087) * (-911.830) [-910.826] (-911.872) (-910.856) -- 0:00:28 526000 -- (-911.685) (-912.185) (-911.502) [-910.982] * (-912.935) [-910.807] (-910.353) (-909.499) -- 0:00:28 526500 -- (-914.228) (-911.642) (-913.388) [-910.267] * [-911.321] (-911.404) (-910.382) (-912.455) -- 0:00:28 527000 -- (-914.695) (-915.886) [-913.312] (-910.520) * (-911.378) [-912.740] (-915.742) (-910.180) -- 0:00:28 527500 -- (-911.598) (-912.340) [-910.454] (-914.327) * [-911.143] (-912.651) (-912.351) (-912.935) -- 0:00:28 528000 -- (-913.378) [-910.933] (-911.714) (-911.539) * [-912.308] (-912.784) (-913.848) (-911.773) -- 0:00:28 528500 -- [-912.512] (-911.077) (-910.520) (-910.986) * [-910.672] (-913.750) (-913.195) (-910.433) -- 0:00:28 529000 -- (-912.843) (-911.553) (-917.647) [-911.240] * (-913.529) (-914.749) [-914.929] (-911.987) -- 0:00:28 529500 -- (-915.805) (-913.929) (-914.223) [-912.618] * (-912.997) [-913.120] (-916.085) (-914.554) -- 0:00:28 530000 -- [-913.280] (-911.602) (-910.345) (-910.261) * (-913.531) [-911.736] (-913.449) (-912.056) -- 0:00:28 Average standard deviation of split frequencies: 0.008828 530500 -- (-911.731) [-912.270] (-911.810) (-911.333) * (-913.453) (-911.813) [-912.410] (-913.795) -- 0:00:28 531000 -- (-910.907) [-912.270] (-910.905) (-911.268) * (-910.888) (-913.125) (-911.781) [-913.984] -- 0:00:28 531500 -- (-910.904) (-910.458) [-910.845] (-913.422) * (-913.396) (-911.829) [-917.864] (-912.995) -- 0:00:28 532000 -- [-913.925] (-910.149) (-910.336) (-910.530) * (-911.504) (-913.121) (-913.278) [-910.709] -- 0:00:28 532500 -- [-911.229] (-917.215) (-909.905) (-910.530) * (-911.976) (-911.554) (-911.372) [-913.141] -- 0:00:28 533000 -- [-912.145] (-912.212) (-911.037) (-913.118) * (-911.966) (-913.687) (-910.712) [-912.072] -- 0:00:28 533500 -- (-910.461) (-919.264) [-911.079] (-911.458) * [-911.546] (-912.938) (-911.832) (-913.945) -- 0:00:28 534000 -- (-911.482) (-913.032) [-913.681] (-912.770) * (-910.225) (-912.223) (-910.736) [-911.496] -- 0:00:28 534500 -- (-910.353) (-912.734) (-910.695) [-910.922] * (-912.073) (-910.188) (-912.553) [-909.871] -- 0:00:28 535000 -- (-911.614) (-912.860) [-911.554] (-914.331) * (-911.932) (-911.125) (-911.980) [-909.729] -- 0:00:28 Average standard deviation of split frequencies: 0.008740 535500 -- (-911.435) (-911.829) [-911.528] (-916.016) * (-914.305) [-911.788] (-911.901) (-913.089) -- 0:00:28 536000 -- (-912.016) [-910.977] (-911.457) (-916.527) * (-912.029) (-913.967) [-910.160] (-913.606) -- 0:00:28 536500 -- (-914.129) [-910.957] (-911.525) (-911.210) * [-914.753] (-915.485) (-910.285) (-910.518) -- 0:00:28 537000 -- [-911.403] (-910.317) (-913.248) (-913.414) * (-910.942) (-910.519) (-914.762) [-910.689] -- 0:00:28 537500 -- (-911.099) [-913.831] (-910.440) (-911.751) * (-910.454) [-911.514] (-910.073) (-910.145) -- 0:00:28 538000 -- [-911.989] (-915.714) (-909.894) (-911.172) * (-912.440) (-911.846) [-910.777] (-910.352) -- 0:00:28 538500 -- (-915.249) (-912.368) [-910.000] (-910.893) * [-915.391] (-911.400) (-914.696) (-910.278) -- 0:00:28 539000 -- (-913.266) (-911.103) (-910.246) [-909.707] * (-912.471) [-912.269] (-912.644) (-911.309) -- 0:00:28 539500 -- (-911.937) (-909.876) (-909.700) [-912.621] * (-912.401) (-914.182) [-910.999] (-911.604) -- 0:00:28 540000 -- (-913.076) [-909.813] (-910.530) (-912.186) * (-912.830) (-911.896) [-910.247] (-911.905) -- 0:00:28 Average standard deviation of split frequencies: 0.009155 540500 -- [-912.805] (-911.305) (-910.353) (-911.708) * (-909.816) (-912.378) [-911.411] (-913.716) -- 0:00:28 541000 -- (-911.127) [-909.916] (-917.745) (-910.667) * (-910.459) [-912.835] (-911.749) (-915.225) -- 0:00:27 541500 -- [-910.767] (-910.598) (-910.713) (-910.315) * [-909.925] (-916.887) (-914.018) (-911.670) -- 0:00:27 542000 -- (-911.802) (-912.000) [-911.356] (-914.385) * (-910.072) [-911.825] (-912.723) (-909.566) -- 0:00:27 542500 -- [-912.554] (-911.496) (-912.053) (-913.324) * [-911.518] (-912.345) (-913.329) (-909.668) -- 0:00:27 543000 -- (-911.791) [-916.856] (-910.718) (-914.230) * (-913.951) [-911.288] (-913.325) (-911.301) -- 0:00:27 543500 -- (-910.373) (-916.998) (-912.547) [-913.248] * (-910.312) (-910.883) [-911.428] (-910.419) -- 0:00:27 544000 -- (-911.297) [-911.444] (-917.146) (-915.699) * [-910.602] (-911.344) (-912.201) (-910.109) -- 0:00:27 544500 -- (-913.813) (-911.935) [-915.537] (-913.019) * (-911.847) (-910.367) (-914.458) [-913.108] -- 0:00:27 545000 -- (-912.068) [-912.172] (-914.340) (-913.462) * (-910.986) (-909.852) [-914.278] (-912.417) -- 0:00:27 Average standard deviation of split frequencies: 0.008735 545500 -- [-912.565] (-910.595) (-916.821) (-915.346) * (-910.086) (-910.632) (-910.869) [-910.628] -- 0:00:27 546000 -- [-911.690] (-911.660) (-912.346) (-912.269) * (-910.477) (-912.755) (-913.014) [-910.575] -- 0:00:27 546500 -- (-913.370) [-911.471] (-910.625) (-910.828) * [-910.562] (-909.876) (-913.117) (-915.552) -- 0:00:27 547000 -- (-912.453) (-911.367) (-910.510) [-912.676] * [-911.967] (-913.577) (-912.741) (-911.184) -- 0:00:27 547500 -- (-914.622) (-911.634) [-912.521] (-915.506) * (-913.223) (-913.473) (-916.548) [-911.628] -- 0:00:27 548000 -- (-910.779) [-913.860] (-913.682) (-911.678) * (-910.565) (-910.283) [-912.528] (-912.705) -- 0:00:27 548500 -- [-912.038] (-912.919) (-912.878) (-913.745) * (-911.204) (-910.813) (-911.996) [-913.753] -- 0:00:27 549000 -- (-912.175) (-917.437) [-913.164] (-912.600) * (-912.059) (-911.718) [-912.864] (-914.703) -- 0:00:27 549500 -- [-911.949] (-918.672) (-921.799) (-912.019) * (-910.343) [-911.138] (-910.437) (-912.095) -- 0:00:27 550000 -- [-912.343] (-914.590) (-915.835) (-911.277) * (-910.576) (-910.618) (-915.219) [-912.556] -- 0:00:27 Average standard deviation of split frequencies: 0.009115 550500 -- (-912.356) (-916.571) [-910.724] (-911.879) * (-915.817) (-910.792) (-917.278) [-912.018] -- 0:00:27 551000 -- (-913.010) (-911.490) (-911.793) [-913.543] * [-910.956] (-912.711) (-915.494) (-915.734) -- 0:00:27 551500 -- (-912.807) [-910.299] (-912.314) (-911.164) * [-911.806] (-912.832) (-916.657) (-912.471) -- 0:00:27 552000 -- (-913.191) (-911.312) [-914.402] (-913.019) * (-912.198) (-914.485) [-916.003] (-913.164) -- 0:00:27 552500 -- (-912.214) (-910.530) (-910.678) [-912.568] * (-918.335) [-911.144] (-911.435) (-911.950) -- 0:00:27 553000 -- (-912.970) (-911.442) [-913.832] (-916.455) * [-915.415] (-910.581) (-913.239) (-911.337) -- 0:00:27 553500 -- (-909.912) (-915.726) [-917.734] (-915.027) * (-912.237) (-910.676) (-910.947) [-912.549] -- 0:00:27 554000 -- (-913.166) (-911.899) (-914.550) [-911.137] * (-911.201) [-911.513] (-912.124) (-912.547) -- 0:00:27 554500 -- (-910.303) [-911.554] (-913.963) (-913.986) * (-911.912) [-910.343] (-913.031) (-911.740) -- 0:00:27 555000 -- (-910.907) (-911.638) (-911.517) [-911.230] * (-910.389) (-913.544) [-912.528] (-912.625) -- 0:00:27 Average standard deviation of split frequencies: 0.009379 555500 -- (-912.834) (-911.251) [-911.232] (-917.036) * [-912.724] (-911.477) (-914.196) (-916.362) -- 0:00:27 556000 -- (-911.967) (-913.716) (-913.591) [-915.678] * (-911.812) [-911.883] (-911.268) (-909.961) -- 0:00:27 556500 -- (-910.534) [-912.019] (-913.987) (-910.997) * (-918.589) (-911.097) (-914.183) [-909.885] -- 0:00:27 557000 -- (-915.419) [-910.920] (-910.843) (-911.485) * (-915.259) (-911.195) [-910.999] (-910.497) -- 0:00:27 557500 -- (-914.818) (-911.488) [-911.008] (-914.458) * (-914.662) (-910.859) [-910.712] (-911.448) -- 0:00:26 558000 -- (-914.473) (-913.191) [-912.913] (-912.033) * (-913.478) [-911.540] (-915.172) (-913.726) -- 0:00:26 558500 -- (-911.634) (-910.766) [-910.263] (-912.298) * (-911.925) (-910.892) [-911.413] (-912.124) -- 0:00:26 559000 -- [-911.017] (-912.107) (-915.234) (-915.065) * (-913.368) (-910.619) (-912.790) [-911.271] -- 0:00:26 559500 -- [-911.222] (-912.048) (-917.291) (-911.821) * (-916.216) (-910.613) [-911.514] (-910.570) -- 0:00:26 560000 -- (-911.000) (-914.822) (-911.554) [-914.855] * (-912.473) (-911.088) [-912.518] (-911.498) -- 0:00:26 Average standard deviation of split frequencies: 0.009039 560500 -- (-911.081) (-912.016) [-910.627] (-912.008) * [-912.825] (-911.029) (-912.638) (-911.047) -- 0:00:26 561000 -- (-910.810) (-915.421) (-913.321) [-911.517] * (-911.525) (-911.032) (-912.767) [-911.134] -- 0:00:26 561500 -- (-915.121) (-916.740) (-912.206) [-913.675] * (-911.995) (-915.490) (-914.003) [-911.325] -- 0:00:26 562000 -- (-912.410) (-914.822) [-911.716] (-922.176) * (-914.029) (-912.967) (-912.559) [-912.761] -- 0:00:26 562500 -- (-914.466) [-911.668] (-911.120) (-913.648) * [-913.173] (-912.428) (-914.197) (-912.177) -- 0:00:26 563000 -- [-911.722] (-913.307) (-913.537) (-914.352) * (-915.007) [-912.817] (-910.823) (-910.776) -- 0:00:26 563500 -- [-910.989] (-910.335) (-910.945) (-912.850) * (-915.846) (-912.775) [-915.083] (-915.212) -- 0:00:26 564000 -- (-910.774) (-911.922) (-911.890) [-912.529] * (-911.567) [-910.986] (-913.392) (-914.128) -- 0:00:26 564500 -- (-910.427) (-911.284) (-910.691) [-915.380] * [-912.782] (-910.395) (-911.802) (-912.039) -- 0:00:26 565000 -- [-911.023] (-912.138) (-914.620) (-915.684) * (-913.218) (-913.428) (-911.573) [-912.700] -- 0:00:26 Average standard deviation of split frequencies: 0.008797 565500 -- (-911.036) (-912.950) [-910.468] (-911.789) * (-913.059) (-911.819) (-910.346) [-913.741] -- 0:00:26 566000 -- (-912.064) [-910.690] (-911.381) (-912.303) * (-914.641) (-911.946) (-910.274) [-912.318] -- 0:00:26 566500 -- (-912.681) (-913.658) [-911.310] (-915.589) * (-911.631) (-912.684) [-910.398] (-911.966) -- 0:00:26 567000 -- [-914.370] (-912.164) (-911.563) (-910.509) * (-910.070) (-916.650) (-910.117) [-911.874] -- 0:00:26 567500 -- [-912.693] (-910.802) (-910.713) (-912.266) * (-909.711) (-916.292) (-910.542) [-910.677] -- 0:00:26 568000 -- [-914.636] (-911.475) (-910.731) (-913.235) * (-909.938) [-912.641] (-911.405) (-910.617) -- 0:00:26 568500 -- (-910.830) [-911.996] (-912.908) (-912.884) * (-912.303) (-911.888) (-911.448) [-910.234] -- 0:00:26 569000 -- (-911.784) (-912.390) (-912.178) [-910.053] * (-911.934) (-910.923) [-913.249] (-912.419) -- 0:00:26 569500 -- [-910.730] (-912.352) (-910.681) (-910.000) * (-912.530) (-913.370) [-911.403] (-910.858) -- 0:00:26 570000 -- [-910.374] (-911.215) (-910.622) (-911.454) * [-915.259] (-912.868) (-913.648) (-911.658) -- 0:00:26 Average standard deviation of split frequencies: 0.008519 570500 -- (-910.819) (-911.849) (-911.877) [-910.456] * (-914.041) (-913.004) (-909.698) [-913.428] -- 0:00:26 571000 -- (-911.051) [-911.213] (-910.831) (-911.875) * (-916.255) (-913.359) (-913.788) [-911.856] -- 0:00:26 571500 -- (-910.542) [-911.966] (-913.596) (-913.829) * (-911.114) (-911.774) (-918.276) [-911.039] -- 0:00:26 572000 -- (-910.118) (-911.189) [-912.343] (-910.168) * (-912.763) (-911.024) [-912.349] (-912.067) -- 0:00:26 572500 -- (-912.297) [-910.234] (-915.657) (-910.723) * (-911.993) (-911.766) (-912.905) [-911.895] -- 0:00:26 573000 -- [-910.833] (-910.723) (-911.665) (-913.547) * (-911.873) [-911.202] (-912.404) (-912.812) -- 0:00:26 573500 -- [-910.128] (-912.314) (-911.696) (-912.541) * (-911.950) [-911.984] (-913.282) (-911.860) -- 0:00:26 574000 -- (-910.326) (-910.224) [-911.048] (-910.159) * (-913.916) (-912.509) [-911.023] (-910.835) -- 0:00:25 574500 -- [-912.240] (-912.356) (-911.226) (-913.421) * (-912.898) (-912.664) (-913.252) [-911.999] -- 0:00:25 575000 -- [-913.607] (-912.196) (-916.255) (-912.045) * (-912.987) (-914.758) [-912.334] (-910.166) -- 0:00:25 Average standard deviation of split frequencies: 0.008521 575500 -- (-911.735) [-911.941] (-913.948) (-914.401) * (-910.833) [-910.989] (-914.099) (-910.938) -- 0:00:25 576000 -- (-912.543) [-911.245] (-911.404) (-910.846) * (-910.737) (-913.043) [-911.094] (-913.008) -- 0:00:25 576500 -- [-910.481] (-913.009) (-915.286) (-910.696) * (-912.909) [-911.476] (-912.807) (-910.410) -- 0:00:25 577000 -- (-914.248) (-912.686) (-911.177) [-912.000] * (-912.742) (-911.357) [-912.872] (-911.451) -- 0:00:25 577500 -- (-912.753) (-913.090) (-911.104) [-912.067] * (-916.478) [-911.185] (-912.427) (-912.354) -- 0:00:25 578000 -- (-910.474) (-911.432) [-912.037] (-911.540) * (-914.457) (-911.611) [-913.999] (-911.595) -- 0:00:25 578500 -- (-915.435) (-913.581) (-912.464) [-911.656] * (-914.030) (-913.469) [-912.211] (-911.304) -- 0:00:25 579000 -- (-910.332) [-911.649] (-915.832) (-911.730) * (-915.036) (-910.386) [-913.633] (-911.954) -- 0:00:25 579500 -- (-912.411) (-913.735) (-913.044) [-912.913] * (-912.100) (-910.083) [-910.639] (-911.317) -- 0:00:25 580000 -- [-910.581] (-910.331) (-912.267) (-911.879) * (-915.690) (-912.137) [-910.112] (-911.319) -- 0:00:25 Average standard deviation of split frequencies: 0.008691 580500 -- [-911.124] (-910.726) (-912.444) (-912.022) * (-912.805) (-911.205) (-911.318) [-910.073] -- 0:00:25 581000 -- (-915.657) (-917.035) [-912.897] (-912.810) * [-912.171] (-912.393) (-910.340) (-911.013) -- 0:00:25 581500 -- (-911.953) (-916.072) [-910.832] (-913.758) * [-911.699] (-911.041) (-910.849) (-910.450) -- 0:00:25 582000 -- [-912.372] (-913.343) (-911.596) (-912.921) * (-913.544) (-911.044) [-911.628] (-911.152) -- 0:00:25 582500 -- (-912.436) [-910.287] (-919.653) (-913.312) * [-911.657] (-910.816) (-912.012) (-911.340) -- 0:00:25 583000 -- [-910.677] (-910.742) (-913.833) (-911.092) * (-911.074) (-914.044) [-913.689] (-912.115) -- 0:00:25 583500 -- [-910.768] (-911.702) (-913.187) (-909.994) * (-910.743) (-910.067) [-910.132] (-912.031) -- 0:00:25 584000 -- (-911.122) (-910.432) [-913.008] (-912.634) * (-914.275) (-913.560) [-910.636] (-911.299) -- 0:00:25 584500 -- (-913.052) (-912.097) [-911.757] (-911.234) * (-911.870) (-918.448) (-914.248) [-911.051] -- 0:00:25 585000 -- (-910.726) (-911.485) (-913.097) [-909.963] * (-910.488) [-911.141] (-913.708) (-910.931) -- 0:00:25 Average standard deviation of split frequencies: 0.008754 585500 -- (-910.112) (-912.189) (-911.544) [-910.123] * (-910.787) (-910.367) (-914.182) [-910.672] -- 0:00:25 586000 -- (-910.064) (-912.285) (-911.758) [-911.097] * (-911.741) (-910.818) (-912.998) [-910.395] -- 0:00:25 586500 -- (-912.300) [-912.919] (-911.829) (-911.348) * (-911.501) (-910.729) [-910.922] (-914.152) -- 0:00:25 587000 -- (-910.315) [-911.249] (-912.342) (-910.700) * (-910.303) (-910.087) [-911.723] (-911.735) -- 0:00:25 587500 -- [-914.473] (-913.269) (-911.641) (-912.128) * (-912.494) [-909.984] (-918.256) (-916.993) -- 0:00:25 588000 -- (-913.364) (-910.373) [-913.316] (-915.639) * [-911.372] (-910.873) (-910.627) (-910.736) -- 0:00:25 588500 -- (-913.391) (-911.306) [-914.774] (-913.544) * (-911.275) (-912.866) [-911.382] (-911.545) -- 0:00:25 589000 -- (-912.360) (-916.878) [-910.357] (-911.185) * [-912.827] (-911.426) (-913.578) (-910.797) -- 0:00:25 589500 -- (-911.274) (-911.806) [-910.924] (-914.639) * [-912.798] (-911.672) (-913.148) (-910.098) -- 0:00:25 590000 -- (-911.084) (-911.921) [-912.316] (-917.596) * (-912.396) [-913.220] (-914.149) (-912.703) -- 0:00:25 Average standard deviation of split frequencies: 0.008779 590500 -- [-911.581] (-910.531) (-910.261) (-918.635) * (-909.947) (-912.330) (-911.812) [-914.047] -- 0:00:24 591000 -- (-913.072) [-911.543] (-911.007) (-912.460) * (-910.959) (-912.123) (-912.115) [-911.101] -- 0:00:24 591500 -- (-914.487) (-914.856) [-910.088] (-912.741) * (-911.766) [-912.151] (-910.857) (-911.116) -- 0:00:24 592000 -- [-913.769] (-912.990) (-912.687) (-913.317) * (-911.931) [-909.963] (-910.177) (-911.815) -- 0:00:24 592500 -- (-915.933) (-912.730) [-910.996] (-910.714) * [-910.074] (-910.406) (-911.664) (-911.866) -- 0:00:24 593000 -- (-911.655) [-912.191] (-911.482) (-915.855) * (-912.039) [-910.684] (-911.617) (-912.128) -- 0:00:24 593500 -- (-917.854) (-912.484) [-913.991] (-914.308) * (-910.622) (-913.106) (-912.364) [-910.608] -- 0:00:24 594000 -- (-916.239) (-911.282) [-912.302] (-910.881) * [-911.994] (-913.329) (-911.197) (-911.081) -- 0:00:24 594500 -- (-911.227) (-911.348) (-910.338) [-910.805] * (-910.803) [-912.280] (-910.702) (-912.876) -- 0:00:24 595000 -- (-913.030) (-912.033) [-911.799] (-914.897) * (-910.799) (-912.314) (-910.156) [-911.067] -- 0:00:24 Average standard deviation of split frequencies: 0.009046 595500 -- [-912.129] (-912.456) (-911.796) (-913.219) * (-910.145) (-909.843) (-910.782) [-912.000] -- 0:00:24 596000 -- (-918.143) (-912.480) (-913.139) [-912.122] * (-910.738) (-909.843) [-910.063] (-912.730) -- 0:00:24 596500 -- (-916.222) [-914.844] (-910.912) (-911.243) * [-911.392] (-910.223) (-910.529) (-912.760) -- 0:00:24 597000 -- (-910.240) [-915.292] (-912.219) (-912.136) * (-911.397) (-911.783) [-911.190] (-916.928) -- 0:00:24 597500 -- [-915.450] (-912.911) (-910.470) (-910.564) * (-911.856) (-911.663) (-912.024) [-911.597] -- 0:00:24 598000 -- (-911.059) (-917.160) [-910.219] (-910.602) * [-912.485] (-910.918) (-911.302) (-914.978) -- 0:00:24 598500 -- (-911.419) [-911.296] (-910.850) (-911.132) * (-912.899) (-910.315) [-910.692] (-912.183) -- 0:00:24 599000 -- [-912.426] (-911.036) (-910.532) (-915.539) * (-911.212) (-913.450) [-911.391] (-911.144) -- 0:00:24 599500 -- (-910.073) [-911.822] (-911.682) (-914.688) * (-912.135) (-911.691) (-911.902) [-912.851] -- 0:00:24 600000 -- (-910.503) [-912.984] (-911.752) (-916.685) * [-911.708] (-918.072) (-912.198) (-911.694) -- 0:00:24 Average standard deviation of split frequencies: 0.009320 600500 -- (-910.846) (-914.230) [-910.275] (-914.416) * (-911.213) [-918.447] (-911.924) (-910.506) -- 0:00:24 601000 -- (-915.140) [-910.463] (-912.423) (-915.519) * (-913.140) [-917.149] (-911.111) (-910.506) -- 0:00:24 601500 -- (-912.080) (-910.158) (-911.834) [-909.983] * [-912.433] (-912.292) (-910.975) (-911.939) -- 0:00:24 602000 -- (-911.171) (-911.806) (-913.673) [-910.397] * [-912.634] (-910.604) (-911.081) (-911.558) -- 0:00:24 602500 -- (-913.881) (-911.647) [-912.582] (-913.833) * (-911.639) (-911.396) (-911.183) [-910.378] -- 0:00:24 603000 -- (-910.610) [-910.150] (-912.828) (-913.344) * (-910.450) [-910.271] (-911.953) (-910.535) -- 0:00:24 603500 -- (-913.835) (-915.786) [-911.260] (-913.628) * (-913.819) [-910.406] (-911.117) (-913.044) -- 0:00:24 604000 -- (-913.535) (-911.864) (-912.591) [-911.320] * (-914.049) (-909.836) [-913.359] (-911.050) -- 0:00:24 604500 -- (-910.813) [-912.598] (-909.904) (-910.056) * (-909.660) (-915.096) [-912.362] (-910.942) -- 0:00:24 605000 -- (-911.144) (-916.421) (-909.769) [-910.616] * (-911.780) (-911.499) (-913.437) [-911.045] -- 0:00:24 Average standard deviation of split frequencies: 0.008969 605500 -- (-912.525) (-917.792) [-910.127] (-909.931) * (-911.057) [-911.455] (-912.831) (-909.812) -- 0:00:24 606000 -- [-912.166] (-919.100) (-911.949) (-910.435) * (-911.724) (-913.787) [-913.176] (-910.577) -- 0:00:24 606500 -- (-909.969) (-917.203) (-911.770) [-911.265] * [-911.985] (-912.874) (-910.563) (-911.664) -- 0:00:24 607000 -- (-910.151) (-909.950) (-914.487) [-910.531] * (-911.750) (-911.113) (-909.979) [-912.756] -- 0:00:23 607500 -- (-910.965) [-910.767] (-910.276) (-910.657) * (-912.982) (-910.963) (-913.832) [-910.860] -- 0:00:23 608000 -- (-910.095) [-910.798] (-911.972) (-910.600) * (-911.509) (-911.031) [-912.276] (-911.702) -- 0:00:23 608500 -- (-915.734) [-910.374] (-913.485) (-913.333) * (-911.547) (-911.222) (-915.857) [-909.693] -- 0:00:23 609000 -- (-912.111) [-910.338] (-912.510) (-911.910) * (-910.599) (-912.829) (-910.856) [-910.508] -- 0:00:23 609500 -- (-911.219) (-918.261) (-911.894) [-911.706] * (-909.959) (-910.860) [-911.820] (-912.019) -- 0:00:23 610000 -- (-910.959) (-916.376) (-915.519) [-914.186] * (-911.622) (-918.439) [-913.216] (-912.492) -- 0:00:23 Average standard deviation of split frequencies: 0.009490 610500 -- (-913.825) (-911.746) [-912.183] (-914.039) * [-911.818] (-915.540) (-913.970) (-913.611) -- 0:00:23 611000 -- (-913.538) (-915.282) [-912.552] (-914.050) * (-910.856) (-911.230) [-911.068] (-913.147) -- 0:00:23 611500 -- (-910.796) (-913.760) [-911.526] (-918.817) * (-912.000) [-910.953] (-912.435) (-911.396) -- 0:00:23 612000 -- (-910.283) (-913.157) (-910.826) [-911.796] * (-910.949) (-910.278) [-913.393] (-913.758) -- 0:00:23 612500 -- [-910.494] (-913.935) (-912.735) (-911.489) * (-911.158) (-910.919) [-912.095] (-910.247) -- 0:00:23 613000 -- [-914.861] (-914.355) (-914.090) (-912.278) * (-917.516) [-910.546] (-916.757) (-910.095) -- 0:00:23 613500 -- (-914.891) (-913.352) (-914.000) [-916.832] * (-910.515) (-910.693) (-912.263) [-912.471] -- 0:00:23 614000 -- (-911.212) (-912.782) (-912.865) [-911.850] * (-912.150) (-918.161) [-911.875] (-911.010) -- 0:00:23 614500 -- [-910.000] (-912.266) (-910.599) (-913.957) * [-910.851] (-915.440) (-909.887) (-914.773) -- 0:00:23 615000 -- (-911.291) (-912.729) [-910.643] (-912.514) * [-911.674] (-912.251) (-912.593) (-910.477) -- 0:00:23 Average standard deviation of split frequencies: 0.009318 615500 -- (-911.994) (-911.777) [-912.185] (-913.288) * (-911.519) [-910.958] (-911.592) (-910.714) -- 0:00:23 616000 -- [-916.295] (-910.692) (-910.879) (-914.504) * [-911.279] (-916.108) (-912.437) (-915.947) -- 0:00:23 616500 -- (-917.496) (-910.074) [-912.064] (-913.848) * (-910.526) (-910.135) [-914.110] (-912.096) -- 0:00:23 617000 -- (-912.202) (-910.489) [-911.726] (-910.724) * (-914.535) (-912.860) (-915.179) [-910.469] -- 0:00:23 617500 -- (-910.011) [-917.319] (-912.092) (-910.550) * (-910.461) (-912.064) [-912.465] (-911.194) -- 0:00:23 618000 -- [-910.170] (-914.367) (-910.303) (-910.175) * [-910.888] (-909.881) (-912.421) (-912.195) -- 0:00:23 618500 -- (-911.370) [-912.918] (-910.324) (-914.761) * (-919.088) [-911.618] (-911.049) (-914.964) -- 0:00:23 619000 -- [-911.238] (-913.353) (-912.751) (-911.968) * [-911.358] (-912.616) (-910.598) (-911.628) -- 0:00:23 619500 -- (-911.464) [-911.418] (-913.111) (-911.302) * (-915.785) [-913.082] (-913.126) (-910.278) -- 0:00:23 620000 -- (-913.971) [-910.525] (-913.965) (-911.620) * [-914.989] (-909.999) (-913.783) (-911.263) -- 0:00:23 Average standard deviation of split frequencies: 0.009293 620500 -- [-914.250] (-910.404) (-910.844) (-912.585) * (-911.344) (-911.457) (-911.357) [-912.228] -- 0:00:23 621000 -- (-912.703) [-911.049] (-910.949) (-914.004) * [-912.072] (-910.129) (-912.222) (-912.606) -- 0:00:23 621500 -- (-912.094) (-912.904) (-910.458) [-913.270] * (-912.988) (-912.902) [-913.834] (-913.639) -- 0:00:23 622000 -- (-911.481) [-910.565] (-913.017) (-912.091) * [-912.021] (-911.124) (-914.658) (-911.909) -- 0:00:23 622500 -- (-917.009) (-913.409) (-912.843) [-914.201] * [-910.619] (-911.640) (-913.670) (-912.660) -- 0:00:23 623000 -- [-914.221] (-910.441) (-914.043) (-913.766) * (-910.913) (-912.923) (-913.052) [-910.398] -- 0:00:22 623500 -- (-911.564) (-910.466) (-911.954) [-912.644] * [-913.955] (-911.710) (-913.707) (-910.894) -- 0:00:22 624000 -- (-911.061) (-912.603) (-912.028) [-912.647] * (-913.117) [-911.422] (-913.018) (-914.397) -- 0:00:22 624500 -- (-911.778) (-914.391) (-910.560) [-913.431] * [-912.558] (-911.931) (-913.368) (-919.958) -- 0:00:22 625000 -- (-914.121) (-912.474) [-910.896] (-913.092) * (-912.739) (-913.598) (-911.138) [-915.317] -- 0:00:22 Average standard deviation of split frequencies: 0.009435 625500 -- (-910.560) [-914.892] (-910.450) (-913.593) * (-911.986) [-910.500] (-915.025) (-915.316) -- 0:00:22 626000 -- [-913.263] (-914.012) (-915.307) (-910.950) * (-910.326) (-911.258) (-911.219) [-911.402] -- 0:00:22 626500 -- (-916.048) (-914.012) (-911.990) [-912.616] * [-910.326] (-911.666) (-911.325) (-913.057) -- 0:00:22 627000 -- (-910.846) [-911.412] (-911.913) (-911.963) * (-910.847) [-911.893] (-913.440) (-913.863) -- 0:00:22 627500 -- [-910.282] (-913.015) (-912.309) (-910.928) * [-911.968] (-910.856) (-911.998) (-911.255) -- 0:00:22 628000 -- (-918.109) (-910.435) (-911.575) [-910.524] * (-911.402) [-912.236] (-913.742) (-911.081) -- 0:00:22 628500 -- (-915.073) (-911.987) [-918.585] (-910.531) * [-912.676] (-912.222) (-912.557) (-911.665) -- 0:00:22 629000 -- (-915.927) [-913.416] (-911.290) (-912.425) * (-912.681) (-911.924) (-910.390) [-914.266] -- 0:00:22 629500 -- (-918.514) [-911.148] (-913.001) (-913.374) * (-912.252) (-910.849) [-912.066] (-911.756) -- 0:00:22 630000 -- (-910.657) (-914.345) [-911.582] (-917.127) * (-915.211) (-912.584) (-914.958) [-912.757] -- 0:00:22 Average standard deviation of split frequencies: 0.009146 630500 -- [-913.511] (-911.691) (-911.192) (-912.583) * (-910.575) [-911.494] (-912.086) (-911.074) -- 0:00:22 631000 -- (-913.343) (-912.177) [-910.663] (-913.230) * [-910.174] (-911.750) (-911.136) (-910.964) -- 0:00:22 631500 -- [-910.427] (-913.368) (-910.992) (-913.958) * [-911.101] (-911.265) (-910.524) (-910.604) -- 0:00:22 632000 -- [-910.107] (-913.752) (-910.562) (-911.603) * (-910.404) [-913.964] (-916.231) (-910.589) -- 0:00:22 632500 -- (-910.349) (-910.820) [-916.776] (-912.233) * [-912.095] (-912.766) (-911.259) (-913.285) -- 0:00:22 633000 -- (-912.420) (-910.851) [-911.694] (-911.982) * [-913.084] (-911.145) (-910.458) (-912.665) -- 0:00:22 633500 -- (-910.887) [-911.536] (-913.796) (-915.013) * [-913.420] (-911.075) (-911.038) (-910.404) -- 0:00:22 634000 -- (-915.061) [-910.426] (-913.000) (-911.828) * (-913.936) (-910.972) (-910.493) [-913.564] -- 0:00:22 634500 -- (-912.175) (-910.572) [-914.224] (-910.733) * [-911.279] (-911.503) (-909.771) (-911.210) -- 0:00:22 635000 -- (-910.524) (-911.982) [-912.506] (-913.999) * [-912.163] (-909.638) (-914.230) (-916.981) -- 0:00:22 Average standard deviation of split frequencies: 0.009461 635500 -- (-912.166) (-910.855) [-914.224] (-911.235) * [-911.724] (-910.795) (-911.993) (-916.772) -- 0:00:22 636000 -- (-912.559) (-913.912) [-913.061] (-914.473) * [-912.373] (-910.781) (-914.615) (-909.723) -- 0:00:22 636500 -- (-913.918) [-910.031] (-912.741) (-912.704) * (-910.330) (-910.107) (-913.083) [-910.313] -- 0:00:22 637000 -- (-910.388) (-912.869) (-914.562) [-910.248] * [-914.497] (-910.655) (-916.606) (-911.264) -- 0:00:22 637500 -- (-911.219) [-909.759] (-913.204) (-910.929) * [-910.897] (-914.387) (-914.695) (-913.810) -- 0:00:22 638000 -- (-916.664) [-909.967] (-918.953) (-910.614) * [-911.640] (-912.135) (-912.818) (-914.042) -- 0:00:22 638500 -- (-911.444) (-910.432) (-919.778) [-910.274] * [-912.027] (-911.258) (-914.758) (-910.163) -- 0:00:22 639000 -- (-911.804) (-912.820) [-910.369] (-914.520) * (-910.185) (-910.811) (-910.037) [-910.341] -- 0:00:22 639500 -- (-914.570) (-911.895) [-912.554] (-913.559) * (-910.723) [-910.884] (-911.456) (-910.218) -- 0:00:21 640000 -- [-915.757] (-913.397) (-910.530) (-912.251) * (-913.717) (-913.309) [-912.240] (-910.278) -- 0:00:21 Average standard deviation of split frequencies: 0.008916 640500 -- (-911.014) [-912.407] (-911.259) (-911.137) * [-910.129] (-911.495) (-911.672) (-910.950) -- 0:00:21 641000 -- (-912.175) [-912.107] (-910.470) (-911.288) * [-909.942] (-916.615) (-910.301) (-913.089) -- 0:00:21 641500 -- (-911.299) (-913.657) (-915.202) [-910.737] * (-911.442) (-914.733) (-912.273) [-913.433] -- 0:00:21 642000 -- (-912.502) [-912.792] (-914.066) (-912.597) * (-910.092) [-918.277] (-910.757) (-911.872) -- 0:00:21 642500 -- (-913.604) [-910.593] (-914.726) (-914.843) * [-912.914] (-917.226) (-912.200) (-911.147) -- 0:00:21 643000 -- (-915.346) (-910.406) (-915.534) [-913.172] * (-917.092) (-918.135) [-911.464] (-912.833) -- 0:00:21 643500 -- [-912.082] (-910.958) (-917.683) (-911.769) * [-910.155] (-918.712) (-911.138) (-915.759) -- 0:00:21 644000 -- [-910.518] (-911.304) (-914.908) (-910.466) * (-912.295) (-910.303) [-911.040] (-913.082) -- 0:00:21 644500 -- [-910.221] (-912.937) (-913.711) (-911.590) * (-912.029) [-911.117] (-910.105) (-909.848) -- 0:00:21 645000 -- (-912.125) (-912.841) [-909.958] (-911.807) * (-910.694) (-913.128) (-911.122) [-910.148] -- 0:00:21 Average standard deviation of split frequencies: 0.009143 645500 -- (-911.744) (-913.961) (-911.276) [-909.862] * (-911.059) (-911.893) (-913.929) [-910.985] -- 0:00:21 646000 -- (-913.078) [-910.944] (-912.602) (-912.055) * (-911.056) [-912.404] (-914.557) (-913.211) -- 0:00:21 646500 -- (-910.056) [-911.842] (-912.352) (-909.853) * [-912.931] (-912.760) (-911.863) (-916.353) -- 0:00:21 647000 -- (-910.826) (-912.838) [-910.114] (-910.131) * (-913.046) (-911.714) [-912.975] (-911.169) -- 0:00:21 647500 -- (-913.537) [-912.581] (-917.008) (-912.231) * (-911.910) (-912.348) [-912.302] (-911.598) -- 0:00:21 648000 -- [-913.161] (-912.556) (-912.894) (-914.487) * [-915.222] (-911.460) (-912.258) (-911.308) -- 0:00:21 648500 -- [-912.699] (-911.213) (-909.984) (-910.815) * [-911.722] (-910.687) (-913.736) (-910.626) -- 0:00:21 649000 -- (-910.663) [-913.955] (-914.950) (-914.100) * [-911.330] (-913.902) (-914.114) (-910.192) -- 0:00:21 649500 -- (-910.663) [-913.656] (-911.852) (-912.304) * (-910.699) (-913.798) (-913.934) [-911.366] -- 0:00:21 650000 -- [-912.434] (-912.799) (-911.739) (-912.257) * (-911.162) (-910.616) (-912.340) [-911.996] -- 0:00:21 Average standard deviation of split frequencies: 0.009418 650500 -- [-910.979] (-913.912) (-910.805) (-911.012) * (-912.189) [-913.008] (-911.660) (-916.794) -- 0:00:21 651000 -- (-910.087) [-911.239] (-916.986) (-910.435) * (-910.965) (-913.639) [-911.271] (-912.828) -- 0:00:21 651500 -- (-911.137) (-909.805) (-910.245) [-909.863] * (-911.579) (-917.355) [-911.413] (-910.701) -- 0:00:21 652000 -- (-913.059) (-910.548) [-910.374] (-911.410) * (-912.581) (-912.696) [-914.140] (-910.456) -- 0:00:21 652500 -- (-912.550) (-910.752) [-912.024] (-917.690) * (-913.298) (-917.464) [-913.536] (-911.699) -- 0:00:21 653000 -- [-910.345] (-914.812) (-912.266) (-912.026) * (-911.161) (-911.067) [-912.800] (-910.867) -- 0:00:21 653500 -- [-910.044] (-910.350) (-911.937) (-910.665) * (-911.495) (-913.359) (-910.682) [-912.860] -- 0:00:21 654000 -- [-910.660] (-910.821) (-911.254) (-913.642) * (-910.895) [-917.011] (-910.996) (-913.584) -- 0:00:21 654500 -- (-912.808) [-910.399] (-909.970) (-911.677) * (-911.509) [-910.894] (-909.933) (-912.588) -- 0:00:21 655000 -- (-911.514) (-910.931) (-912.709) [-911.223] * [-910.552] (-913.278) (-911.351) (-910.683) -- 0:00:21 Average standard deviation of split frequencies: 0.009046 655500 -- (-911.485) [-911.111] (-917.369) (-912.097) * (-911.544) [-916.917] (-914.997) (-910.652) -- 0:00:21 656000 -- [-911.569] (-912.087) (-911.813) (-911.102) * (-911.403) [-914.394] (-913.640) (-911.575) -- 0:00:20 656500 -- (-912.320) (-912.359) (-912.862) [-910.902] * (-912.689) [-913.692] (-915.117) (-911.549) -- 0:00:20 657000 -- (-918.652) (-910.390) (-912.500) [-913.179] * (-909.669) (-912.605) (-912.812) [-911.697] -- 0:00:20 657500 -- (-917.800) (-912.550) [-911.058] (-913.972) * (-912.070) [-912.085] (-913.442) (-911.668) -- 0:00:20 658000 -- (-914.206) (-913.776) (-911.693) [-912.737] * [-911.542] (-911.316) (-911.664) (-910.784) -- 0:00:20 658500 -- [-915.784] (-916.874) (-914.799) (-912.067) * [-912.711] (-911.254) (-910.762) (-910.261) -- 0:00:20 659000 -- [-911.514] (-916.607) (-913.762) (-911.203) * [-912.840] (-912.364) (-910.614) (-918.595) -- 0:00:20 659500 -- [-912.313] (-913.722) (-911.469) (-911.610) * (-915.444) (-911.793) (-912.641) [-911.622] -- 0:00:20 660000 -- [-911.244] (-912.423) (-910.146) (-910.995) * (-913.196) (-913.095) [-911.429] (-911.092) -- 0:00:20 Average standard deviation of split frequencies: 0.009150 660500 -- (-913.840) (-912.123) (-911.439) [-910.963] * (-915.677) (-911.134) (-912.704) [-910.963] -- 0:00:20 661000 -- (-913.283) (-911.296) (-910.453) [-911.819] * (-913.083) [-910.752] (-911.881) (-911.978) -- 0:00:20 661500 -- (-913.976) (-919.026) [-909.974] (-916.268) * (-914.841) [-910.167] (-913.329) (-911.660) -- 0:00:20 662000 -- (-912.975) (-912.344) [-910.678] (-914.212) * (-913.068) (-911.327) [-910.808] (-912.225) -- 0:00:20 662500 -- [-912.478] (-912.706) (-912.105) (-910.691) * [-911.134] (-910.952) (-911.034) (-910.581) -- 0:00:20 663000 -- (-911.123) (-910.548) [-910.982] (-910.741) * (-911.911) (-911.798) [-911.591] (-910.870) -- 0:00:20 663500 -- (-909.807) [-911.488] (-911.496) (-913.542) * [-912.105] (-914.874) (-915.146) (-914.824) -- 0:00:20 664000 -- (-910.876) (-912.244) (-912.274) [-913.013] * (-915.117) (-911.296) [-914.224] (-912.513) -- 0:00:20 664500 -- (-910.291) (-910.645) [-911.737] (-912.058) * (-912.118) [-910.661] (-913.158) (-910.236) -- 0:00:20 665000 -- (-917.580) (-911.123) (-911.854) [-910.235] * (-911.699) (-909.676) (-911.313) [-911.330] -- 0:00:20 Average standard deviation of split frequencies: 0.008993 665500 -- (-910.966) (-912.908) [-912.283] (-909.966) * [-910.935] (-912.263) (-912.275) (-912.829) -- 0:00:20 666000 -- (-909.987) [-911.312] (-913.425) (-912.306) * [-911.226] (-915.044) (-916.037) (-912.817) -- 0:00:20 666500 -- (-911.276) [-911.477] (-910.976) (-913.256) * (-913.824) (-914.271) (-912.280) [-911.159] -- 0:00:20 667000 -- (-913.917) (-911.545) (-913.011) [-910.675] * (-911.724) (-919.817) [-910.799] (-913.577) -- 0:00:20 667500 -- (-913.638) [-912.007] (-910.793) (-910.952) * (-911.085) (-914.697) [-911.899] (-910.404) -- 0:00:20 668000 -- (-912.270) (-912.518) [-910.650] (-913.029) * (-915.630) (-911.358) [-910.559] (-910.829) -- 0:00:20 668500 -- (-914.836) (-912.646) (-910.649) [-911.087] * [-915.388] (-911.725) (-911.430) (-912.098) -- 0:00:20 669000 -- [-913.427] (-910.988) (-911.445) (-912.020) * [-913.554] (-910.511) (-913.310) (-910.366) -- 0:00:20 669500 -- (-916.075) (-910.993) [-914.384] (-914.669) * (-911.537) [-911.004] (-914.283) (-913.500) -- 0:00:20 670000 -- (-912.813) (-911.696) [-911.141] (-910.383) * [-910.434] (-911.427) (-910.691) (-912.449) -- 0:00:20 Average standard deviation of split frequencies: 0.009386 670500 -- [-912.651] (-917.090) (-911.619) (-912.218) * (-917.145) (-911.985) [-911.979] (-913.237) -- 0:00:20 671000 -- (-912.062) [-913.768] (-912.171) (-914.539) * (-912.029) [-910.010] (-914.009) (-913.183) -- 0:00:20 671500 -- (-910.445) (-917.344) (-911.128) [-910.292] * (-910.116) [-914.321] (-912.305) (-918.048) -- 0:00:20 672000 -- [-911.857] (-915.086) (-911.583) (-911.604) * (-909.804) (-912.798) [-913.835] (-912.379) -- 0:00:20 672500 -- [-912.890] (-912.165) (-912.108) (-912.615) * (-909.599) (-913.133) [-910.460] (-913.663) -- 0:00:19 673000 -- [-911.991] (-913.529) (-911.487) (-915.118) * (-914.483) [-913.911] (-910.654) (-912.847) -- 0:00:19 673500 -- (-914.279) [-911.592] (-915.540) (-913.386) * [-912.771] (-916.956) (-914.806) (-914.349) -- 0:00:19 674000 -- [-912.999] (-911.182) (-912.721) (-913.732) * (-910.926) (-911.177) (-912.948) [-918.032] -- 0:00:19 674500 -- (-912.381) (-910.771) (-910.508) [-914.719] * (-915.986) (-912.874) (-911.996) [-913.718] -- 0:00:19 675000 -- (-917.206) (-920.275) [-910.447] (-913.458) * [-912.168] (-911.555) (-912.454) (-912.494) -- 0:00:19 Average standard deviation of split frequencies: 0.008819 675500 -- (-911.816) [-915.042] (-910.891) (-913.580) * (-910.768) [-910.933] (-913.821) (-912.939) -- 0:00:19 676000 -- [-912.964] (-916.333) (-918.081) (-911.240) * (-912.072) [-911.941] (-914.017) (-911.563) -- 