--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 16:30:02 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0281/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -911.20 -914.43 2 -911.28 -916.00 -------------------------------------- TOTAL -911.23 -915.49 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.902984 0.093183 0.377322 1.472407 0.870641 1286.03 1319.25 1.000 r(A<->C){all} 0.170021 0.020927 0.000062 0.465713 0.134141 195.34 211.60 1.002 r(A<->G){all} 0.163324 0.019721 0.000071 0.449213 0.124156 239.43 268.40 1.003 r(A<->T){all} 0.157597 0.017391 0.000083 0.424753 0.121688 258.46 283.24 1.003 r(C<->G){all} 0.176440 0.022759 0.000095 0.492436 0.135039 111.43 144.83 1.000 r(C<->T){all} 0.173828 0.020621 0.000029 0.466342 0.134784 111.46 175.48 1.002 r(G<->T){all} 0.158791 0.018534 0.000020 0.433757 0.125554 147.05 215.97 1.000 pi(A){all} 0.159018 0.000187 0.130953 0.185129 0.158636 915.80 1129.90 1.000 pi(C){all} 0.323201 0.000314 0.287969 0.356461 0.323524 1081.58 1275.35 1.000 pi(G){all} 0.349612 0.000328 0.311799 0.382806 0.349183 1215.05 1291.80 1.001 pi(T){all} 0.168169 0.000205 0.140139 0.195731 0.167742 1251.74 1321.15 1.000 alpha{1,2} 0.438181 0.243597 0.000109 1.481592 0.259960 1188.72 1210.77 1.003 alpha{3} 0.448864 0.227720 0.000256 1.455069 0.293928 1138.68 1282.38 1.000 pinvar{all} 0.997726 0.000007 0.992220 1.000000 0.998601 1088.