0:00:19 676500 -- (-914.534) (-912.203) (-915.908) [-913.538] * (-915.214) (-912.333) [-912.553] (-910.299) -- 0:00:19 677000 -- (-914.914) (-912.529) (-911.346) [-911.371] * (-916.004) (-910.713) [-910.469] (-912.787) -- 0:00:19 677500 -- (-911.041) (-912.702) (-911.712) [-910.364] * (-916.173) [-911.729] (-912.814) (-913.293) -- 0:00:19 678000 -- [-916.877] (-910.248) (-913.748) (-910.895) * (-910.995) (-913.902) [-912.202] (-912.140) -- 0:00:19 678500 -- (-916.654) (-910.708) (-913.350) [-913.179] * (-914.012) (-911.151) (-912.670) [-918.012] -- 0:00:19 679000 -- (-911.835) [-912.037] (-914.649) (-912.437) * [-913.301] (-910.431) (-910.839) (-920.030) -- 0:00:19 679500 -- [-910.944] (-913.300) (-910.861) (-910.556) * (-916.171) [-911.692] (-912.145) (-913.882) -- 0:00:19 680000 -- (-911.590) (-910.902) [-914.710] (-914.638) * (-911.721) (-910.100) (-914.312) [-910.616] -- 0:00:19 Average standard deviation of split frequencies: 0.008311 680500 -- (-911.508) (-911.250) (-912.523) [-911.192] * [-913.508] (-911.102) (-911.631) (-909.921) -- 0:00:19 681000 -- (-910.030) [-910.556] (-912.952) (-909.861) * [-912.893] (-916.472) (-912.237) (-911.966) -- 0:00:19 681500 -- (-915.017) (-918.196) (-913.473) [-910.270] * (-910.881) [-913.585] (-911.091) (-914.045) -- 0:00:19 682000 -- [-912.331] (-910.371) (-910.214) (-913.171) * (-914.539) [-910.915] (-915.281) (-910.239) -- 0:00:19 682500 -- (-913.461) [-915.412] (-910.856) (-913.462) * (-912.970) (-911.303) [-912.539] (-910.666) -- 0:00:19 683000 -- (-915.120) (-911.006) [-911.496] (-916.084) * (-909.658) (-912.909) (-913.066) [-912.033] -- 0:00:19 683500 -- (-914.953) (-909.771) [-912.147] (-915.801) * (-912.473) (-910.664) (-912.757) [-910.972] -- 0:00:19 684000 -- [-911.924] (-909.571) (-912.037) (-911.662) * (-910.404) (-910.427) (-915.196) [-909.949] -- 0:00:19 684500 -- (-912.938) (-911.672) (-910.255) [-914.113] * [-911.409] (-914.365) (-914.729) (-909.978) -- 0:00:19 685000 -- [-910.202] (-911.083) (-913.799) (-912.597) * (-909.934) (-910.581) [-911.875] (-910.862) -- 0:00:19 Average standard deviation of split frequencies: 0.008547 685500 -- (-909.963) (-912.306) [-912.651] (-910.309) * (-910.299) [-910.585] (-910.892) (-916.090) -- 0:00:19 686000 -- (-912.061) [-911.746] (-912.259) (-912.898) * (-910.299) (-917.072) (-921.220) [-912.894] -- 0:00:19 686500 -- [-912.600] (-911.175) (-912.641) (-912.238) * [-911.934] (-914.162) (-915.989) (-911.128) -- 0:00:19 687000 -- [-910.100] (-911.911) (-912.342) (-912.617) * [-910.920] (-911.609) (-914.670) (-911.826) -- 0:00:19 687500 -- (-913.708) (-911.915) (-912.165) [-911.166] * (-911.616) [-912.899] (-911.848) (-911.062) -- 0:00:19 688000 -- (-913.551) (-911.822) [-916.026] (-913.643) * [-912.652] (-911.566) (-911.261) (-912.235) -- 0:00:19 688500 -- [-912.309] (-910.457) (-912.149) (-913.258) * (-910.232) (-912.346) [-911.810] (-914.692) -- 0:00:19 689000 -- (-912.474) [-912.499] (-911.837) (-911.413) * (-910.462) [-915.765] (-913.962) (-911.125) -- 0:00:18 689500 -- (-911.982) (-918.512) [-911.796] (-910.839) * [-910.523] (-912.914) (-912.987) (-911.979) -- 0:00:18 690000 -- [-911.577] (-917.971) (-911.783) (-911.713) * (-913.030) [-910.601] (-913.902) (-914.301) -- 0:00:18 Average standard deviation of split frequencies: 0.009034 690500 -- (-913.087) (-913.691) [-911.811] (-910.829) * (-914.018) [-911.149] (-913.472) (-914.064) -- 0:00:18 691000 -- (-910.215) [-912.119] (-912.286) (-910.563) * (-915.481) [-912.035] (-913.215) (-915.041) -- 0:00:18 691500 -- [-911.811] (-912.127) (-912.008) (-910.237) * (-911.562) (-911.201) [-912.896] (-911.314) -- 0:00:18 692000 -- [-913.232] (-916.398) (-911.149) (-918.759) * (-910.297) [-917.440] (-913.046) (-912.863) -- 0:00:18 692500 -- [-911.938] (-912.295) (-910.526) (-911.362) * (-911.787) (-914.184) (-913.484) [-911.399] -- 0:00:18 693000 -- (-912.045) (-910.810) [-911.050] (-914.813) * (-913.029) (-912.820) (-910.031) [-911.087] -- 0:00:18 693500 -- [-911.551] (-911.114) (-910.533) (-911.315) * (-914.675) (-913.454) [-913.205] (-914.202) -- 0:00:18 694000 -- (-911.258) (-910.511) (-913.224) [-913.714] * [-912.314] (-913.713) (-911.193) (-912.612) -- 0:00:18 694500 -- (-911.388) [-910.129] (-910.360) (-912.965) * (-912.378) (-911.757) (-910.427) [-910.758] -- 0:00:18 695000 -- (-911.635) (-911.052) (-913.817) [-910.784] * (-911.017) [-910.395] (-910.391) (-911.337) -- 0:00:18 Average standard deviation of split frequencies: 0.009323 695500 -- (-914.425) (-911.705) (-914.937) [-910.757] * [-912.557] (-910.239) (-911.711) (-912.426) -- 0:00:18 696000 -- [-910.633] (-912.786) (-911.010) (-911.375) * (-914.034) (-911.528) (-911.640) [-914.910] -- 0:00:18 696500 -- (-914.313) [-911.861] (-912.393) (-914.776) * (-912.831) (-910.621) [-912.553] (-910.328) -- 0:00:18 697000 -- [-914.806] (-911.801) (-913.903) (-916.326) * (-911.120) (-910.675) [-912.043] (-911.394) -- 0:00:18 697500 -- (-911.683) (-912.930) (-910.720) [-913.661] * (-913.332) [-910.238] (-910.916) (-912.175) -- 0:00:18 698000 -- [-914.224] (-918.772) (-916.312) (-914.297) * (-916.046) (-914.486) (-909.776) [-912.547] -- 0:00:18 698500 -- (-913.656) [-917.577] (-910.857) (-913.420) * (-919.889) (-911.373) [-910.004] (-914.292) -- 0:00:18 699000 -- (-912.373) [-913.062] (-911.007) (-912.001) * (-915.181) [-912.266] (-912.489) (-913.881) -- 0:00:18 699500 -- [-911.920] (-910.101) (-909.762) (-911.019) * (-916.268) [-910.386] (-912.032) (-910.491) -- 0:00:18 700000 -- (-911.068) (-911.214) (-913.678) [-911.124] * (-913.830) [-910.388] (-913.517) (-911.300) -- 0:00:18 Average standard deviation of split frequencies: 0.009419 700500 -- (-912.151) (-912.572) (-910.843) [-910.730] * (-911.032) (-909.672) (-913.842) [-909.623] -- 0:00:18 701000 -- (-911.715) (-911.312) (-909.883) [-912.994] * (-911.289) (-911.695) [-912.662] (-911.764) -- 0:00:18 701500 -- [-911.893] (-910.941) (-911.006) (-911.733) * [-910.984] (-913.093) (-910.551) (-912.095) -- 0:00:18 702000 -- (-915.068) (-914.915) (-912.844) [-910.421] * (-913.885) [-916.508] (-913.198) (-911.330) -- 0:00:18 702500 -- (-913.725) (-912.391) [-913.421] (-910.592) * (-912.821) (-916.747) (-911.731) [-910.587] -- 0:00:18 703000 -- [-910.768] (-912.358) (-912.572) (-921.077) * (-914.777) (-910.645) (-911.976) [-912.509] -- 0:00:18 703500 -- (-911.351) (-910.004) [-909.700] (-920.879) * (-914.961) (-915.424) (-911.855) [-911.313] -- 0:00:18 704000 -- (-910.811) [-910.848] (-911.646) (-910.535) * (-913.586) (-914.574) (-914.153) [-913.210] -- 0:00:18 704500 -- (-910.517) (-911.353) [-909.731] (-911.519) * [-911.177] (-912.824) (-912.557) (-914.468) -- 0:00:18 705000 -- [-910.251] (-910.103) (-917.827) (-912.158) * [-910.620] (-910.565) (-913.197) (-915.101) -- 0:00:17 Average standard deviation of split frequencies: 0.009427 705500 -- (-911.330) (-912.359) [-912.308] (-911.111) * (-910.204) (-910.515) (-910.282) [-910.938] -- 0:00:17 706000 -- (-909.693) (-911.563) [-915.392] (-912.644) * (-915.929) (-918.541) (-910.997) [-911.304] -- 0:00:17 706500 -- (-910.504) [-910.535] (-910.239) (-912.064) * (-914.059) (-914.191) [-912.113] (-910.381) -- 0:00:17 707000 -- (-910.504) (-911.663) [-909.725] (-911.589) * (-912.145) [-914.282] (-912.588) (-910.908) -- 0:00:17 707500 -- (-911.885) (-911.114) [-911.215] (-912.467) * (-911.984) (-912.488) (-910.464) [-912.376] -- 0:00:17 708000 -- [-910.607] (-915.359) (-910.315) (-918.332) * (-915.546) (-911.963) [-910.108] (-910.197) -- 0:00:17 708500 -- (-911.685) (-913.942) [-912.647] (-910.833) * (-912.968) (-909.961) (-915.917) [-910.054] -- 0:00:17 709000 -- (-912.207) (-910.227) [-911.185] (-913.152) * (-911.451) (-912.234) (-911.315) [-912.914] -- 0:00:17 709500 -- (-914.668) (-910.165) (-910.511) [-911.608] * (-910.617) (-913.347) (-916.072) [-909.826] -- 0:00:17 710000 -- (-913.830) [-910.747] (-910.535) (-913.463) * (-913.455) [-911.572] (-913.769) (-916.561) -- 0:00:17 Average standard deviation of split frequencies: 0.009560 710500 -- (-915.785) (-910.469) (-915.108) [-912.459] * (-914.293) [-914.524] (-913.100) (-918.190) -- 0:00:17 711000 -- (-913.080) (-911.564) (-916.383) [-912.123] * (-911.241) (-913.262) (-910.629) [-911.056] -- 0:00:17 711500 -- [-910.887] (-913.221) (-913.777) (-912.583) * (-910.994) (-910.772) [-910.835] (-913.103) -- 0:00:17 712000 -- (-910.865) (-912.604) (-916.214) [-913.924] * (-912.442) (-912.737) (-915.090) [-912.413] -- 0:00:17 712500 -- (-915.791) [-910.961] (-912.794) (-911.694) * [-914.384] (-911.783) (-911.352) (-912.085) -- 0:00:17 713000 -- (-911.151) (-915.952) (-911.425) [-911.862] * (-910.244) [-910.676] (-910.297) (-913.668) -- 0:00:17 713500 -- (-910.805) (-912.877) (-914.237) [-911.094] * (-910.179) [-914.069] (-913.437) (-913.441) -- 0:00:17 714000 -- (-910.072) (-912.351) (-913.907) [-910.347] * (-910.959) (-911.464) [-911.520] (-915.755) -- 0:00:17 714500 -- [-911.049] (-910.423) (-912.568) (-912.496) * [-911.380] (-911.944) (-912.606) (-915.653) -- 0:00:17 715000 -- (-910.395) (-914.235) (-910.607) [-910.909] * (-913.535) [-913.545] (-912.041) (-910.347) -- 0:00:17 Average standard deviation of split frequencies: 0.009217 715500 -- (-913.320) (-911.542) (-912.700) [-915.302] * (-913.539) [-909.998] (-911.994) (-910.497) -- 0:00:17 716000 -- (-914.027) [-911.182] (-912.940) (-910.283) * (-911.287) (-916.145) (-913.457) [-910.331] -- 0:00:17 716500 -- (-914.244) (-912.473) (-909.952) [-911.556] * (-910.901) (-918.284) [-910.476] (-910.658) -- 0:00:17 717000 -- (-912.352) (-911.452) [-913.822] (-911.116) * (-912.447) (-912.972) [-910.133] (-912.589) -- 0:00:17 717500 -- (-914.410) [-913.330] (-912.537) (-911.527) * [-913.031] (-911.193) (-909.836) (-916.064) -- 0:00:17 718000 -- (-911.501) [-912.125] (-912.468) (-913.217) * (-913.571) [-911.391] (-912.105) (-915.796) -- 0:00:17 718500 -- [-912.182] (-910.999) (-911.520) (-911.418) * (-914.488) (-912.080) [-915.375] (-911.148) -- 0:00:17 719000 -- (-913.125) [-911.981] (-911.309) (-916.652) * (-913.247) (-910.347) (-915.022) [-911.142] -- 0:00:17 719500 -- (-912.344) [-911.599] (-914.419) (-913.910) * (-910.943) (-910.220) [-912.518] (-913.623) -- 0:00:17 720000 -- (-912.068) (-911.721) [-914.604] (-912.414) * (-912.204) (-913.074) [-913.160] (-911.415) -- 0:00:17 Average standard deviation of split frequencies: 0.009696 720500 -- (-913.767) [-912.690] (-914.865) (-916.584) * (-912.265) (-912.427) (-916.774) [-910.502] -- 0:00:17 721000 -- [-912.500] (-916.326) (-919.117) (-916.532) * [-914.266] (-914.808) (-913.120) (-914.958) -- 0:00:17 721500 -- (-913.558) [-910.565] (-910.339) (-911.007) * (-916.423) (-913.709) [-913.671] (-912.555) -- 0:00:16 722000 -- [-911.201] (-910.333) (-912.589) (-910.842) * (-917.370) (-909.761) (-917.417) [-915.283] -- 0:00:16 722500 -- (-909.709) (-911.323) [-911.393] (-910.011) * (-913.123) (-912.665) [-913.673] (-913.840) -- 0:00:16 723000 -- (-913.047) (-911.871) (-913.112) [-910.035] * [-911.055] (-912.945) (-912.345) (-912.856) -- 0:00:16 723500 -- [-912.439] (-911.199) (-913.592) (-913.481) * [-910.621] (-916.359) (-910.671) (-910.457) -- 0:00:16 724000 -- (-916.691) (-911.778) (-911.033) [-910.394] * (-912.450) [-910.770] (-910.356) (-911.115) -- 0:00:16 724500 -- [-909.786] (-910.575) (-913.375) (-912.576) * (-912.580) (-909.948) (-916.127) [-910.423] -- 0:00:16 725000 -- (-912.095) (-910.262) [-914.217] (-909.890) * (-912.893) (-913.224) (-916.576) [-913.786] -- 0:00:16 Average standard deviation of split frequencies: 0.009663 725500 -- (-916.578) (-910.545) (-912.709) [-910.350] * [-912.862] (-912.948) (-916.594) (-912.731) -- 0:00:16 726000 -- [-911.164] (-911.139) (-911.633) (-910.734) * (-910.894) (-916.065) (-915.873) [-910.688] -- 0:00:16 726500 -- [-912.447] (-913.093) (-912.267) (-913.366) * [-910.739] (-912.558) (-914.940) (-910.604) -- 0:00:16 727000 -- (-917.393) [-911.149] (-913.144) (-910.954) * (-911.434) [-910.584] (-910.194) (-911.518) -- 0:00:16 727500 -- (-914.112) (-912.469) (-910.460) [-911.358] * (-911.840) [-909.890] (-911.465) (-913.494) -- 0:00:16 728000 -- (-916.028) [-911.308] (-910.589) (-917.349) * (-913.132) (-911.635) (-910.730) [-913.838] -- 0:00:16 728500 -- (-910.285) (-915.192) (-910.696) [-912.374] * (-911.068) (-912.774) [-911.402] (-912.791) -- 0:00:16 729000 -- (-913.891) (-911.589) (-914.671) [-910.828] * [-911.788] (-911.983) (-912.470) (-909.856) -- 0:00:16 729500 -- (-918.454) (-911.537) (-909.910) [-910.563] * (-915.411) [-912.471] (-913.104) (-911.365) -- 0:00:16 730000 -- (-914.016) (-913.908) (-912.266) [-911.718] * [-911.546] (-911.023) (-911.580) (-911.185) -- 0:00:16 Average standard deviation of split frequencies: 0.009412 730500 -- [-910.384] (-914.406) (-913.343) (-912.149) * (-913.982) [-911.442] (-914.942) (-915.452) -- 0:00:16 731000 -- [-912.167] (-912.080) (-912.380) (-913.071) * (-911.513) (-910.420) (-912.990) [-911.336] -- 0:00:16 731500 -- (-912.327) (-913.638) (-915.698) [-914.528] * (-913.265) (-915.593) [-913.889] (-915.850) -- 0:00:16 732000 -- (-912.440) [-910.235] (-911.533) (-912.241) * (-912.722) (-915.589) (-914.869) [-914.468] -- 0:00:16 732500 -- (-911.993) [-912.393] (-911.835) (-910.194) * (-912.187) (-916.053) [-913.487] (-911.242) -- 0:00:16 733000 -- (-910.766) (-912.745) (-913.979) [-910.871] * (-912.008) (-915.100) [-910.802] (-911.451) -- 0:00:16 733500 -- (-911.551) [-909.953] (-918.331) (-911.993) * (-911.987) (-916.019) (-910.778) [-913.017] -- 0:00:16 734000 -- [-912.311] (-912.427) (-915.177) (-910.904) * (-910.114) [-913.035] (-910.704) (-913.459) -- 0:00:16 734500 -- (-910.509) [-913.763] (-913.389) (-911.510) * (-914.358) [-914.369] (-914.807) (-910.602) -- 0:00:16 735000 -- (-911.377) (-911.543) (-917.022) [-910.548] * [-911.824] (-919.316) (-920.485) (-912.707) -- 0:00:16 Average standard deviation of split frequencies: 0.009494 735500 -- [-914.365] (-910.836) (-910.160) (-913.222) * (-910.534) (-912.235) [-912.011] (-912.791) -- 0:00:16 736000 -- (-912.964) (-913.344) (-911.807) [-913.550] * (-914.030) [-910.439] (-911.753) (-915.935) -- 0:00:16 736500 -- (-915.324) (-913.938) [-910.444] (-911.712) * [-911.418] (-915.135) (-911.449) (-912.081) -- 0:00:16 737000 -- (-913.491) (-912.142) (-911.813) [-912.326] * (-914.159) (-911.761) (-910.750) [-911.400] -- 0:00:16 737500 -- (-913.726) (-911.494) (-913.978) [-911.968] * [-910.351] (-912.987) (-910.849) (-912.491) -- 0:00:16 738000 -- (-912.549) [-911.785] (-913.235) (-916.574) * [-910.476] (-909.989) (-911.741) (-910.979) -- 0:00:15 738500 -- (-913.612) [-913.929] (-910.719) (-912.948) * (-911.689) (-909.576) (-911.281) [-911.851] -- 0:00:15 739000 -- [-913.749] (-912.479) (-912.747) (-913.100) * (-910.763) [-912.362] (-913.937) (-911.643) -- 0:00:15 739500 -- (-913.293) (-910.931) (-911.920) [-914.690] * (-916.782) [-910.331] (-910.060) (-910.280) -- 0:00:15 740000 -- (-915.373) (-914.775) [-912.457] (-911.089) * (-916.977) [-911.436] (-913.964) (-912.483) -- 0:00:15 Average standard deviation of split frequencies: 0.009322 740500 -- (-910.118) [-913.750] (-911.091) (-914.220) * (-911.369) (-912.469) [-910.439] (-911.186) -- 0:00:15 741000 -- (-912.726) [-913.213] (-911.539) (-915.658) * (-913.825) (-911.665) [-911.058] (-912.018) -- 0:00:15 741500 -- (-914.866) [-917.119] (-911.484) (-914.488) * [-911.687] (-911.006) (-912.303) (-912.055) -- 0:00:15 742000 -- (-914.076) [-911.222] (-911.425) (-912.674) * (-910.829) (-910.572) [-912.349] (-911.504) -- 0:00:15 742500 -- (-911.294) [-910.984] (-910.761) (-911.359) * (-910.228) (-912.440) (-915.559) [-912.099] -- 0:00:15 743000 -- (-913.161) (-912.337) (-910.535) [-910.165] * [-913.828] (-912.362) (-913.598) (-911.732) -- 0:00:15 743500 -- (-911.854) (-913.652) [-913.375] (-918.404) * [-911.682] (-911.306) (-910.856) (-912.000) -- 0:00:15 744000 -- (-912.402) [-910.796] (-911.126) (-918.213) * (-910.572) (-916.514) (-913.672) [-910.779] -- 0:00:15 744500 -- (-910.657) (-915.540) [-912.471] (-911.611) * (-912.434) (-911.692) [-911.018] (-910.978) -- 0:00:15 745000 -- [-911.817] (-915.419) (-910.910) (-913.013) * (-910.882) [-910.101] (-914.868) (-912.019) -- 0:00:15 Average standard deviation of split frequencies: 0.009256 745500 -- (-913.599) (-914.547) (-910.592) [-914.226] * (-911.238) (-911.578) (-911.831) [-911.498] -- 0:00:15 746000 -- (-914.654) (-914.794) [-910.975] (-912.536) * (-911.103) (-911.408) (-910.733) [-913.611] -- 0:00:15 746500 -- (-914.943) (-912.322) (-912.498) [-911.026] * (-910.071) (-913.291) (-915.270) [-913.982] -- 0:00:15 747000 -- (-915.457) [-912.249] (-913.306) (-910.745) * (-909.854) [-913.724] (-914.553) (-915.742) -- 0:00:15 747500 -- (-912.091) [-912.849] (-911.412) (-910.814) * [-911.725] (-912.135) (-912.153) (-917.382) -- 0:00:15 748000 -- [-909.961] (-910.909) (-914.963) (-912.087) * [-909.537] (-911.797) (-910.840) (-913.969) -- 0:00:15 748500 -- (-911.022) (-912.069) [-910.226] (-911.518) * (-913.301) (-916.639) (-911.569) [-912.066] -- 0:00:15 749000 -- (-911.014) [-911.918] (-913.002) (-911.441) * (-910.639) (-913.621) (-910.813) [-912.674] -- 0:00:15 749500 -- (-912.483) (-915.551) (-911.147) [-916.058] * (-913.363) [-911.018] (-912.618) (-912.929) -- 0:00:15 750000 -- (-911.739) [-914.154] (-910.049) (-910.730) * (-916.419) (-915.580) (-912.659) [-910.315] -- 0:00:15 Average standard deviation of split frequencies: 0.009531 750500 -- (-912.125) (-912.743) [-910.731] (-911.460) * [-911.010] (-913.975) (-912.036) (-910.311) -- 0:00:15 751000 -- (-912.071) (-913.407) (-912.557) [-912.037] * (-911.140) [-911.519] (-910.177) (-912.330) -- 0:00:15 751500 -- (-911.055) [-914.384] (-912.107) (-914.144) * (-912.860) (-911.540) (-913.407) [-914.936] -- 0:00:15 752000 -- (-914.064) [-914.105] (-911.266) (-915.755) * (-910.578) (-911.591) [-912.778] (-916.015) -- 0:00:15 752500 -- (-915.674) (-914.824) [-910.572] (-913.396) * (-913.180) [-912.954] (-911.641) (-915.831) -- 0:00:15 753000 -- [-914.855] (-911.388) (-913.189) (-917.856) * [-912.878] (-913.158) (-911.469) (-917.822) -- 0:00:15 753500 -- (-915.557) (-911.927) [-910.993] (-917.199) * (-912.795) [-910.046] (-912.341) (-914.280) -- 0:00:15 754000 -- (-917.065) [-910.625] (-912.875) (-914.354) * (-912.668) (-912.886) (-912.886) [-913.526] -- 0:00:15 754500 -- (-918.211) (-910.670) [-912.980] (-913.587) * (-912.838) [-911.799] (-909.901) (-913.715) -- 0:00:14 755000 -- (-914.869) (-912.380) [-911.911] (-913.038) * [-912.707] (-912.016) (-913.842) (-915.238) -- 0:00:14 Average standard deviation of split frequencies: 0.009427 755500 -- [-910.797] (-913.168) (-912.823) (-911.837) * (-910.290) (-910.323) (-915.461) [-915.186] -- 0:00:14 756000 -- (-911.634) (-912.902) (-910.989) [-910.842] * (-911.820) (-913.653) (-911.523) [-911.109] -- 0:00:14 756500 -- (-911.904) (-913.571) [-910.671] (-912.252) * (-913.631) (-914.984) (-909.507) [-910.072] -- 0:00:14 757000 -- [-911.190] (-910.459) (-912.464) (-912.698) * (-913.493) (-912.350) [-911.130] (-909.899) -- 0:00:14 757500 -- (-913.417) (-916.989) [-914.098] (-911.029) * (-913.467) (-913.894) [-912.134] (-914.012) -- 0:00:14 758000 -- (-910.742) (-911.991) (-910.791) [-911.444] * (-912.388) (-912.356) [-915.498] (-917.670) -- 0:00:14 758500 -- [-911.078] (-911.824) (-911.817) (-912.827) * (-913.276) (-912.474) (-915.034) [-918.732] -- 0:00:14 759000 -- (-915.118) (-912.037) (-912.497) [-910.302] * [-911.279] (-916.353) (-912.987) (-911.701) -- 0:00:14 759500 -- (-918.529) (-910.072) (-911.002) [-910.270] * (-914.153) [-911.226] (-912.487) (-911.326) -- 0:00:14 760000 -- (-914.936) (-909.978) [-911.038] (-911.584) * (-911.379) (-910.307) (-910.844) [-910.219] -- 0:00:14 Average standard deviation of split frequencies: 0.009041 760500 -- (-911.089) (-913.818) [-911.105] (-912.884) * [-911.622] (-910.338) (-912.768) (-911.439) -- 0:00:14 761000 -- (-912.392) [-910.331] (-913.973) (-911.039) * (-911.769) [-909.772] (-910.338) (-910.314) -- 0:00:14 761500 -- (-910.319) (-913.332) [-916.619] (-911.754) * (-913.112) (-911.715) [-914.228] (-911.141) -- 0:00:14 762000 -- (-910.907) [-911.068] (-910.530) (-914.658) * [-913.015] (-913.883) (-910.711) (-912.502) -- 0:00:14 762500 -- (-912.142) (-914.478) [-912.874] (-910.601) * (-912.998) [-913.239] (-910.741) (-909.618) -- 0:00:14 763000 -- (-912.749) (-912.580) (-914.929) [-910.608] * (-913.921) (-920.064) (-912.832) [-909.736] -- 0:00:14 763500 -- (-911.936) [-911.247] (-912.521) (-910.868) * (-912.474) (-913.401) [-911.198] (-910.215) -- 0:00:14 764000 -- (-910.437) (-911.119) [-910.565] (-910.105) * (-913.091) (-913.256) (-911.684) [-912.308] -- 0:00:14 764500 -- [-911.000] (-911.469) (-911.772) (-911.198) * [-912.397] (-910.548) (-912.780) (-912.693) -- 0:00:14 765000 -- (-910.646) [-912.396] (-911.588) (-913.630) * [-910.310] (-910.723) (-912.901) (-914.104) -- 0:00:14 Average standard deviation of split frequencies: 0.009955 765500 -- [-911.702] (-911.227) (-910.518) (-910.176) * (-911.127) (-913.505) (-910.373) [-910.958] -- 0:00:14 766000 -- (-913.519) (-912.496) (-913.391) [-910.952] * [-911.699] (-913.852) (-914.981) (-912.234) -- 0:00:14 766500 -- (-913.967) (-911.010) (-911.917) [-911.358] * (-910.330) (-913.986) [-911.840] (-911.906) -- 0:00:14 767000 -- (-911.859) (-912.796) [-913.109] (-915.405) * (-911.688) (-913.389) [-919.048] (-912.346) -- 0:00:14 767500 -- [-911.991] (-910.645) (-912.339) (-911.496) * [-911.283] (-912.385) (-911.291) (-912.813) -- 0:00:14 768000 -- (-911.526) [-911.067] (-913.720) (-914.285) * (-912.085) (-913.636) [-912.717] (-911.487) -- 0:00:14 768500 -- (-911.933) (-911.473) [-910.759] (-911.076) * (-912.706) [-911.440] (-913.621) (-910.861) -- 0:00:14 769000 -- (-911.368) (-912.645) (-912.665) [-912.468] * (-913.823) [-911.402] (-912.917) (-911.945) -- 0:00:14 769500 -- (-911.649) (-913.480) [-911.636] (-910.263) * (-913.203) (-910.806) (-911.481) [-911.475] -- 0:00:14 770000 -- [-911.771] (-920.314) (-917.689) (-910.505) * (-911.691) (-913.945) [-910.789] (-911.855) -- 0:00:14 Average standard deviation of split frequencies: 0.010003 770500 -- (-911.464) [-914.292] (-912.830) (-910.670) * [-911.180] (-913.501) (-913.924) (-912.985) -- 0:00:13 771000 -- (-912.032) (-911.304) (-912.414) [-910.968] * (-910.401) (-912.268) (-912.507) [-911.751] -- 0:00:13 771500 -- (-915.137) (-911.834) (-912.698) [-912.379] * [-910.857] (-912.094) (-915.556) (-911.988) -- 0:00:13 772000 -- (-916.421) [-912.295] (-915.178) (-913.402) * (-911.820) [-914.633] (-913.020) (-914.173) -- 0:00:13 772500 -- (-912.194) [-915.391] (-914.296) (-916.650) * (-912.890) (-912.941) [-912.387] (-910.907) -- 0:00:13 773000 -- (-912.347) [-915.956] (-911.832) (-914.179) * (-911.133) (-910.728) (-912.104) [-912.625] -- 0:00:13 773500 -- (-911.548) (-914.245) (-911.571) [-911.119] * (-910.360) (-912.380) (-911.063) [-910.037] -- 0:00:13 774000 -- (-914.317) [-915.229] (-911.849) (-911.587) * (-911.971) [-911.229] (-912.208) (-911.816) -- 0:00:13 774500 -- (-911.186) (-910.672) [-911.497] (-911.404) * (-912.476) (-909.821) (-912.475) [-910.783] -- 0:00:13 775000 -- (-911.964) (-911.402) (-910.097) [-912.651] * (-911.889) [-915.190] (-915.171) (-912.558) -- 0:00:13 Average standard deviation of split frequencies: 0.009684 775500 -- (-912.659) (-911.089) [-910.278] (-911.269) * (-912.965) (-918.679) [-911.125] (-911.567) -- 0:00:13 776000 -- (-912.713) (-911.288) (-915.632) [-912.527] * (-911.364) (-917.211) [-912.193] (-913.311) -- 0:00:13 776500 -- (-912.235) (-914.128) (-911.085) [-912.087] * (-911.870) [-912.769] (-912.826) (-916.712) -- 0:00:13 777000 -- [-914.164] (-911.861) (-911.651) (-913.153) * (-914.480) (-911.526) (-911.732) [-910.482] -- 0:00:13 777500 -- (-913.813) (-909.924) [-911.836] (-910.552) * (-911.422) [-911.586] (-911.544) (-911.060) -- 0:00:13 778000 -- [-910.001] (-909.988) (-910.614) (-909.927) * (-912.076) [-911.701] (-911.975) (-909.746) -- 0:00:13 778500 -- [-910.541] (-910.048) (-914.028) (-912.172) * (-911.275) [-911.531] (-912.567) (-910.902) -- 0:00:13 779000 -- (-912.536) [-914.320] (-913.294) (-910.510) * (-911.714) (-912.580) [-912.549] (-910.652) -- 0:00:13 779500 -- (-910.911) (-911.610) [-912.310] (-910.310) * (-912.117) (-910.773) [-909.827] (-910.859) -- 0:00:13 780000 -- (-912.201) (-911.871) [-911.816] (-913.218) * (-912.931) [-911.722] (-917.127) (-915.968) -- 0:00:13 Average standard deviation of split frequencies: 0.009839 780500 -- (-913.530) (-911.999) [-912.924] (-913.358) * (-912.225) (-914.082) [-911.468] (-910.264) -- 0:00:13 781000 -- (-913.788) (-911.958) [-912.914] (-910.785) * (-910.266) (-912.614) [-912.183] (-912.040) -- 0:00:13 781500 -- (-911.949) (-914.674) (-911.692) [-912.053] * (-911.308) [-912.304] (-913.213) (-914.608) -- 0:00:13 782000 -- (-912.716) [-912.693] (-910.802) (-912.044) * [-912.019] (-912.752) (-911.308) (-915.347) -- 0:00:13 782500 -- (-912.647) [-912.228] (-911.158) (-911.544) * (-911.575) [-920.101] (-913.987) (-913.710) -- 0:00:13 783000 -- (-911.686) (-911.078) [-912.203] (-914.873) * (-910.950) (-916.515) (-915.573) [-912.545] -- 0:00:13 783500 -- (-911.387) (-910.412) [-911.276] (-914.215) * (-910.728) (-912.656) (-912.829) [-913.766] -- 0:00:13 784000 -- [-909.800] (-915.266) (-918.259) (-912.245) * [-913.175] (-910.807) (-911.748) (-912.119) -- 0:00:13 784500 -- (-911.021) (-916.722) [-911.455] (-914.642) * (-913.427) (-911.847) [-911.337] (-910.936) -- 0:00:13 785000 -- (-913.232) (-911.713) [-912.146] (-913.205) * (-910.544) (-911.616) [-911.124] (-911.812) -- 0:00:13 Average standard deviation of split frequencies: 0.010055 785500 -- [-912.186] (-914.858) (-912.949) (-914.396) * (-911.657) [-914.875] (-912.548) (-911.655) -- 0:00:13 786000 -- (-911.416) [-914.391] (-910.129) (-912.228) * (-913.799) [-911.446] (-911.502) (-913.713) -- 0:00:13 786500 -- (-914.533) (-910.545) (-917.401) [-910.542] * (-911.702) (-919.464) [-911.000] (-911.436) -- 0:00:13 787000 -- (-912.633) (-913.553) [-912.811] (-912.240) * (-911.791) (-914.120) (-911.061) [-914.105] -- 0:00:12 787500 -- (-916.282) (-912.226) [-910.488] (-911.107) * (-911.236) (-912.818) [-910.423] (-910.755) -- 0:00:12 788000 -- (-910.071) (-912.445) (-910.131) [-911.055] * (-911.478) (-917.129) [-913.833] (-913.575) -- 0:00:12 788500 -- (-913.755) (-912.272) (-910.093) [-913.222] * (-912.196) (-914.270) [-910.991] (-911.668) -- 0:00:12 789000 -- (-912.601) (-912.167) (-912.430) [-911.611] * (-913.448) (-913.222) (-911.784) [-911.934] -- 0:00:12 789500 -- (-911.817) [-913.159] (-914.358) (-911.678) * [-912.887] (-913.070) (-911.968) (-912.216) -- 0:00:12 790000 -- (-912.732) [-912.310] (-911.527) (-912.825) * (-913.362) (-910.942) (-910.662) [-912.226] -- 0:00:12 Average standard deviation of split frequencies: 0.009820 790500 -- (-915.555) [-911.561] (-911.584) (-910.609) * [-913.321] (-910.265) (-913.120) (-912.948) -- 0:00:12 791000 -- (-912.113) [-916.326] (-913.088) (-911.023) * (-911.896) [-913.912] (-914.299) (-915.437) -- 0:00:12 791500 -- (-911.584) [-910.451] (-913.196) (-912.972) * (-911.480) (-912.043) [-916.915] (-913.973) -- 0:00:12 792000 -- (-914.857) [-911.883] (-914.863) (-913.464) * (-910.894) (-910.699) [-911.182] (-910.919) -- 0:00:12 792500 -- (-928.849) (-914.263) (-910.604) [-909.810] * (-912.194) (-913.854) (-910.762) [-911.585] -- 0:00:12 793000 -- (-915.232) (-916.922) [-911.494] (-911.190) * [-912.083] (-912.617) (-911.035) (-910.523) -- 0:00:12 793500 -- [-911.673] (-911.475) (-910.933) (-910.512) * (-912.505) (-913.364) (-912.721) [-912.087] -- 0:00:12 794000 -- (-912.523) (-911.886) (-909.585) [-909.695] * [-910.001] (-911.767) (-912.368) (-911.823) -- 0:00:12 794500 -- (-912.120) [-911.229] (-911.454) (-916.078) * (-910.553) (-910.590) [-910.227] (-914.058) -- 0:00:12 795000 -- [-911.611] (-911.321) (-913.095) (-912.080) * (-911.214) (-910.589) (-910.278) [-916.251] -- 0:00:12 Average standard deviation of split frequencies: 0.009789 795500 -- [-912.289] (-912.124) (-912.375) (-911.954) * (-911.672) (-912.582) [-913.623] (-912.007) -- 0:00:12 796000 -- (-915.187) (-914.205) (-913.610) [-912.534] * (-911.866) (-912.933) (-910.696) [-911.904] -- 0:00:12 796500 -- (-910.773) (-911.957) (-910.790) [-914.565] * (-914.274) (-913.013) [-910.477] (-912.792) -- 0:00:12 797000 -- (-913.832) (-911.790) (-916.817) [-910.862] * (-914.659) (-910.733) (-912.243) [-911.675] -- 0:00:12 797500 -- (-913.604) (-912.644) [-910.209] (-910.276) * (-914.310) [-911.085] (-911.005) (-911.608) -- 0:00:12 798000 -- (-912.695) (-911.108) [-914.757] (-910.277) * (-912.279) [-913.661] (-910.119) (-910.470) -- 0:00:12 798500 -- [-914.863] (-912.357) (-914.028) (-910.667) * (-912.071) (-913.102) [-910.767] (-914.208) -- 0:00:12 799000 -- (-916.498) (-911.390) [-915.317] (-910.547) * [-911.016] (-917.558) (-912.309) (-912.200) -- 0:00:12 799500 -- [-911.053] (-911.176) (-913.167) (-912.024) * (-912.385) (-912.213) [-913.503] (-914.674) -- 0:00:12 800000 -- (-910.978) (-911.846) [-911.580] (-914.368) * (-911.347) (-911.120) [-914.123] (-914.043) -- 0:00:12 Average standard deviation of split frequencies: 0.009697 800500 -- [-910.705] (-913.226) (-911.828) (-912.032) * (-911.175) (-911.921) (-911.398) [-909.926] -- 0:00:12 801000 -- (-910.679) (-913.031) [-912.506] (-912.445) * (-910.432) [-910.803] (-915.613) (-912.704) -- 0:00:12 801500 -- (-910.210) (-910.706) (-916.354) [-910.590] * (-910.334) (-911.016) [-910.662] (-911.374) -- 0:00:12 802000 -- (-913.223) [-911.319] (-910.098) (-910.915) * (-910.787) [-912.087] (-914.730) (-916.985) -- 0:00:12 802500 -- [-911.786] (-913.584) (-910.461) (-912.245) * (-912.073) (-914.539) [-910.945] (-912.441) -- 0:00:12 803000 -- [-910.898] (-914.227) (-912.189) (-912.190) * (-913.669) (-911.811) (-909.981) [-913.684] -- 0:00:12 803500 -- (-913.239) (-910.382) [-910.567] (-910.743) * (-913.359) (-911.819) [-911.169] (-911.569) -- 0:00:11 804000 -- (-919.211) (-911.650) [-913.436] (-914.478) * (-914.751) (-912.438) [-912.299] (-911.196) -- 0:00:11 804500 -- (-915.643) (-911.702) (-912.377) [-913.435] * (-912.898) (-911.983) [-912.097] (-913.404) -- 0:00:11 805000 -- [-914.258] (-915.329) (-910.347) (-912.785) * (-912.627) (-910.234) [-910.304] (-910.573) -- 0:00:11 Average standard deviation of split frequencies: 0.009530 805500 -- (-911.292) [-911.639] (-914.941) (-911.997) * [-911.428] (-912.846) (-918.027) (-915.315) -- 0:00:11 806000 -- [-909.882] (-913.204) (-914.457) (-915.625) * [-911.657] (-916.093) (-911.593) (-915.546) -- 0:00:11 806500 -- (-910.811) [-914.598] (-914.111) (-910.858) * [-911.046] (-910.456) (-912.422) (-912.393) -- 0:00:11 807000 -- (-910.833) [-912.725] (-915.999) (-910.284) * [-911.117] (-911.786) (-910.769) (-912.144) -- 0:00:11 807500 -- (-911.523) (-911.601) (-912.916) [-910.681] * [-914.326] (-911.885) (-912.449) (-909.870) -- 0:00:11 808000 -- (-913.874) (-912.459) [-914.880] (-911.400) * (-912.528) [-913.763] (-912.223) (-910.917) -- 0:00:11 808500 -- (-910.542) [-914.062] (-913.469) (-911.864) * [-913.273] (-910.487) (-912.499) (-914.861) -- 0:00:11 809000 -- [-911.082] (-913.211) (-912.392) (-912.117) * (-912.138) [-912.001] (-915.356) (-910.557) -- 0:00:11 809500 -- (-911.218) (-912.716) [-911.477] (-911.827) * (-912.382) (-910.048) [-914.003] (-912.886) -- 0:00:11 810000 -- (-911.759) (-911.047) [-910.187] (-913.857) * (-913.249) (-911.679) (-914.696) [-910.392] -- 0:00:11 Average standard deviation of split frequencies: 0.009749 810500 -- (-912.658) (-911.116) [-912.821] (-910.770) * (-910.096) (-909.879) (-913.456) [-912.632] -- 0:00:11 811000 -- (-913.939) (-913.734) (-911.709) [-912.570] * (-914.242) [-911.288] (-917.006) (-910.815) -- 0:00:11 811500 -- (-914.813) (-912.902) [-910.259] (-915.216) * [-912.935] (-910.949) (-912.253) (-924.072) -- 0:00:11 812000 -- [-917.458] (-911.993) (-917.059) (-912.289) * [-910.424] (-912.926) (-912.126) (-913.715) -- 0:00:11 812500 -- (-921.551) (-910.716) (-912.329) [-912.245] * (-910.597) (-913.926) [-910.593] (-915.502) -- 0:00:11 813000 -- (-916.073) [-910.546] (-911.526) (-914.658) * [-910.300] (-912.409) (-910.594) (-910.066) -- 0:00:11 813500 -- (-911.336) (-910.591) [-912.734] (-914.605) * [-910.043] (-911.696) (-911.814) (-911.266) -- 0:00:11 814000 -- (-914.059) (-911.311) [-915.848] (-911.792) * [-910.790] (-911.319) (-911.659) (-910.884) -- 0:00:11 814500 -- (-916.435) (-909.746) [-914.500] (-910.645) * (-914.185) [-910.754] (-911.487) (-912.234) -- 0:00:11 815000 -- (-917.304) (-913.624) [-911.414] (-912.211) * (-914.497) (-911.751) [-911.920] (-917.183) -- 0:00:11 Average standard deviation of split frequencies: 0.009923 815500 -- (-915.256) [-911.582] (-911.132) (-915.914) * (-911.254) (-912.347) [-914.222] (-915.569) -- 0:00:11 816000 -- [-910.941] (-910.943) (-916.601) (-912.917) * (-911.343) [-910.629] (-911.023) (-910.540) -- 0:00:11 816500 -- (-910.541) (-910.587) [-910.874] (-914.912) * (-911.324) (-910.831) (-913.161) [-911.093] -- 0:00:11 817000 -- [-911.256] (-914.329) (-910.440) (-910.440) * [-911.701] (-911.772) (-912.557) (-913.236) -- 0:00:11 817500 -- (-912.702) (-915.957) [-911.564] (-911.066) * (-912.833) [-911.950] (-913.338) (-916.383) -- 0:00:11 818000 -- (-915.388) [-912.241] (-911.744) (-912.571) * (-913.279) [-911.875] (-914.650) (-911.953) -- 0:00:11 818500 -- (-922.984) (-911.919) [-912.094] (-913.268) * [-911.805] (-914.608) (-912.561) (-912.978) -- 0:00:11 819000 -- (-920.549) (-912.690) [-913.095] (-913.110) * (-914.326) (-910.873) (-915.618) [-914.221] -- 0:00:11 819500 -- (-914.468) (-909.910) (-913.467) [-915.669] * [-914.334] (-913.030) (-911.344) (-912.306) -- 0:00:11 820000 -- [-911.363] (-910.244) (-916.453) (-911.868) * (-917.112) [-911.764] (-913.820) (-911.175) -- 0:00:10 Average standard deviation of split frequencies: 0.009866 820500 -- (-913.420) (-913.022) (-910.585) [-913.517] * (-912.775) (-914.328) (-917.595) [-909.630] -- 0:00:10 821000 -- (-913.927) (-911.355) (-910.661) [-910.796] * (-910.621) [-912.533] (-916.854) (-914.004) -- 0:00:10 821500 -- (-913.026) [-911.664] (-912.424) (-910.515) * (-911.444) [-910.787] (-912.827) (-910.744) -- 0:00:10 822000 -- [-912.337] (-910.929) (-911.303) (-909.906) * (-911.546) (-910.629) [-911.628] (-910.631) -- 0:00:10 822500 -- [-909.968] (-913.469) (-913.875) (-912.263) * (-913.132) (-912.819) (-911.502) [-910.596] -- 0:00:10 823000 -- [-911.992] (-914.939) (-912.099) (-914.459) * (-911.224) (-913.001) [-910.138] (-914.803) -- 0:00:10 823500 -- (-919.041) [-912.017] (-911.519) (-912.007) * (-910.665) (-913.833) (-913.144) [-912.234] -- 0:00:10 824000 -- (-917.524) [-910.886] (-913.565) (-912.998) * (-912.811) (-916.106) [-910.615] (-915.340) -- 0:00:10 824500 -- [-910.138] (-910.636) (-911.739) (-911.627) * (-911.743) (-912.437) [-911.165] (-914.300) -- 0:00:10 825000 -- (-911.378) [-911.567] (-910.912) (-910.662) * (-913.017) [-910.307] (-915.701) (-912.095) -- 0:00:10 Average standard deviation of split frequencies: 0.009736 825500 -- (-910.586) (-911.166) (-914.958) [-912.137] * [-914.006] (-909.565) (-912.544) (-911.442) -- 0:00:10 826000 -- (-911.504) (-918.750) (-914.377) [-910.987] * (-911.724) (-910.316) [-914.304] (-910.211) -- 0:00:10 826500 -- [-911.782] (-911.548) (-914.891) (-911.004) * [-911.675] (-911.524) (-913.343) (-914.086) -- 0:00:10 827000 -- (-911.264) [-912.606] (-911.085) (-914.413) * (-912.518) [-912.039] (-912.242) (-914.113) -- 0:00:10 827500 -- [-914.787] (-912.540) (-911.304) (-911.304) * (-912.497) [-912.445] (-910.990) (-911.956) -- 0:00:10 828000 -- [-910.537] (-912.087) (-911.886) (-910.631) * (-912.512) (-911.259) [-910.688] (-914.446) -- 0:00:10 828500 -- (-911.350) [-911.004] (-909.777) (-910.655) * (-911.393) (-910.839) [-910.150] (-915.280) -- 0:00:10 829000 -- (-911.313) (-912.200) [-910.754] (-910.614) * (-914.404) (-911.916) (-911.098) [-914.961] -- 0:00:10 829500 -- (-913.761) (-910.163) (-911.482) [-913.661] * (-913.739) [-911.107] (-913.428) (-913.491) -- 0:00:10 830000 -- (-912.118) (-910.600) [-912.595] (-914.316) * (-911.383) [-910.479] (-911.812) (-913.553) -- 0:00:10 Average standard deviation of split frequencies: 0.009714 830500 -- (-915.020) [-909.808] (-913.068) (-911.906) * [-912.517] (-910.407) (-915.325) (-913.683) -- 0:00:10 831000 -- [-913.710] (-912.211) (-915.143) (-913.074) * [-910.539] (-909.673) (-912.124) (-913.921) -- 0:00:10 831500 -- (-911.425) (-914.167) [-912.190] (-912.518) * (-912.095) [-911.414] (-911.596) (-910.513) -- 0:00:10 832000 -- (-913.239) (-911.797) [-910.889] (-915.277) * (-911.412) (-912.541) (-912.455) [-914.248] -- 0:00:10 832500 -- (-911.811) (-915.791) [-910.515] (-912.782) * (-911.396) (-913.000) (-912.060) [-917.270] -- 0:00:10 833000 -- [-911.811] (-911.819) (-910.796) (-914.186) * [-910.713] (-912.744) (-914.853) (-913.961) -- 0:00:10 833500 -- (-912.144) [-910.562] (-913.983) (-913.157) * (-911.129) [-915.433] (-911.256) (-911.772) -- 0:00:10 834000 -- (-909.843) (-912.979) (-911.412) [-911.702] * (-912.453) (-911.928) [-910.471] (-912.764) -- 0:00:10 834500 -- (-910.762) (-911.735) [-912.857] (-911.415) * (-910.366) [-915.418] (-911.328) (-912.945) -- 0:00:10 835000 -- (-911.011) [-912.404] (-913.380) (-915.770) * (-915.464) (-914.166) (-916.354) [-910.573] -- 0:00:10 Average standard deviation of split frequencies: 0.009685 835500 -- (-911.919) (-910.189) (-915.740) [-910.092] * (-910.193) (-913.498) (-915.101) [-911.336] -- 0:00:10 836000 -- [-916.674] (-911.312) (-915.005) (-910.111) * (-911.751) [-913.658] (-911.605) (-916.165) -- 0:00:10 836500 -- (-913.839) (-910.541) (-912.569) [-909.849] * (-911.226) (-918.568) [-913.871] (-912.909) -- 0:00:09 837000 -- (-915.585) (-913.997) (-912.150) [-911.123] * (-910.673) (-911.923) (-914.473) [-915.771] -- 0:00:09 837500 -- (-915.684) (-913.036) (-913.637) [-910.439] * (-910.914) [-910.873] (-912.951) (-912.884) -- 0:00:09 838000 -- [-913.242] (-916.652) (-912.858) (-911.027) * (-912.741) [-912.931] (-911.185) (-914.489) -- 0:00:09 838500 -- (-912.536) [-910.971] (-910.824) (-911.036) * (-911.513) (-910.523) [-911.217] (-912.453) -- 0:00:09 839000 -- (-912.854) (-910.041) [-910.466] (-912.174) * [-909.980] (-912.023) (-911.793) (-914.990) -- 0:00:09 839500 -- (-914.831) (-914.400) [-910.359] (-913.335) * [-912.589] (-910.124) (-910.340) (-912.241) -- 0:00:09 840000 -- (-912.418) (-913.272) [-910.261] (-912.271) * (-915.016) (-909.796) [-910.562] (-911.267) -- 0:00:09 Average standard deviation of split frequencies: 0.009863 840500 -- (-911.574) (-916.975) (-913.186) [-909.852] * [-915.191] (-909.607) (-911.213) (-913.197) -- 0:00:09 841000 -- (-911.693) (-910.989) (-910.447) [-910.683] * [-911.900] (-911.591) (-912.003) (-912.808) -- 0:00:09 841500 -- [-909.886] (-911.478) (-909.659) (-911.267) * [-912.151] (-913.560) (-912.560) (-909.690) -- 0:00:09 842000 -- (-914.996) [-912.300] (-909.731) (-912.584) * [-910.435] (-911.714) (-914.929) (-912.569) -- 0:00:09 842500 -- (-912.469) [-912.649] (-912.325) (-912.198) * (-910.195) (-919.252) (-912.003) [-912.313] -- 0:00:09 843000 -- (-912.106) (-912.413) [-913.182] (-910.762) * (-910.365) [-910.231] (-911.823) (-912.138) -- 0:00:09 843500 -- (-912.044) [-912.837] (-916.793) (-914.680) * [-912.745] (-911.181) (-912.938) (-913.035) -- 0:00:09 844000 -- (-912.048) [-912.765] (-915.276) (-910.270) * (-911.954) (-911.094) [-910.541] (-913.875) -- 0:00:09 844500 -- (-912.254) [-913.997] (-915.375) (-912.677) * (-911.400) (-910.849) [-910.740] (-913.864) -- 0:00:09 845000 -- [-911.400] (-910.816) (-911.698) (-911.700) * (-916.675) (-910.439) [-910.171] (-913.860) -- 0:00:09 Average standard deviation of split frequencies: 0.009637 845500 -- (-911.031) [-913.094] (-914.127) (-911.720) * (-912.828) (-913.253) (-913.580) [-912.168] -- 0:00:09 846000 -- (-911.732) [-911.199] (-911.043) (-911.520) * [-912.374] (-914.355) (-912.007) (-911.626) -- 0:00:09 846500 -- (-910.596) (-912.380) (-911.588) [-910.901] * (-911.908) (-910.008) (-911.965) [-913.395] -- 0:00:09 847000 -- [-911.248] (-911.895) (-912.218) (-911.303) * (-911.413) (-912.631) [-911.185] (-912.377) -- 0:00:09 847500 -- (-912.720) (-911.734) [-910.585] (-909.967) * (-912.858) [-909.994] (-915.772) (-912.912) -- 0:00:09 848000 -- [-915.487] (-910.322) (-912.257) (-919.361) * (-913.008) (-910.872) [-911.388] (-912.991) -- 0:00:09 848500 -- (-910.294) (-913.571) (-914.211) [-912.780] * (-911.173) (-910.947) [-911.086] (-909.687) -- 0:00:09 849000 -- (-910.961) (-914.941) [-911.907] (-912.361) * [-911.691] (-912.822) (-913.367) (-909.662) -- 0:00:09 849500 -- [-910.504] (-911.928) (-913.209) (-916.334) * (-914.059) (-912.594) [-911.961] (-911.228) -- 0:00:09 850000 -- (-910.304) [-909.915] (-911.990) (-914.012) * (-918.203) (-911.389) [-909.932] (-911.142) -- 0:00:09 Average standard deviation of split frequencies: 0.009942 850500 -- (-911.105) [-911.652] (-914.088) (-912.457) * (-909.729) (-911.662) (-916.021) [-911.588] -- 0:00:09 851000 -- (-911.099) (-911.591) [-911.534] (-913.675) * (-911.578) (-910.579) (-913.488) [-911.626] -- 0:00:09 851500 -- (-912.472) (-912.950) [-911.585] (-911.502) * (-909.875) [-912.187] (-912.999) (-912.555) -- 0:00:09 852000 -- (-911.523) [-913.957] (-912.794) (-914.273) * [-910.295] (-913.566) (-915.024) (-913.204) -- 0:00:09 852500 -- (-913.839) (-910.578) (-913.909) [-912.967] * [-915.981] (-915.636) (-914.600) (-914.043) -- 0:00:08 853000 -- (-913.574) (-911.011) [-912.150] (-912.557) * (-910.555) (-916.568) [-911.266] (-912.903) -- 0:00:08 853500 -- [-912.626] (-914.892) (-919.195) (-909.982) * (-911.578) (-916.195) (-913.017) [-913.994] -- 0:00:08 854000 -- (-910.924) (-911.612) (-917.139) [-911.209] * (-911.787) (-915.299) (-912.887) [-911.011] -- 0:00:08 854500 -- [-913.570] (-910.670) (-912.429) (-911.747) * (-911.567) (-912.172) (-912.037) [-914.957] -- 0:00:08 855000 -- (-913.466) (-912.239) [-910.259] (-911.791) * [-914.274] (-912.620) (-913.355) (-913.593) -- 0:00:08 Average standard deviation of split frequencies: 0.009880 855500 -- (-910.737) (-910.947) (-912.039) [-911.540] * (-911.539) [-912.224] (-914.414) (-910.316) -- 0:00:08 856000 -- (-911.706) (-912.652) (-911.661) [-913.644] * (-912.444) (-914.918) (-912.586) [-910.686] -- 0:00:08 856500 -- (-916.409) [-910.434] (-911.315) (-910.935) * (-913.009) (-912.659) [-911.331] (-918.519) -- 0:00:08 857000 -- (-914.617) (-910.516) (-912.418) [-910.155] * (-910.341) (-912.981) (-914.363) [-921.175] -- 0:00:08 857500 -- [-913.643] (-911.498) (-911.425) (-912.277) * [-910.882] (-912.932) (-913.530) (-918.176) -- 0:00:08 858000 -- [-911.674] (-910.943) (-912.098) (-911.629) * [-911.539] (-915.829) (-910.569) (-918.831) -- 0:00:08 858500 -- (-914.004) [-910.720] (-915.101) (-912.119) * (-910.305) [-912.752] (-917.442) (-912.712) -- 0:00:08 859000 -- [-915.045] (-910.861) (-911.011) (-910.454) * (-910.895) (-921.420) [-915.276] (-913.019) -- 0:00:08 859500 -- [-912.746] (-913.649) (-910.637) (-912.138) * (-910.696) [-916.193] (-913.113) (-911.578) -- 0:00:08 860000 -- (-910.917) (-911.798) [-912.827] (-915.292) * (-912.300) [-910.645] (-912.295) (-910.130) -- 0:00:08 Average standard deviation of split frequencies: 0.009962 860500 -- [-910.916] (-912.378) (-913.786) (-910.714) * (-910.670) (-912.721) (-909.914) [-915.222] -- 0:00:08 861000 -- (-912.537) (-911.609) (-918.432) [-913.329] * (-910.993) (-910.917) [-911.045] (-915.332) -- 0:00:08 861500 -- (-917.408) (-912.285) (-910.949) [-909.832] * (-910.356) (-910.364) (-911.091) [-910.906] -- 0:00:08 862000 -- (-913.193) (-910.321) (-911.173) [-910.619] * (-911.251) (-913.247) [-910.025] (-913.113) -- 0:00:08 862500 -- (-911.411) [-910.394] (-913.376) (-912.233) * (-914.895) (-916.254) (-910.950) [-910.334] -- 0:00:08 863000 -- (-911.388) [-912.890] (-913.510) (-911.622) * (-914.845) [-911.773] (-910.555) (-910.380) -- 0:00:08 863500 -- (-911.895) (-910.682) [-913.477] (-910.196) * (-911.404) (-912.163) (-913.560) [-912.104] -- 0:00:08 864000 -- (-909.950) [-911.579] (-912.663) (-910.941) * (-911.163) [-910.254] (-912.530) (-913.710) -- 0:00:08 864500 -- [-910.691] (-913.518) (-911.510) (-913.446) * [-913.550] (-917.856) (-912.296) (-913.059) -- 0:00:08 865000 -- (-910.669) (-910.871) [-911.726] (-910.292) * (-910.148) [-911.728] (-911.670) (-911.463) -- 0:00:08 Average standard deviation of split frequencies: 0.010309 865500 -- (-911.576) [-915.594] (-911.606) (-912.068) * (-910.762) [-914.609] (-914.293) (-910.733) -- 0:00:08 866000 -- [-912.900] (-912.909) (-914.757) (-915.357) * [-910.132] (-911.741) (-911.082) (-911.257) -- 0:00:08 866500 -- (-911.516) (-913.275) [-913.147] (-913.101) * (-914.535) (-912.014) (-912.534) [-912.061] -- 0:00:08 867000 -- (-913.981) [-913.552] (-912.573) (-911.547) * (-912.079) (-916.407) (-911.422) [-913.274] -- 0:00:08 867500 -- [-912.291] (-912.948) (-916.522) (-912.365) * (-911.950) (-913.366) (-911.465) [-910.891] -- 0:00:08 868000 -- (-910.991) (-911.689) (-913.900) [-914.867] * (-912.284) (-915.426) [-910.459] (-910.521) -- 0:00:08 868500 -- (-909.806) (-915.888) [-913.053] (-912.519) * (-911.471) (-910.636) [-912.581] (-912.278) -- 0:00:08 869000 -- (-914.359) (-915.413) [-911.604] (-910.846) * (-913.804) (-913.673) [-910.556] (-909.957) -- 0:00:07 869500 -- (-913.249) [-912.530] (-911.541) (-909.961) * (-912.672) (-915.621) [-910.475] (-911.800) -- 0:00:07 870000 -- (-916.261) [-910.588] (-910.556) (-911.754) * (-911.200) [-911.980] (-911.507) (-911.675) -- 0:00:07 Average standard deviation of split frequencies: 0.010795 870500 -- (-912.330) [-910.719] (-910.847) (-910.174) * (-913.832) [-914.110] (-911.466) (-910.574) -- 0:00:07 871000 -- (-911.045) (-909.773) [-911.207] (-912.590) * (-913.873) [-911.468] (-910.017) (-911.620) -- 0:00:07 871500 -- [-914.060] (-909.773) (-911.268) (-911.616) * (-914.022) [-912.216] (-910.767) (-913.929) -- 0:00:07 872000 -- (-914.576) (-911.251) [-913.033] (-912.239) * (-914.478) [-911.912] (-910.664) (-912.432) -- 0:00:07 872500 -- [-910.151] (-910.882) (-910.710) (-909.684) * (-913.292) (-915.478) [-914.963] (-910.599) -- 0:00:07 873000 -- (-912.770) (-910.454) [-911.324] (-913.548) * (-913.223) (-910.578) (-914.520) [-912.609] -- 0:00:07 873500 -- (-910.929) [-910.306] (-914.725) (-915.922) * (-912.563) (-910.935) (-918.269) [-911.110] -- 0:00:07 874000 -- (-910.804) (-910.724) (-915.813) [-912.628] * [-914.436] (-912.037) (-910.808) (-914.041) -- 0:00:07 874500 -- (-911.974) (-912.020) (-912.300) [-910.194] * [-914.450] (-914.965) (-910.608) (-910.891) -- 0:00:07 875000 -- (-913.814) (-911.306) (-911.492) [-910.117] * (-912.073) [-911.465] (-910.464) (-910.308) -- 0:00:07 Average standard deviation of split frequencies: 0.011065 875500 -- (-913.168) (-911.536) (-912.783) [-910.775] * [-913.044] (-911.898) (-915.681) (-912.248) -- 0:00:07 876000 -- [-911.788] (-911.798) (-910.962) (-911.412) * (-912.443) (-912.673) (-912.155) [-911.866] -- 0:00:07 876500 -- [-913.036] (-910.723) (-911.818) (-910.958) * [-912.197] (-911.972) (-913.500) (-914.730) -- 0:00:07 877000 -- [-912.048] (-912.844) (-910.851) (-911.566) * (-910.560) [-911.805] (-910.693) (-915.663) -- 0:00:07 877500 -- (-912.276) [-918.791] (-912.060) (-916.416) * (-912.952) (-911.419) (-911.798) [-916.574] -- 0:00:07 878000 -- [-911.526] (-914.054) (-910.789) (-914.092) * (-914.021) (-910.934) (-913.637) [-912.562] -- 0:00:07 878500 -- [-911.666] (-914.676) (-912.013) (-911.071) * (-914.354) (-910.621) (-912.748) [-913.002] -- 0:00:07 879000 -- (-912.917) [-913.331] (-909.823) (-915.364) * [-911.257] (-911.088) (-911.638) (-909.856) -- 0:00:07 879500 -- (-915.304) (-911.547) [-911.658] (-917.488) * (-914.291) (-911.405) (-910.454) [-912.079] -- 0:00:07 880000 -- [-910.579] (-916.173) (-912.916) (-911.345) * (-910.349) (-911.678) [-910.377] (-910.063) -- 0:00:07 Average standard deviation of split frequencies: 0.010839 880500 -- (-911.021) (-921.305) (-911.661) [-910.873] * (-915.093) (-911.441) [-910.410] (-911.701) -- 0:00:07 881000 -- [-910.273] (-916.741) (-910.382) (-913.980) * (-911.903) (-910.574) (-912.211) [-911.378] -- 0:00:07 881500 -- (-910.269) (-910.984) [-912.233] (-911.100) * (-911.274) [-909.786] (-910.810) (-911.770) -- 0:00:07 882000 -- (-913.410) (-911.468) (-911.705) [-913.856] * (-911.664) [-909.788] (-912.010) (-910.867) -- 0:00:07 882500 -- (-911.515) [-911.119] (-910.781) (-913.498) * (-913.114) [-910.418] (-911.060) (-912.524) -- 0:00:07 883000 -- (-914.114) (-914.394) (-912.752) [-914.277] * (-914.018) (-911.292) (-910.975) [-912.720] -- 0:00:07 883500 -- (-911.304) (-911.460) [-909.945] (-910.313) * (-912.123) (-914.061) [-911.038] (-915.017) -- 0:00:07 884000 -- (-911.278) (-911.480) [-909.958] (-912.020) * [-909.639] (-910.015) (-912.437) (-913.928) -- 0:00:07 884500 -- (-911.121) (-910.662) [-911.026] (-912.157) * [-910.907] (-912.283) (-913.638) (-914.585) -- 0:00:07 885000 -- (-911.896) (-914.431) (-912.366) [-912.215] * (-911.892) (-919.853) (-912.994) [-914.815] -- 0:00:07 Average standard deviation of split frequencies: 0.010342 885500 -- [-911.216] (-911.725) (-910.413) (-910.906) * (-911.493) [-911.220] (-913.106) (-913.316) -- 0:00:06 886000 -- [-913.877] (-912.967) (-912.820) (-910.583) * [-910.997] (-913.859) (-910.913) (-914.396) -- 0:00:06 886500 -- [-911.963] (-914.166) (-913.232) (-913.039) * [-911.552] (-912.850) (-911.949) (-914.868) -- 0:00:06 887000 -- (-910.615) [-914.466] (-910.105) (-912.421) * (-910.477) (-912.515) (-913.230) [-911.819] -- 0:00:06 887500 -- (-911.106) (-913.218) [-913.202] (-916.301) * (-909.661) (-912.058) [-910.940] (-912.319) -- 0:00:06 888000 -- [-911.678] (-911.918) (-911.292) (-912.683) * (-911.206) (-913.655) [-912.487] (-914.767) -- 0:00:06 888500 -- (-915.468) (-911.451) [-912.428] (-910.240) * (-913.263) (-913.175) [-911.323] (-912.040) -- 0:00:06 889000 -- (-915.218) [-911.209] (-915.056) (-913.343) * (-913.235) (-910.955) [-912.085] (-914.692) -- 0:00:06 889500 -- (-914.436) [-913.290] (-910.274) (-914.692) * (-910.995) (-915.670) [-915.096] (-911.537) -- 0:00:06 890000 -- (-917.387) [-912.164] (-909.732) (-917.523) * (-912.743) (-912.555) [-912.619] (-910.914) -- 0:00:06 Average standard deviation of split frequencies: 0.010122 890500 -- (-914.193) (-911.934) [-912.237] (-911.456) * (-912.914) [-913.611] (-911.758) (-910.477) -- 0:00:06 891000 -- (-914.267) [-911.529] (-911.566) (-912.349) * (-910.486) (-911.639) (-911.869) [-912.690] -- 0:00:06 891500 -- (-912.482) [-909.763] (-911.138) (-912.832) * [-911.842] (-912.910) (-911.126) (-912.315) -- 0:00:06 892000 -- (-914.951) [-909.767] (-912.055) (-912.694) * (-914.245) (-918.416) [-911.624] (-911.861) -- 0:00:06 892500 -- [-911.178] (-914.141) (-909.965) (-912.018) * [-910.741] (-912.861) (-910.835) (-911.704) -- 0:00:06 893000 -- [-912.852] (-911.994) (-911.792) (-912.434) * (-911.293) [-913.833] (-914.776) (-916.780) -- 0:00:06 893500 -- (-911.095) [-910.447] (-911.493) (-913.241) * [-910.568] (-912.685) (-910.088) (-912.916) -- 0:00:06 894000 -- [-915.705] (-911.836) (-912.817) (-912.678) * (-911.932) [-911.320] (-911.189) (-910.523) -- 0:00:06 894500 -- (-913.281) (-911.864) (-910.391) [-910.350] * (-913.885) (-910.218) (-912.332) [-909.993] -- 0:00:06 895000 -- [-918.165] (-915.778) (-912.556) (-910.879) * (-915.709) (-909.900) (-911.425) [-913.193] -- 0:00:06 Average standard deviation of split frequencies: 0.010095 895500 -- [-913.327] (-910.399) (-911.087) (-912.952) * (-915.764) (-912.955) [-910.103] (-910.947) -- 0:00:06 896000 -- (-913.067) (-911.796) (-911.121) [-910.203] * (-912.321) (-913.058) [-909.946] (-913.683) -- 0:00:06 896500 -- (-912.255) [-910.634] (-911.614) (-912.765) * [-913.451] (-910.077) (-912.580) (-911.870) -- 0:00:06 897000 -- [-914.414] (-911.455) (-914.340) (-913.990) * (-919.750) [-914.509] (-912.452) (-912.529) -- 0:00:06 897500 -- [-912.364] (-911.499) (-910.517) (-911.268) * (-912.323) (-910.648) (-919.171) [-910.661] -- 0:00:06 898000 -- (-914.573) (-910.544) [-912.666] (-915.945) * (-917.575) [-910.304] (-912.570) (-910.433) -- 0:00:06 898500 -- (-911.354) (-911.066) (-911.006) [-914.344] * [-911.429] (-912.155) (-910.916) (-910.899) -- 0:00:06 899000 -- (-915.179) (-911.175) (-912.765) [-913.026] * (-910.166) (-910.479) (-912.804) [-910.510] -- 0:00:06 899500 -- (-912.032) (-911.719) [-915.143] (-915.124) * [-912.093] (-909.795) (-913.625) (-912.438) -- 0:00:06 900000 -- (-910.614) [-910.629] (-912.892) (-911.321) * (-917.753) (-912.277) [-911.962] (-911.667) -- 0:00:06 Average standard deviation of split frequencies: 0.010173 900500 -- (-910.710) [-913.048] (-912.890) (-911.531) * (-916.066) (-912.910) (-912.402) [-911.495] -- 0:00:06 901000 -- [-912.377] (-912.951) (-910.772) (-913.729) * (-912.385) [-912.640] (-910.048) (-911.528) -- 0:00:06 901500 -- (-914.339) (-913.907) (-910.432) [-911.971] * (-912.541) [-911.135] (-910.773) (-915.848) -- 0:00:06 902000 -- (-909.767) (-912.996) [-909.906] (-911.773) * (-912.393) (-916.899) (-911.727) [-914.259] -- 0:00:05 902500 -- (-911.129) [-913.004] (-912.946) (-912.577) * (-911.922) (-914.897) [-912.162] (-911.683) -- 0:00:05 903000 -- [-910.299] (-913.723) (-913.890) (-912.853) * (-915.453) (-912.591) [-910.413] (-912.451) -- 0:00:05 903500 -- (-910.832) (-915.115) (-912.093) [-910.523] * (-911.801) (-914.807) (-910.341) [-910.691] -- 0:00:05 904000 -- [-911.308] (-912.387) (-912.434) (-911.472) * (-912.152) [-911.968] (-912.194) (-909.887) -- 0:00:05 904500 -- (-911.510) (-914.090) (-911.115) [-914.754] * (-910.252) (-911.280) [-912.629] (-910.351) -- 0:00:05 905000 -- (-910.130) [-910.573] (-911.826) (-915.143) * (-910.133) [-911.979] (-917.862) (-912.948) -- 0:00:05 Average standard deviation of split frequencies: 0.009886 905500 -- (-910.977) [-912.021] (-917.360) (-914.814) * (-911.789) [-911.927] (-911.632) (-912.140) -- 0:00:05 906000 -- (-911.510) (-912.331) (-913.492) [-915.129] * (-915.378) (-914.030) (-911.690) [-913.078] -- 0:00:05 906500 -- [-911.908] (-910.430) (-910.564) (-914.033) * (-911.402) (-912.819) [-911.353] (-912.795) -- 0:00:05 907000 -- (-910.332) [-910.923] (-914.415) (-913.399) * (-912.762) (-911.534) (-910.241) [-911.963] -- 0:00:05 907500 -- (-913.541) (-911.014) (-910.970) [-912.776] * [-911.087] (-913.254) (-911.281) (-911.977) -- 0:00:05 908000 -- (-910.475) (-912.839) [-910.847] (-916.145) * (-911.053) [-912.946] (-909.875) (-912.356) -- 0:00:05 908500 -- (-911.238) (-911.538) (-911.617) [-916.065] * (-910.696) (-913.906) [-912.485] (-912.424) -- 0:00:05 909000 -- (-916.288) (-910.216) [-910.336] (-913.542) * (-911.833) (-915.498) [-910.947] (-910.365) -- 0:00:05 909500 -- (-911.999) [-912.659] (-913.037) (-911.844) * (-911.315) (-911.856) [-910.690] (-912.128) -- 0:00:05 910000 -- (-918.126) [-917.653] (-914.492) (-911.589) * [-911.217] (-915.947) (-910.058) (-910.157) -- 0:00:05 Average standard deviation of split frequencies: 0.009868 910500 -- [-910.433] (-915.031) (-912.489) (-910.232) * (-914.245) [-919.386] (-914.812) (-911.423) -- 0:00:05 911000 -- (-911.743) (-915.265) [-910.119] (-913.638) * (-911.483) [-912.582] (-913.491) (-912.151) -- 0:00:05 911500 -- (-910.141) (-909.870) [-910.945] (-913.229) * (-912.259) (-912.484) [-915.793] (-912.143) -- 0:00:05 912000 -- [-910.850] (-911.205) (-910.410) (-914.566) * (-915.874) [-912.104] (-915.294) (-912.502) -- 0:00:05 912500 -- (-912.158) (-912.919) (-910.931) [-912.437] * (-912.786) (-913.409) [-914.770] (-911.518) -- 0:00:05 913000 -- [-910.689] (-911.269) (-911.089) (-915.490) * (-911.640) [-911.288] (-913.997) (-911.574) -- 0:00:05 913500 -- (-913.263) (-910.107) [-913.026] (-916.697) * (-911.320) [-909.697] (-914.897) (-910.283) -- 0:00:05 914000 -- (-915.236) (-910.875) (-911.869) [-913.233] * (-913.615) [-910.310] (-916.996) (-911.861) -- 0:00:05 914500 -- (-912.699) [-911.310] (-915.202) (-911.540) * (-914.981) (-910.146) (-911.513) [-911.079] -- 0:00:05 915000 -- (-912.904) [-910.309] (-915.088) (-912.817) * (-912.429) [-911.930] (-910.144) (-912.991) -- 0:00:05 Average standard deviation of split frequencies: 0.009875 915500 -- (-911.823) [-912.509] (-912.391) (-913.108) * (-913.902) [-910.735] (-910.055) (-912.660) -- 0:00:05 916000 -- (-913.947) (-910.548) [-910.999] (-913.748) * (-910.713) (-910.467) (-912.224) [-910.334] -- 0:00:05 916500 -- (-911.067) (-910.879) (-910.381) [-910.612] * (-912.783) [-913.963] (-913.542) (-912.605) -- 0:00:05 917000 -- [-912.556] (-910.755) (-914.273) (-911.288) * (-911.734) (-914.193) [-914.064] (-911.545) -- 0:00:05 917500 -- (-912.982) (-913.873) [-912.970] (-912.156) * (-910.474) (-913.647) [-912.922] (-914.524) -- 0:00:05 918000 -- (-911.135) (-915.599) (-913.125) [-910.609] * (-912.326) (-916.805) [-911.899] (-915.175) -- 0:00:05 918500 -- [-914.331] (-917.886) (-910.325) (-915.384) * (-912.199) (-911.802) (-915.975) [-912.253] -- 0:00:04 919000 -- [-911.703] (-911.598) (-910.406) (-910.750) * [-912.817] (-910.798) (-915.315) (-911.400) -- 0:00:04 919500 -- [-913.168] (-915.060) (-910.594) (-910.531) * (-914.223) (-911.018) (-913.308) [-910.878] -- 0:00:04 920000 -- (-912.758) (-910.103) (-914.597) [-911.362] * [-912.887] (-911.613) (-913.965) (-911.591) -- 0:00:04 Average standard deviation of split frequencies: 0.009696 920500 -- (-911.477) (-911.751) (-912.730) [-911.965] * [-911.885] (-911.906) (-912.494) (-914.239) -- 0:00:04 921000 -- (-911.465) (-910.565) (-911.756) [-914.129] * [-912.164] (-914.387) (-913.560) (-914.123) -- 0:00:04 921500 -- (-916.397) (-910.886) [-913.261] (-910.567) * [-911.359] (-912.342) (-913.000) (-915.066) -- 0:00:04 922000 -- (-912.417) (-912.477) [-914.438] (-911.903) * (-911.107) (-916.743) (-912.485) [-911.560] -- 0:00:04 922500 -- [-911.596] (-911.668) (-910.491) (-915.830) * (-910.767) (-911.007) (-913.004) [-912.372] -- 0:00:04 923000 -- [-910.948] (-912.035) (-910.165) (-912.882) * (-911.752) (-909.989) [-910.774] (-916.717) -- 0:00:04 923500 -- [-910.806] (-911.874) (-911.744) (-914.053) * (-912.862) (-910.305) [-910.524] (-910.567) -- 0:00:04 924000 -- (-913.085) [-910.239] (-911.608) (-913.327) * (-915.301) (-910.120) [-912.043] (-911.502) -- 0:00:04 924500 -- (-913.162) (-912.950) [-913.909] (-911.170) * [-910.176] (-910.267) (-910.226) (-919.223) -- 0:00:04 925000 -- (-911.193) [-910.808] (-912.309) (-910.252) * (-912.477) (-911.108) (-913.236) [-911.325] -- 0:00:04 Average standard deviation of split frequencies: 0.009291 925500 -- (-913.319) [-910.530] (-910.898) (-909.776) * [-911.886] (-912.246) (-912.620) (-911.298) -- 0:00:04 926000 -- (-914.211) (-910.068) [-910.687] (-913.238) * (-910.790) (-912.462) [-911.216] (-911.771) -- 0:00:04 926500 -- (-913.400) (-911.053) (-911.914) [-911.201] * (-912.330) [-911.246] (-912.496) (-912.540) -- 0:00:04 927000 -- [-914.951] (-911.179) (-912.864) (-910.181) * (-914.006) (-911.563) [-910.211] (-911.736) -- 0:00:04 927500 -- [-910.795] (-912.050) (-912.842) (-909.918) * (-910.343) (-911.006) [-909.769] (-910.474) -- 0:00:04 928000 -- (-911.061) (-911.508) (-911.607) [-912.449] * (-910.372) (-912.867) (-909.987) [-909.664] -- 0:00:04 928500 -- (-913.206) [-911.468] (-910.746) (-913.489) * (-910.205) (-913.265) (-910.187) [-910.119] -- 0:00:04 929000 -- (-910.397) (-912.140) (-914.508) [-912.093] * (-913.498) (-911.316) [-912.034] (-915.350) -- 0:00:04 929500 -- (-913.533) [-912.975] (-912.431) (-911.793) * (-910.017) (-910.623) (-914.935) [-910.838] -- 0:00:04 930000 -- (-914.411) (-910.800) (-911.756) [-913.805] * [-911.445] (-916.806) (-915.035) (-910.441) -- 0:00:04 Average standard deviation of split frequencies: 0.009434 930500 -- [-912.195] (-910.681) (-912.108) (-910.001) * (-910.457) (-915.276) (-912.819) [-910.363] -- 0:00:04 931000 -- (-911.938) (-910.343) [-912.964] (-912.649) * (-911.627) [-912.934] (-915.353) (-912.843) -- 0:00:04 931500 -- [-912.717] (-910.562) (-912.931) (-911.909) * (-912.362) (-912.533) (-918.835) [-911.811] -- 0:00:04 932000 -- [-913.419] (-912.091) (-910.932) (-914.163) * (-912.739) (-911.823) (-911.052) [-913.448] -- 0:00:04 932500 -- (-910.970) (-916.498) [-912.502] (-913.296) * (-912.455) (-910.682) (-911.189) [-912.250] -- 0:00:04 933000 -- (-911.777) (-912.775) [-910.373] (-912.233) * (-912.658) [-910.852] (-917.218) (-913.096) -- 0:00:04 933500 -- (-914.370) (-910.897) [-912.594] (-912.334) * (-911.636) (-912.796) (-914.686) [-913.391] -- 0:00:04 934000 -- [-914.764] (-910.930) (-910.824) (-911.859) * (-911.715) [-910.635] (-916.454) (-911.516) -- 0:00:04 934500 -- (-909.831) (-911.206) (-914.843) [-911.050] * [-913.992] (-915.211) (-910.815) (-910.568) -- 0:00:03 935000 -- (-909.841) (-911.113) (-910.157) [-911.772] * (-911.299) (-911.710) (-910.787) [-910.012] -- 0:00:03 Average standard deviation of split frequencies: 0.009160 935500 -- [-911.341] (-914.865) (-915.940) (-911.437) * (-912.356) [-910.421] (-910.806) (-912.674) -- 0:00:03 936000 -- (-912.129) (-911.063) (-918.163) [-916.085] * (-910.455) (-910.686) [-912.408] (-914.943) -- 0:00:03 936500 -- [-910.600] (-914.723) (-913.920) (-910.701) * (-910.884) (-910.138) [-911.926] (-912.415) -- 0:00:03 937000 -- (-910.940) (-912.063) [-910.148] (-910.701) * (-924.078) [-911.490] (-911.308) (-912.603) -- 0:00:03 937500 -- (-914.167) (-913.209) (-911.167) [-910.933] * [-912.897] (-912.586) (-911.846) (-912.035) -- 0:00:03 938000 -- [-911.569] (-910.299) (-913.881) (-912.871) * [-914.514] (-914.750) (-911.017) (-911.580) -- 0:00:03 938500 -- (-910.812) (-914.289) [-910.685] (-911.076) * (-910.596) [-911.891] (-910.636) (-915.109) -- 0:00:03 939000 -- (-910.803) (-910.729) (-913.436) [-912.318] * (-914.032) [-911.388] (-910.954) (-910.751) -- 0:00:03 939500 -- (-912.982) (-916.037) [-912.105] (-911.348) * [-916.431] (-913.030) (-911.132) (-910.955) -- 0:00:03 940000 -- [-909.707] (-913.511) (-913.543) (-911.971) * (-914.958) [-910.843] (-910.108) (-911.790) -- 0:00:03 Average standard deviation of split frequencies: 0.009428 940500 -- (-910.214) (-914.519) [-913.459] (-912.276) * (-911.958) (-913.499) (-912.746) [-912.258] -- 0:00:03 941000 -- (-910.649) (-914.130) [-916.298] (-916.947) * (-910.150) (-911.733) [-912.729] (-911.543) -- 0:00:03 941500 -- (-912.462) [-911.983] (-915.864) (-911.991) * [-910.816] (-915.507) (-915.753) (-912.461) -- 0:00:03 942000 -- [-911.604] (-911.411) (-913.838) (-914.176) * (-916.964) (-912.351) (-912.478) [-911.047] -- 0:00:03 942500 -- (-911.358) [-912.322] (-913.081) (-911.718) * (-912.264) [-913.110] (-910.331) (-910.680) -- 0:00:03 943000 -- (-911.564) (-911.553) [-913.807] (-913.256) * [-910.544] (-915.465) (-911.225) (-912.747) -- 0:00:03 943500 -- (-914.211) (-914.111) (-912.134) [-912.783] * (-911.496) [-911.907] (-914.931) (-915.315) -- 0:00:03 944000 -- (-910.776) (-914.135) (-913.183) [-912.169] * (-914.098) [-911.581] (-910.478) (-912.364) -- 0:00:03 944500 -- (-911.198) (-913.282) (-910.225) [-910.863] * (-912.840) (-913.810) [-911.724] (-914.657) -- 0:00:03 945000 -- (-912.737) (-917.116) (-912.212) [-910.851] * [-911.216] (-913.027) (-912.219) (-916.907) -- 0:00:03 Average standard deviation of split frequencies: 0.008876 945500 -- (-911.505) (-912.317) (-911.823) [-913.321] * (-914.423) (-913.936) [-911.273] (-914.968) -- 0:00:03 946000 -- (-911.562) [-911.726] (-911.823) (-914.947) * (-910.018) [-918.200] (-912.555) (-913.246) -- 0:00:03 946500 -- (-911.472) (-914.033) [-909.768] (-912.273) * (-910.207) (-919.382) [-911.576] (-915.502) -- 0:00:03 947000 -- (-911.350) (-913.471) [-910.092] (-912.273) * (-912.720) (-911.720) [-911.874] (-912.554) -- 0:00:03 947500 -- (-912.639) [-910.836] (-910.265) (-912.534) * (-912.794) [-914.955] (-910.719) (-912.577) -- 0:00:03 948000 -- (-910.472) [-911.318] (-911.527) (-912.153) * (-919.167) [-911.821] (-911.965) (-915.255) -- 0:00:03 948500 -- (-910.295) (-915.348) (-913.690) [-910.543] * (-912.508) [-910.952] (-910.339) (-917.656) -- 0:00:03 949000 -- (-910.298) [-913.386] (-913.752) (-911.148) * (-911.301) (-914.709) (-910.130) [-912.028] -- 0:00:03 949500 -- (-910.354) [-913.257] (-913.615) (-911.058) * (-911.442) [-910.587] (-910.160) (-912.620) -- 0:00:03 950000 -- (-914.771) (-912.708) [-915.194] (-910.376) * (-912.898) (-914.573) [-911.338] (-911.625) -- 0:00:03 Average standard deviation of split frequencies: 0.008895 950500 -- (-911.691) [-910.162] (-910.829) (-910.887) * (-910.836) (-913.909) (-912.572) [-911.859] -- 0:00:03 951000 -- (-910.232) (-913.563) (-915.719) [-914.332] * (-910.512) (-912.026) (-911.884) [-912.071] -- 0:00:02 951500 -- [-912.372] (-914.109) (-911.071) (-910.076) * (-912.087) [-911.024] (-912.677) (-913.164) -- 0:00:02 952000 -- [-911.931] (-912.110) (-910.432) (-910.008) * (-910.976) [-914.459] (-910.921) (-917.838) -- 0:00:02 952500 -- [-910.936] (-910.754) (-911.691) (-910.008) * (-910.999) (-912.441) [-911.929] (-913.268) -- 0:00:02 953000 -- (-910.418) (-910.704) [-912.800] (-910.210) * [-911.511] (-913.120) (-912.426) (-913.276) -- 0:00:02 953500 -- (-913.920) (-913.247) [-911.671] (-911.383) * (-912.963) (-910.370) [-912.287] (-910.042) -- 0:00:02 954000 -- [-914.618] (-912.757) (-913.911) (-915.645) * (-913.813) (-911.290) (-912.755) [-909.999] -- 0:00:02 954500 -- (-912.109) (-913.054) (-909.907) [-913.576] * (-912.573) (-911.220) [-910.737] (-911.715) -- 0:00:02 955000 -- (-910.925) (-914.768) [-909.912] (-910.651) * [-911.159] (-912.347) (-912.386) (-913.641) -- 0:00:02 Average standard deviation of split frequencies: 0.009215 955500 -- (-910.900) [-913.181] (-913.784) (-913.713) * [-911.314] (-911.907) (-913.467) (-912.653) -- 0:00:02 956000 -- [-910.735] (-910.717) (-913.525) (-910.042) * (-911.296) (-913.065) (-916.199) [-910.376] -- 0:00:02 956500 -- (-910.889) (-913.688) (-912.692) [-910.571] * [-911.181] (-912.188) (-912.460) (-913.485) -- 0:00:02 957000 -- [-911.481] (-912.913) (-915.216) (-912.268) * (-910.844) (-912.882) [-912.840] (-910.491) -- 0:00:02 957500 -- (-910.856) (-912.622) [-913.714] (-910.285) * (-912.161) (-916.145) [-911.369] (-910.311) -- 0:00:02 958000 -- (-912.515) (-913.647) [-910.099] (-910.540) * (-916.795) [-912.483] (-913.099) (-917.479) -- 0:00:02 958500 -- (-910.701) [-913.595] (-911.363) (-911.780) * (-913.196) [-911.542] (-911.091) (-911.630) -- 0:00:02 959000 -- [-913.729] (-911.672) (-914.649) (-915.640) * (-917.917) (-910.985) [-911.257] (-915.258) -- 0:00:02 959500 -- (-911.170) (-914.790) [-912.339] (-910.296) * (-912.154) (-911.007) (-911.961) [-910.719] -- 0:00:02 960000 -- (-912.089) (-910.592) [-915.165] (-910.251) * (-912.478) [-910.246] (-911.599) (-911.866) -- 0:00:02 Average standard deviation of split frequencies: 0.009139 960500 -- (-910.564) (-909.865) (-916.880) [-911.836] * (-911.151) (-913.037) [-912.019] (-915.046) -- 0:00:02 961000 -- [-910.475] (-912.201) (-914.427) (-911.020) * [-911.124] (-911.810) (-911.029) (-914.290) -- 0:00:02 961500 -- (-912.277) (-912.191) (-912.461) [-910.579] * (-913.049) (-911.198) [-911.626] (-915.794) -- 0:00:02 962000 -- [-914.982] (-913.947) (-912.464) (-910.502) * (-909.808) (-911.349) [-916.249] (-910.181) -- 0:00:02 962500 -- (-913.299) [-916.381] (-914.197) (-910.546) * (-911.771) (-912.541) [-917.780] (-911.144) -- 0:00:02 963000 -- [-910.276] (-914.052) (-915.034) (-912.606) * [-912.411] (-911.877) (-910.568) (-911.497) -- 0:00:02 963500 -- (-910.640) (-911.587) [-913.053] (-911.097) * (-910.443) (-912.942) (-912.164) [-914.013] -- 0:00:02 964000 -- [-913.344] (-912.178) (-911.360) (-914.979) * (-912.375) (-910.726) [-910.988] (-915.083) -- 0:00:02 964500 -- (-912.308) (-915.704) (-914.881) [-910.224] * (-910.842) (-915.666) (-911.888) [-913.437] -- 0:00:02 965000 -- [-915.615] (-913.625) (-915.156) (-909.884) * (-912.548) [-913.791] (-910.327) (-916.639) -- 0:00:02 Average standard deviation of split frequencies: 0.008845 965500 -- (-910.018) (-913.637) (-914.732) [-910.278] * (-910.992) (-911.268) [-912.673] (-917.255) -- 0:00:02 966000 -- (-914.734) (-911.825) (-910.151) [-910.860] * (-910.093) (-915.175) (-910.374) [-914.793] -- 0:00:02 966500 -- (-912.289) (-911.570) [-910.518] (-909.815) * (-913.897) (-911.536) (-910.995) [-910.374] -- 0:00:02 967000 -- [-910.450] (-914.985) (-917.130) (-910.058) * (-910.039) (-910.676) (-912.408) [-912.416] -- 0:00:02 967500 -- (-912.416) [-910.514] (-913.810) (-911.091) * [-911.214] (-915.557) (-911.972) (-913.477) -- 0:00:01 968000 -- (-912.336) (-909.949) (-912.806) [-912.185] * (-913.411) (-913.639) [-912.524] (-917.264) -- 0:00:01 968500 -- [-910.992] (-910.497) (-912.290) (-917.568) * (-915.941) [-912.544] (-913.539) (-917.109) -- 0:00:01 969000 -- (-913.186) [-910.229] (-911.019) (-913.917) * (-912.250) [-910.772] (-917.106) (-911.419) -- 0:00:01 969500 -- (-917.307) (-910.378) (-910.200) [-909.905] * (-915.588) [-912.073] (-912.149) (-913.107) -- 0:00:01 970000 -- (-911.930) [-911.231] (-910.915) (-912.885) * (-910.568) (-911.827) [-911.823] (-909.785) -- 0:00:01 Average standard deviation of split frequencies: 0.008711 970500 -- (-912.942) (-911.553) [-911.419] (-911.114) * (-913.068) (-911.547) (-914.450) [-915.598] -- 0:00:01 971000 -- (-911.450) (-914.190) [-911.473] (-912.723) * (-911.271) (-912.191) [-910.919] (-913.493) -- 0:00:01 971500 -- [-910.647] (-911.867) (-911.098) (-913.661) * (-914.642) (-912.302) (-909.867) [-912.870] -- 0:00:01 972000 -- (-911.428) (-912.054) [-913.071] (-912.113) * (-911.553) [-911.931] (-910.564) (-911.555) -- 0:00:01 972500 -- (-910.634) (-911.696) (-913.269) [-911.945] * [-911.279] (-913.209) (-910.740) (-912.845) -- 0:00:01 973000 -- (-912.901) [-916.136] (-912.241) (-913.906) * (-912.052) (-910.529) [-911.581] (-911.626) -- 0:00:01 973500 -- (-911.052) (-911.487) (-911.080) [-913.237] * [-911.734] (-911.591) (-910.810) (-910.148) -- 0:00:01 974000 -- [-915.503] (-914.363) (-910.488) (-910.495) * [-912.515] (-915.692) (-912.468) (-911.800) -- 0:00:01 974500 -- (-914.965) [-911.889] (-911.162) (-911.107) * [-911.958] (-913.954) (-910.567) (-910.801) -- 0:00:01 975000 -- (-910.184) (-912.350) [-914.191] (-913.113) * (-912.134) (-914.060) (-910.862) [-914.524] -- 0:00:01 Average standard deviation of split frequencies: 0.008332 975500 -- (-909.651) (-912.050) [-911.665] (-914.980) * (-910.682) (-911.270) [-917.002] (-911.103) -- 0:00:01 976000 -- (-911.882) (-914.440) (-911.927) [-909.771] * (-912.084) (-912.584) (-912.585) [-912.350] -- 0:00:01 976500 -- (-912.044) [-913.841] (-910.145) (-911.910) * (-909.852) [-911.355] (-913.594) (-911.887) -- 0:00:01 977000 -- (-912.577) [-911.228] (-911.718) (-910.463) * (-913.543) [-910.646] (-913.530) (-919.621) -- 0:00:01 977500 -- [-911.293] (-911.861) (-912.799) (-910.479) * (-912.442) [-910.661] (-914.109) (-915.263) -- 0:00:01 978000 -- (-910.396) [-914.002] (-911.169) (-913.497) * [-910.105] (-909.927) (-912.286) (-914.954) -- 0:00:01 978500 -- (-910.268) (-915.002) [-911.138] (-919.993) * (-911.296) (-914.988) (-911.611) [-912.146] -- 0:00:01 979000 -- (-914.681) (-910.589) [-910.631] (-914.652) * [-910.840] (-915.149) (-912.784) (-911.859) -- 0:00:01 979500 -- (-919.683) (-912.871) (-918.001) [-915.779] * [-911.984] (-912.467) (-912.307) (-910.871) -- 0:00:01 980000 -- [-911.206] (-915.114) (-916.444) (-914.584) * (-914.538) (-912.614) (-915.487) [-911.281] -- 0:00:01 Average standard deviation of split frequencies: 0.008076 980500 -- (-911.655) (-915.183) (-914.262) [-913.536] * (-917.749) (-912.157) [-914.921] (-910.648) -- 0:00:01 981000 -- (-912.604) (-912.892) [-910.876] (-912.997) * (-912.148) (-912.516) [-910.850] (-911.296) -- 0:00:01 981500 -- (-910.406) (-911.631) [-911.717] (-913.925) * [-915.780] (-910.954) (-910.494) (-911.414) -- 0:00:01 982000 -- [-912.809] (-912.684) (-915.853) (-912.329) * (-915.656) (-914.003) [-915.735] (-910.999) -- 0:00:01 982500 -- [-913.070] (-912.033) (-910.961) (-913.586) * (-911.435) (-914.870) [-911.153] (-912.865) -- 0:00:01 983000 -- (-913.161) (-909.803) (-912.966) [-912.514] * (-911.269) (-911.126) (-909.907) [-913.427] -- 0:00:01 983500 -- (-913.131) (-913.018) (-912.275) [-915.857] * (-910.784) [-911.577] (-910.298) (-913.299) -- 0:00:01 984000 -- (-910.460) (-909.733) (-911.922) [-912.569] * [-910.789] (-911.864) (-913.375) (-911.658) -- 0:00:00 984500 -- (-910.050) [-911.003] (-912.036) (-912.708) * (-910.514) (-912.018) (-912.271) [-911.812] -- 0:00:00 985000 -- [-910.644] (-912.536) (-911.425) (-914.371) * (-912.728) (-912.952) [-912.252] (-913.025) -- 0:00:00 Average standard deviation of split frequencies: 0.007936 985500 -- (-914.191) (-914.185) (-911.540) [-912.395] * (-911.549) (-911.694) (-912.983) [-911.540] -- 0:00:00 986000 -- (-913.462) [-914.296] (-910.865) (-912.580) * (-911.365) (-912.136) (-912.154) [-911.918] -- 0:00:00 986500 -- [-911.982] (-912.402) (-910.180) (-915.968) * (-911.652) [-910.468] (-913.091) (-914.185) -- 0:00:00 987000 -- (-911.710) (-911.405) [-913.559] (-912.634) * (-913.194) (-912.514) [-911.425] (-909.866) -- 0:00:00 987500 -- (-911.306) [-911.419] (-910.913) (-916.365) * (-911.736) (-912.321) [-911.637] (-914.854) -- 0:00:00 988000 -- (-912.096) [-910.799] (-911.857) (-914.257) * (-915.240) (-911.018) [-911.023] (-912.116) -- 0:00:00 988500 -- (-910.118) [-914.970] (-913.667) (-918.795) * [-913.573] (-911.297) (-911.193) (-910.511) -- 0:00:00 989000 -- (-910.148) [-912.238] (-911.552) (-912.042) * (-911.190) [-913.401] (-910.638) (-917.180) -- 0:00:00 989500 -- [-909.650] (-912.710) (-912.855) (-911.072) * [-910.355] (-911.577) (-912.336) (-910.559) -- 0:00:00 990000 -- [-910.731] (-914.883) (-914.887) (-911.440) * (-912.143) [-912.009] (-912.526) (-913.609) -- 0:00:00 Average standard deviation of split frequencies: 0.007645 990500 -- (-911.146) [-911.832] (-912.512) (-911.942) * (-911.439) (-910.329) (-914.034) [-914.971] -- 0:00:00 991000 -- [-912.291] (-911.879) (-914.000) (-913.218) * (-913.014) [-915.677] (-911.753) (-912.021) -- 0:00:00 991500 -- (-912.251) (-910.777) [-912.132] (-912.415) * (-912.805) (-916.998) [-910.015] (-913.292) -- 0:00:00 992000 -- [-911.891] (-912.867) (-914.256) (-910.282) * [-912.396] (-918.342) (-910.708) (-921.387) -- 0:00:00 992500 -- (-910.863) (-910.902) [-915.697] (-911.530) * (-912.098) (-913.622) (-911.756) [-916.949] -- 0:00:00 993000 -- (-913.801) [-911.168] (-913.303) (-910.648) * (-911.593) (-913.223) (-910.726) [-912.359] -- 0:00:00 993500 -- (-913.146) [-912.221] (-918.236) (-911.586) * (-911.644) [-912.368] (-914.465) (-913.695) -- 0:00:00 994000 -- (-913.447) [-910.768] (-911.647) (-915.594) * [-911.146] (-911.674) (-912.499) (-912.371) -- 0:00:00 994500 -- (-912.147) (-910.399) [-911.700] (-913.315) * [-910.826] (-912.406) (-911.446) (-912.837) -- 0:00:00 995000 -- (-911.639) (-910.545) (-913.376) [-913.879] * (-912.167) (-913.166) (-913.077) [-913.401] -- 0:00:00 Average standard deviation of split frequencies: 0.008046 995500 -- (-911.629) (-910.738) [-910.527] (-911.100) * (-912.541) (-912.186) (-911.960) [-913.831] -- 0:00:00 996000 -- (-916.366) (-912.701) (-910.716) [-912.297] * (-911.042) (-915.082) [-910.736] (-912.005) -- 0:00:00 996500 -- (-911.887) [-911.562] (-917.059) (-914.145) * (-911.209) (-914.855) (-914.423) [-910.898] -- 0:00:00 997000 -- [-911.491] (-911.594) (-918.220) (-914.373) * (-911.205) (-913.346) [-912.629] (-912.334) -- 0:00:00 997500 -- (-910.976) (-912.527) [-914.752] (-909.617) * (-910.155) (-911.070) [-910.260] (-913.739) -- 0:00:00 998000 -- (-910.455) (-913.076) [-915.838] (-910.261) * [-913.504] (-913.466) (-910.357) (-910.925) -- 0:00:00 998500 -- (-911.047) (-914.128) (-911.167) [-910.106] * (-912.674) (-913.141) [-911.275] (-910.949) -- 0:00:00 999000 -- [-913.704] (-911.988) (-912.174) (-909.663) * [-915.404] (-911.660) (-910.865) (-911.300) -- 0:00:00 999500 -- (-910.317) [-911.017] (-913.055) (-914.074) * (-918.534) (-916.499) [-910.749] (-912.086) -- 0:00:00 1000000 -- (-911.488) [-910.419] (-910.404) (-915.220) * (-913.620) (-909.763) [-913.224] (-912.183) -- 0:00:00 Average standard deviation of split frequencies: 0.008009 Analysis completed in 1 mins 1 seconds Analysis used 59.95 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -909.52 Likelihood of best state for "cold" chain of run 2 was -909.52 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.5 % ( 66 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 28.1 % ( 25 %) Dirichlet(Pi{all}) 29.9 % ( 25 %) Slider(Pi{all}) 79.2 % ( 53 %) Multiplier(Alpha{1,2}) 78.4 % ( 63 %) Multiplier(Alpha{3}) 21.3 % ( 17 %) Slider(Pinvar{all}) 98.6 % ( 96 %) ExtSPR(Tau{all},V{all}) 70.4 % ( 71 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 93 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 21 %) Multiplier(V{all}) 97.5 % ( 98 %) Nodeslider(V{all}) 30.8 % ( 24 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.2 % ( 71 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 28.6 % ( 31 %) Dirichlet(Pi{all}) 29.8 % ( 27 %) Slider(Pi{all}) 78.3 % ( 61 %) Multiplier(Alpha{1,2}) 77.8 % ( 53 %) Multiplier(Alpha{3}) 21.2 % ( 23 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.0 % ( 69 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 33 %) Multiplier(V{all}) 97.4 % ( 96 %) Nodeslider(V{all}) 30.4 % ( 26 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166390 0.82 0.66 3 | 167233 166517 0.84 4 | 166377 167438 166045 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166794 0.83 0.67 3 | 166234 166342 0.83 4 | 166638 167057 166935 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -911.20 | 2 1 | | 1 1 1 1 1 | |1 1 2 2 | | 1 *2 2 | | 2 2 2 1 1 1 2 | | *1 1 1 2 1 2 2 2 | | 1 2 11 1 2 | | 2 2 2* 2 2 2 12 2 1 1 | |2 1 22 * 2 1 2 2 12 1 1 1 1 | | 1 2 21 2 22 1 1 *1 11 1| | 1 2 2 2 1 1 2 2 2 2 1 2 | | 2 21 1 1 1 2 2 2 | | 1 1 2 1 2 1 1 | | 1 1 2 1 2 2| | 1 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -912.68 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -911.20 -914.43 2 -911.28 -916.00 -------------------------------------- TOTAL -911.23 -915.49 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902984 0.093183 0.377322 1.472407 0.870641 1286.03 1319.25 1.000 r(A<->C){all} 0.170021 0.020927 0.000062 0.465713 0.134141 195.34 211.60 1.002 r(A<->G){all} 0.163324 0.019721 0.000071 0.449213 0.124156 239.43 268.40 1.003 r(A<->T){all} 0.157597 0.017391 0.000083 0.424753 0.121688 258.46 283.24 1.003 r(C<->G){all} 0.176440 0.022759 0.000095 0.492436 0.135039 111.43 144.83 1.000 r(C<->T){all} 0.173828 0.020621 0.000029 0.466342 0.134784 111.46 175.48 1.002 r(G<->T){all} 0.158791 0.018534 0.000020 0.433757 0.125554 147.05 215.97 1.000 pi(A){all} 0.159018 0.000187 0.130953 0.185129 0.158636 915.80 1129.90 1.000 pi(C){all} 0.323201 0.000314 0.287969 0.356461 0.323524 1081.58 1275.35 1.000 pi(G){all} 0.349612 0.000328 0.311799 0.382806 0.349183 1215.05 1291.80 1.001 pi(T){all} 0.168169 0.000205 0.140139 0.195731 0.167742 1251.74 1321.15 1.000 alpha{1,2} 0.438181 0.243597 0.000109 1.481592 0.259960 1188.72 1210.77 1.003 alpha{3} 0.448864 0.227720 0.000256 1.455069 0.293928 1138.68 1282.38 1.000 pinvar{all} 0.997726 0.000007 0.992220 1.000000 0.998601 1088.49 1154.61 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .***.* 8 -- .**... 9 -- .****. 10 -- ..**** 11 -- ..*..* 12 -- .*.*.. 13 -- ...*.* 14 -- .*..*. 15 -- ....** 16 -- ...**. 17 -- .*.*** 18 -- ..*.*. 19 -- ..**.. 20 -- .**.** 21 -- .*...* 22 -- ...*** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 486 0.161892 0.015075 0.151233 0.172552 2 8 484 0.161226 0.010364 0.153897 0.168554 2 9 445 0.148235 0.005182 0.144570 0.151899 2 10 443 0.147568 0.007066 0.142572 0.152565 2 11 442 0.147235 0.001884 0.145903 0.148568 2 12 435 0.144903 0.000471 0.144570 0.145237 2 13 425 0.141572 0.012719 0.132578 0.150566 2 14 422 0.140573 0.006595 0.135909 0.145237 2 15 422 0.140573 0.000000 0.140573 0.140573 2 16 419 0.139574 0.011777 0.131246 0.147901 2 17 418 0.139241 0.009422 0.132578 0.145903 2 18 409 0.136243 0.011777 0.127915 0.144570 2 19 401 0.133578 0.004240 0.130580 0.136576 2 20 394 0.131246 0.013191 0.121919 0.140573 2 21 387 0.128914 0.006124 0.124584 0.133245 2 22 276 0.091939 0.012248 0.083278 0.100600 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.101063 0.010827 0.000033 0.302309 0.069854 1.002 2 length{all}[2] 0.098945 0.009804 0.000007 0.302747 0.067912 1.002 2 length{all}[3] 0.102869 0.010370 0.000079 0.308556 0.072574 1.001 2 length{all}[4] 0.097346 0.009565 0.000033 0.296460 0.066102 1.000 2 length{all}[5] 0.099439 0.009625 0.000004 0.296404 0.069007 1.000 2 length{all}[6] 0.100864 0.010445 0.000007 0.302043 0.069678 1.000 2 length{all}[7] 0.092047 0.007881 0.000032 0.261501 0.066195 1.003 2 length{all}[8] 0.101826 0.011152 0.000262 0.317364 0.068450 1.000 2 length{all}[9] 0.101928 0.009250 0.000099 0.300586 0.074407 0.999 2 length{all}[10] 0.101739 0.010314 0.000035 0.292388 0.069669 0.999 2 length{all}[11] 0.105552 0.012891 0.000032 0.321013 0.067960 1.005 2 length{all}[12] 0.104043 0.012452 0.000404 0.320247 0.069964 0.998 2 length{all}[13] 0.091125 0.008213 0.000314 0.257463 0.063881 0.998 2 length{all}[14] 0.093933 0.009546 0.000425 0.302341 0.065362 1.000 2 length{all}[15] 0.097245 0.010240 0.000114 0.305860 0.063123 0.998 2 length{all}[16] 0.103605 0.010476 0.000203 0.292677 0.071357 0.998 2 length{all}[17] 0.096793 0.009089 0.000015 0.299524 0.065368 1.004 2 length{all}[18] 0.096595 0.011305 0.000209 0.314229 0.057770 0.998 2 length{all}[19] 0.105214 0.012863 0.000031 0.334601 0.067013 1.001 2 length{all}[20] 0.093865 0.009746 0.000526 0.280639 0.062771 1.005 2 length{all}[21] 0.105591 0.010934 0.000061 0.304773 0.076102 0.998 2 length{all}[22] 0.109066 0.009973 0.000376 0.309394 0.079148 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008009 Maximum standard deviation of split frequencies = 0.015075 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.005 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /--------------------------------------------------------------------- C1 (1) | |------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------ C4 (4) | |-------------------------------------------------------------------- C5 (5) | \--------------------------------------------------------------------- C6 (6) |--------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 687 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 49 patterns at 229 / 229 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 49 patterns at 229 / 229 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 47824 bytes for conP 4312 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.082296 0.100058 0.092066 0.052684 0.079947 0.072044 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -995.543680 Iterating by ming2 Initial: fx= 995.543680 x= 0.08230 0.10006 0.09207 0.05268 0.07995 0.07204 0.30000 1.30000 1 h-m-p 0.0000 0.0002 545.7159 +++ 925.137783 m 0.0002 14 | 1/8 2 h-m-p 0.0010 0.0049 66.1624 -----------.. | 1/8 3 h-m-p 0.0000 0.0001 502.6704 ++ 903.172102 m 0.0001 45 | 2/8 4 h-m-p 0.0010 0.0089 39.3085 -----------.. | 2/8 5 h-m-p 0.0000 0.0000 450.9798 ++ 895.951965 m 0.0000 76 | 3/8 6 h-m-p 0.0005 0.0135 27.5059 -----------.. | 3/8 7 h-m-p 0.0000 0.0000 390.9340 ++ 894.339508 m 0.0000 107 | 4/8 8 h-m-p 0.0002 0.0190 20.1751 ----------.. | 4/8 9 h-m-p 0.0000 0.0000 319.0590 ++ 889.859967 m 0.0000 137 | 5/8 10 h-m-p 0.0007 0.0294 13.2901 -----------.. | 5/8 11 h-m-p 0.0000 0.0000 225.8577 ++ 888.021536 m 0.0000 168 | 6/8 12 h-m-p 1.6000 8.0000 0.0000 --C 888.021536 0 0.0250 181 | 6/8 13 h-m-p 1.3684 8.0000 0.0000 -C 888.021536 0 0.0855 195 Out.. lnL = -888.021536 196 lfun, 196 eigenQcodon, 1176 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.055532 0.059394 0.108870 0.076288 0.088099 0.016544 0.299791 0.782494 0.556652 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.225421 np = 9 lnL0 = -978.454054 Iterating by ming2 Initial: fx= 978.454054 x= 0.05553 0.05939 0.10887 0.07629 0.08810 0.01654 0.29979 0.78249 0.55665 1 h-m-p 0.0000 0.0001 540.5827 ++ 956.706633 m 0.0001 14 | 1/9 2 h-m-p 0.0001 0.0006 316.9342 ++ 913.096158 m 0.0006 26 | 2/9 3 h-m-p 0.0000 0.0000 78337932996516.8594 h-m-p: 4.60765958e-17 2.30382979e-16 7.83379330e+13 913.096158 .. | 2/9 4 h-m-p 0.0000 0.0000 446.6676 ++ 909.628128 m 0.0000 47 | 3/9 5 h-m-p 0.0001 0.0029 73.2746 +++ 897.874706 m 0.0029 60 | 4/9 6 h-m-p 0.0000 0.0001 923.4514 ++ 893.140746 m 0.0001 72 | 5/9 7 h-m-p 0.0000 0.0001 1397.6233 ++ 889.412579 m 0.0001 84 | 5/9 8 h-m-p 0.0047 0.0274 37.7871 ------------.. | 5/9 9 h-m-p 0.0000 0.0000 226.1898 ++ 888.021563 m 0.0000 118 | 6/9 10 h-m-p 0.0160 8.0000 0.0000 +++++ 888.021563 m 8.0000 133 | 6/9 11 h-m-p 0.0303 8.0000 0.0111 +++++ 888.021560 m 8.0000 151 | 6/9 12 h-m-p 0.2571 2.9427 0.3456 ++ 888.021547 m 2.9427 166 | 7/9 13 h-m-p 0.3223 1.6114 0.4345 ++ 888.021535 m 1.6114 181 | 8/9 14 h-m-p 1.6000 8.0000 0.0000 N 888.021535 0 1.6000 195 | 8/9 15 h-m-p 0.0160 8.0000 0.0000 C 888.021535 0 0.0160 208 Out.. lnL = -888.021535 209 lfun, 627 eigenQcodon, 2508 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.015408 0.057786 0.037829 0.063311 0.047899 0.080588 0.000100 1.262451 0.130358 0.335063 1.536745 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 10.159936 np = 11 lnL0 = -953.698374 Iterating by ming2 Initial: fx= 953.698374 x= 0.01541 0.05779 0.03783 0.06331 0.04790 0.08059 0.00011 1.26245 0.13036 0.33506 1.53675 1 h-m-p 0.0000 0.0000 510.7073 ++ 952.300271 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0005 209.0802 +++ 932.816661 m 0.0005 31 | 2/11 3 h-m-p 0.0001 0.0003 204.1022 ++ 911.603688 m 0.0003 45 | 3/11 4 h-m-p 0.0005 0.0027 57.0371 ++ 898.347110 m 0.0027 59 | 4/11 5 h-m-p 0.0000 0.0000 6751.2423 ++ 895.248616 m 0.0000 73 | 5/11 6 h-m-p 0.0004 0.0021 8.5132 ----------.. | 5/11 7 h-m-p 0.0000 0.0000 382.4434 ++ 892.563936 m 0.0000 109 | 6/11 8 h-m-p 0.0160 8.0000 3.7552 -------------.. | 6/11 9 h-m-p 0.0000 0.0000 314.9794 ++ 890.801501 m 0.0000 148 | 7/11 10 h-m-p 0.0160 8.0000 2.2890 -------------.. | 7/11 11 h-m-p 0.0000 0.0001 223.7135 ++ 888.021553 m 0.0001 187 | 8/11 12 h-m-p 0.0400 8.0000 0.0000 ++++ 888.021553 m 8.0000 203 | 8/11 13 h-m-p 0.0160 8.0000 0.0122 -------C 888.021553 0 0.0000 227 | 8/11 14 h-m-p 0.0160 8.0000 0.0108 +++++ 888.021551 m 8.0000 247 | 8/11 15 h-m-p 0.0449 8.0000 1.9315 +++Y 888.021534 0 2.8712 267 | 8/11 16 h-m-p 1.6000 8.0000 0.1396 ++ 888.021533 m 8.0000 281 | 8/11 17 h-m-p 0.6891 8.0000 1.6202 Y 888.021533 0 0.6891 298 | 8/11 18 h-m-p 1.6000 8.0000 0.4523 C 888.021533 0 0.6001 312 | 8/11 19 h-m-p 1.6000 8.0000 0.0223 C 888.021533 0 1.3670 329 | 8/11 20 h-m-p 1.6000 8.0000 0.0003 C 888.021533 0 0.6250 346 | 8/11 21 h-m-p 1.0643 8.0000 0.0002 --Y 888.021533 0 0.0166 365 | 8/11 22 h-m-p 1.6000 8.0000 0.0000 N 888.021533 0 0.4000 382 | 8/11 23 h-m-p 0.0296 8.0000 0.0000 Y 888.021533 0 0.0296 399 | 8/11 24 h-m-p 0.0388 8.0000 0.0000 N 888.021533 0 0.0097 416 | 8/11 25 h-m-p 0.0160 8.0000 0.0592 +C 888.021533 0 0.0824 434 | 8/11 26 h-m-p 1.6000 8.0000 0.0007 Y 888.021533 0 0.4000 451 | 8/11 27 h-m-p 1.6000 8.0000 0.0002 N 888.021533 0 0.8000 468 | 8/11 28 h-m-p 0.9205 8.0000 0.0002 ----C 888.021533 0 0.0009 489 | 8/11 29 h-m-p 0.9048 8.0000 0.0000 ---Y 888.021533 0 0.0035 509 Out.. lnL = -888.021533 510 lfun, 2040 eigenQcodon, 9180 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -888.026966 S = -888.017653 -0.003562 Calculating f(w|X), posterior probabilities of site classes. did 10 / 49 patterns 0:03 did 20 / 49 patterns 0:03 did 30 / 49 patterns 0:03 did 40 / 49 patterns 0:03 did 49 / 49 patterns 0:03 Time used: 0:03 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.079155 0.062721 0.097207 0.018549 0.088775 0.029604 0.000100 0.291601 1.794594 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 21.559682 np = 9 lnL0 = -969.692265 Iterating by ming2 Initial: fx= 969.692265 x= 0.07915 0.06272 0.09721 0.01855 0.08878 0.02960 0.00011 0.29160 1.79459 1 h-m-p 0.0000 0.0000 511.1085 ++ 969.164272 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0116 42.6378 +++++ 959.896693 m 0.0116 29 | 2/9 3 h-m-p 0.0001 0.0004 202.7488 ++ 945.025691 m 0.0004 41 | 3/9 4 h-m-p 0.0012 0.0062 19.8753 -----------.. | 3/9 5 h-m-p 0.0000 0.0002 425.8549 +++ 909.073529 m 0.0002 75 | 4/9 6 h-m-p 0.0035 0.0357 20.5611 ------------.. | 4/9 7 h-m-p 0.0000 0.0001 383.2778 ++ 895.575140 m 0.0001 109 | 5/9 8 h-m-p 0.0048 0.1357 5.8695 ------------.. | 5/9 9 h-m-p 0.0000 0.0001 317.7131 ++ 890.317115 m 0.0001 143 | 6/9 10 h-m-p 0.0059 1.0901 1.9674 ------------.. | 6/9 11 h-m-p 0.0000 0.0000 226.0547 ++ 888.021561 m 0.0000 177 | 7/9 12 h-m-p 0.0972 8.0000 0.0000 ++++ 888.021561 m 8.0000 191 | 7/9 13 h-m-p 0.0302 8.0000 0.0010 +++++ 888.021561 m 8.0000 208 | 7/9 14 h-m-p 0.0160 8.0000 0.7714 +++++ 888.021557 m 8.0000 225 | 7/9 15 h-m-p 1.6000 8.0000 0.2385 ++ 888.021556 m 8.0000 239 | 7/9 16 h-m-p 0.5702 8.0000 3.3458 ++ 888.021556 m 8.0000 253 | 7/9 17 h-m-p 1.6000 8.0000 1.9779 ++ 888.021556 m 8.0000 265 | 7/9 18 h-m-p 0.7473 3.7365 13.9042 --------Y 888.021556 0 0.0000 285 | 7/9 19 h-m-p 0.0993 8.0000 0.0004 ++++ 888.021556 m 8.0000 299 | 7/9 20 h-m-p 1.6000 8.0000 0.0002 C 888.021556 0 0.4000 313 | 7/9 21 h-m-p 0.2185 8.0000 0.0003 ----Y 888.021556 0 0.0002 331 Out.. lnL = -888.021556 332 lfun, 3652 eigenQcodon, 19920 P(t) Time used: 0:08 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.094360 0.038608 0.052697 0.082033 0.091689 0.088753 0.000100 0.900000 1.002828 1.522335 1.300098 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 12.517343 np = 11 lnL0 = -983.929208 Iterating by ming2 Initial: fx= 983.929208 x= 0.09436 0.03861 0.05270 0.08203 0.09169 0.08875 0.00011 0.90000 1.00283 1.52233 1.30010 1 h-m-p 0.0000 0.0000 496.5792 ++ 983.255271 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0010 241.7561 ++++ 934.633931 m 0.0010 32 | 2/11 3 h-m-p 0.0000 0.0001 1208.0002 ++ 919.458179 m 0.0001 46 | 3/11 4 h-m-p 0.0010 0.0103 60.5414 ++ 896.606164 m 0.0103 60 | 4/11 5 h-m-p 0.0000 0.0000 1040632.9449 ++ 890.840014 m 0.0000 74 | 5/11 6 h-m-p 0.0002 0.0010 654.8636 ++ 888.478540 m 0.0010 88 | 6/11 7 h-m-p 0.0000 0.0000 47657.9307 ++ 888.326675 m 0.0000 102 | 6/11 8 h-m-p 0.0003 0.0062 337.1769 ----------.. | 6/11 9 h-m-p 0.0000 0.0000 225.5841 ++ 888.021529 m 0.0000 138 | 7/11 10 h-m-p 0.0000 0.0002 0.0000 Y 888.021529 0 0.0000 152 Out.. lnL = -888.021529 153 lfun, 1836 eigenQcodon, 10098 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -888.027495 S = -888.017391 -0.004432 Calculating f(w|X), posterior probabilities of site classes. did 10 / 49 patterns 0:11 did 20 / 49 patterns 0:11 did 30 / 49 patterns 0:12 did 40 / 49 patterns 0:12 did 49 / 49 patterns 0:12 Time used: 0:12 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=229 NC_011896_1_WP_010907646_1_291_MLBR_RS01420 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP NC_002677_1_NP_301322_1_194_ML0281 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP ************************************************** NC_011896_1_WP_010907646_1_291_MLBR_RS01420 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR NC_002677_1_NP_301322_1_194_ML0281 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR ************************************************** NC_011896_1_WP_010907646_1_291_MLBR_RS01420 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP NC_002677_1_NP_301322_1_194_ML0281 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP ************************************************** NC_011896_1_WP_010907646_1_291_MLBR_RS01420 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV NC_002677_1_NP_301322_1_194_ML0281 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV ************************************************** NC_011896_1_WP_010907646_1_291_MLBR_RS01420 AVVRDGVPTRRRERRSTFYRNVEGWMLVR NC_002677_1_NP_301322_1_194_ML0281 AVVRDGVPTRRRERRSTFYRNVEGWMLVR NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 AVVRDGVPTRRRERRSTFYRNVEGWMLVR NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 AVVRDGVPTRRRERRSTFYRNVEGWMLVR NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 AVVRDGVPTRRRERRSTFYRNVEGWMLVR NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 AVVRDGVPTRRRERRSTFYRNVEGWMLVR *****************************
>NC_011896_1_WP_010907646_1_291_MLBR_RS01420 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NC_002677_1_NP_301322_1_194_ML0281 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
>NC_011896_1_WP_010907646_1_291_MLBR_RS01420 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NC_002677_1_NP_301322_1_194_ML0281 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR
#NEXUS [ID: 0409461546] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907646_1_291_MLBR_RS01420 NC_002677_1_NP_301322_1_194_ML0281 NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 ; end; begin trees; translate 1 NC_011896_1_WP_010907646_1_291_MLBR_RS01420, 2 NC_002677_1_NP_301322_1_194_ML0281, 3 NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380, 4 NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505, 5 NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510, 6 NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06985367,2:0.06791181,3:0.07257429,4:0.06610218,5:0.06900685,6:0.06967838); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06985367,2:0.06791181,3:0.07257429,4:0.06610218,5:0.06900685,6:0.06967838); end;
Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -911.20 -914.43 2 -911.28 -916.00 -------------------------------------- TOTAL -911.23 -915.49 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902984 0.093183 0.377322 1.472407 0.870641 1286.03 1319.25 1.000 r(A<->C){all} 0.170021 0.020927 0.000062 0.465713 0.134141 195.34 211.60 1.002 r(A<->G){all} 0.163324 0.019721 0.000071 0.449213 0.124156 239.43 268.40 1.003 r(A<->T){all} 0.157597 0.017391 0.000083 0.424753 0.121688 258.46 283.24 1.003 r(C<->G){all} 0.176440 0.022759 0.000095 0.492436 0.135039 111.43 144.83 1.000 r(C<->T){all} 0.173828 0.020621 0.000029 0.466342 0.134784 111.46 175.48 1.002 r(G<->T){all} 0.158791 0.018534 0.000020 0.433757 0.125554 147.05 215.97 1.000 pi(A){all} 0.159018 0.000187 0.130953 0.185129 0.158636 915.80 1129.90 1.000 pi(C){all} 0.323201 0.000314 0.287969 0.356461 0.323524 1081.58 1275.35 1.000 pi(G){all} 0.349612 0.000328 0.311799 0.382806 0.349183 1215.05 1291.80 1.001 pi(T){all} 0.168169 0.000205 0.140139 0.195731 0.167742 1251.74 1321.15 1.000 alpha{1,2} 0.438181 0.243597 0.000109 1.481592 0.259960 1188.72 1210.77 1.003 alpha{3} 0.448864 0.227720 0.000256 1.455069 0.293928 1138.68 1282.38 1.000 pinvar{all} 0.997726 0.000007 0.992220 1.000000 0.998601 1088.49 1154.61 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0281/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 229 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0 TTC 2 2 2 2 2 2 | TCC 4 4 4 4 4 4 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0 Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 4 4 4 4 4 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3 CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 2 2 2 2 2 2 | CGC 9 9 9 9 9 9 CTA 2 2 2 2 2 2 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 11 11 11 11 11 11 CTG 10 10 10 10 10 10 | CCG 10 10 10 10 10 10 | CAG 2 2 2 2 2 2 | CGG 10 10 10 10 10 10 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0 ATC 7 7 7 7 7 7 | ACC 10 10 10 10 10 10 | AAC 3 3 3 3 3 3 | AGC 3 3 3 3 3 3 ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0 Met ATG 2 2 2 2 2 2 | ACG 6 6 6 6 6 6 | AAG 0 0 0 0 0 0 | AGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 4 4 4 4 4 4 | Gly GGT 5 5 5 5 5 5 GTC 8 8 8 8 8 8 | GCC 8 8 8 8 8 8 | GAC 15 15 15 15 15 15 | GGC 16 16 16 16 16 16 GTA 4 4 4 4 4 4 | GCA 4 4 4 4 4 4 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1 GTG 9 9 9 9 9 9 | GCG 9 9 9 9 9 9 | GAG 4 4 4 4 4 4 | GGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907646_1_291_MLBR_RS01420 position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485 position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694 position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061 Average T:0.16739 C:0.32314 A:0.15866 G:0.35080 #2: NC_002677_1_NP_301322_1_194_ML0281 position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485 position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694 position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061 Average T:0.16739 C:0.32314 A:0.15866 G:0.35080 #3: NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485 position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694 position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061 Average T:0.16739 C:0.32314 A:0.15866 G:0.35080 #4: NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485 position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694 position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061 Average T:0.16739 C:0.32314 A:0.15866 G:0.35080 #5: NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485 position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694 position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061 Average T:0.16739 C:0.32314 A:0.15866 G:0.35080 #6: NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485 position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694 position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061 Average T:0.16739 C:0.32314 A:0.15866 G:0.35080 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0 TTC 12 | TCC 24 | TAC 24 | TGC 0 Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0 TTG 24 | TCG 12 | TAG 0 | Trp W TGG 30 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 18 CTC 12 | CCC 12 | CAC 12 | CGC 54 CTA 12 | CCA 0 | Gln Q CAA 12 | CGA 66 CTG 60 | CCG 60 | CAG 12 | CGG 60 ------------------------------------------------------------------------------ Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 0 ATC 42 | ACC 60 | AAC 18 | AGC 18 ATA 12 | ACA 0 | Lys K AAA 0 | Arg R AGA 0 Met M ATG 12 | ACG 36 | AAG 0 | AGG 18 ------------------------------------------------------------------------------ Val V GTT 18 | Ala A GCT 12 | Asp D GAT 24 | Gly G GGT 30 GTC 48 | GCC 48 | GAC 90 | GGC 96 GTA 24 | GCA 24 | Glu E GAA 6 | GGA 6 GTG 54 | GCG 54 | GAG 24 | GGG 12 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485 position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694 position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061 Average T:0.16739 C:0.32314 A:0.15866 G:0.35080 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -888.021536 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299791 1.300098 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29979 omega (dN/dS) = 1.30010 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0 7..2 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0 7..3 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0 7..4 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0 7..5 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0 7..6 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -888.021535 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.706270 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.70627 0.29373 w: 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -888.021533 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.023251 0.796345 0.000001 1.508825 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.02325 0.79635 0.18040 w: 0.00000 1.00000 1.50883 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0 7..2 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0 7..3 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0 7..4 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0 7..5 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0 7..6 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907646_1_291_MLBR_RS01420) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907646_1_291_MLBR_RS01420) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:03 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -888.021556 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 29.512351 43.166096 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 29.51235 q = 43.16610 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.31338 0.34647 0.36669 0.38308 0.39795 0.41248 0.42758 0.44451 0.46581 0.50172 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0 7..2 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0 7..3 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0 7..4 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0 7..5 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0 7..6 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0 Time used: 0:08 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -888.021529 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.479420 0.005000 1.957401 2.606790 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.47942 p = 0.00500 q = 1.95740 (p1 = 0.52058) w = 2.60679 MLEs of dN/dS (w) for site classes (K=11) p: 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.52058 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.60679 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0 7..2 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0 7..3 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0 7..4 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0 7..5 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0 7..6 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907646_1_291_MLBR_RS01420) Pr(w>1) post mean +- SE for w 1 L 0.521 1.357 2 N 0.521 1.357 3 T 0.521 1.357 4 S 0.521 1.357 5 D 0.521 1.357 6 S 0.521 1.357 7 A 0.521 1.357 8 P 0.521 1.357 9 G 0.521 1.357 10 V 0.521 1.357 11 A 0.521 1.357 12 V 0.521 1.357 13 L 0.521 1.357 14 L 0.521 1.357 15 F 0.521 1.357 16 G 0.521 1.357 17 D 0.521 1.357 18 D 0.521 1.357 19 R 0.521 1.357 20 T 0.521 1.357 21 R 0.521 1.357 22 Q 0.521 1.357 23 R 0.521 1.357 24 W 0.521 1.357 25 N 0.521 1.357 26 T 0.521 1.357 27 L 0.521 1.357 28 T 0.521 1.357 29 A 0.521 1.357 30 L 0.521 1.357 31 S 0.521 1.357 32 T 0.521 1.357 33 Y 0.521 1.357 34 R 0.521 1.357 35 A 0.521 1.357 36 G 0.521 1.357 37 G 0.521 1.357 38 P 0.521 1.357 39 D 0.521 1.357 40 D 0.521 1.357 41 I 0.521 1.357 42 D 0.521 1.357 43 S 0.521 1.357 44 I 0.521 1.357 45 D 0.521 1.357 46 A 0.521 1.357 47 T 0.521 1.357 48 I 0.521 1.357 49 G 0.521 1.357 50 P 0.521 1.357 51 Y 0.521 1.357 52 R 0.521 1.357 53 R 0.521 1.357 54 L 0.521 1.357 55 V 0.521 1.357 56 V 0.521 1.357 57 V 0.521 1.357 58 G 0.521 1.357 59 G 0.521 1.357 60 D 0.521 1.357 61 G 0.521 1.357 62 D 0.521 1.357 63 L 0.521 1.357 64 A 0.521 1.357 65 A 0.521 1.357 66 V 0.521 1.357 67 L 0.521 1.357 68 G 0.521 1.357 69 R 0.521 1.357 70 L 0.521 1.357 71 L 0.521 1.357 72 R 0.521 1.357 73 A 0.521 1.357 74 D 0.521 1.357 75 R 0.521 1.357 76 L 0.521 1.357 77 D 0.521 1.357 78 I 0.521 1.357 79 E 0.521 1.357 80 V 0.521 1.357 81 A 0.521 1.357 82 Y 0.521 1.357 83 V 0.521 1.357 84 P 0.521 1.357 85 H 0.521 1.357 86 Q 0.521 1.357 87 R 0.521 1.357 88 T 0.521 1.357 89 A 0.521 1.357 90 A 0.521 1.357 91 T 0.521 1.357 92 R 0.521 1.357 93 V 0.521 1.357 94 Y 0.521 1.357 95 R 0.521 1.357 96 L 0.521 1.357 97 P 0.521 1.357 98 T 0.521 1.357 99 G 0.521 1.357 100 R 0.521 1.357 101 R 0.521 1.357 102 A 0.521 1.357 103 A 0.521 1.357 104 R 0.521 1.357 105 R 0.521 1.357 106 A 0.521 1.357 107 R 0.521 1.357 108 R 0.521 1.357 109 G 0.521 1.357 110 Y 0.521 1.357 111 A 0.521 1.357 112 T 0.521 1.357 113 R 0.521 1.357 114 V 0.521 1.357 115 P 0.521 1.357 116 L 0.521 1.357 117 I 0.521 1.357 118 R 0.521 1.357 119 D 0.521 1.357 120 E 0.521 1.357 121 T 0.521 1.357 122 G 0.521 1.357 123 S 0.521 1.357 124 V 0.521 1.357 125 I 0.521 1.357 126 V 0.521 1.357 127 G 0.521 1.357 128 R 0.521 1.357 129 A 0.521 1.357 130 D 0.521 1.357 131 W 0.521 1.357 132 L 0.521 1.357 133 P 0.521 1.357 134 V 0.521 1.357 135 V 0.521 1.357 136 D 0.521 1.357 137 R 0.521 1.357 138 Q 0.521 1.357 139 P 0.521 1.357 140 L 0.521 1.357 141 H 0.521 1.357 142 G 0.521 1.357 143 E 0.521 1.357 144 A 0.521 1.357 145 I 0.521 1.357 146 V 0.521 1.357 147 D 0.521 1.357 148 D 0.521 1.357 149 I 0.521 1.357 150 P 0.521 1.357 151 L 0.521 1.357 152 F 0.521 1.357 153 D 0.521 1.357 154 G 0.521 1.357 155 D 0.521 1.357 156 V 0.521 1.357 157 A 0.521 1.357 158 G 0.521 1.357 159 V 0.521 1.357 160 R 0.521 1.357 161 I 0.521 1.357 162 A 0.521 1.357 163 P 0.521 1.357 164 T 0.521 1.357 165 L 0.521 1.357 166 A 0.521 1.357 167 M 0.521 1.357 168 P 0.521 1.357 169 G 0.521 1.357 170 L 0.521 1.357 171 R 0.521 1.357 172 A 0.521 1.357 173 R 0.521 1.357 174 L 0.521 1.357 175 H 0.521 1.357 176 T 0.521 1.357 177 S 0.521 1.357 178 R 0.521 1.357 179 T 0.521 1.357 180 G 0.521 1.357 181 I 0.521 1.357 182 G 0.521 1.357 183 I 0.521 1.357 184 W 0.521 1.357 185 S 0.521 1.357 186 R 0.521 1.357 187 W 0.521 1.357 188 L 0.521 1.357 189 T 0.521 1.357 190 G 0.521 1.357 191 R 0.521 1.357 192 A 0.521 1.357 193 V 0.521 1.357 194 Q 0.521 1.357 195 L 0.521 1.357 196 G 0.521 1.357 197 S 0.521 1.357 198 T 0.521 1.357 199 G 0.521 1.357 200 V 0.521 1.357 201 A 0.521 1.357 202 V 0.521 1.357 203 V 0.521 1.357 204 R 0.521 1.357 205 D 0.521 1.357 206 G 0.521 1.357 207 V 0.521 1.357 208 P 0.521 1.357 209 T 0.521 1.357 210 R 0.521 1.357 211 R 0.521 1.357 212 R 0.521 1.357 213 E 0.521 1.357 214 R 0.521 1.357 215 R 0.521 1.357 216 S 0.521 1.357 217 T 0.521 1.357 218 F 0.521 1.357 219 Y 0.521 1.357 220 R 0.521 1.357 221 N 0.521 1.357 222 V 0.521 1.357 223 E 0.521 1.357 224 G 0.521 1.357 225 W 0.521 1.357 226 M 0.521 1.357 227 L 0.521 1.357 228 V 0.521 1.357 229 R 0.521 1.357 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907646_1_291_MLBR_RS01420) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099 Time used: 0:12
Model 1: NearlyNeutral -888.021535 Model 2: PositiveSelection -888.021533 Model 0: one-ratio -888.021536 Model 7: beta -888.021556 Model 8: beta&w>1 -888.021529 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 5.400000009103678E-5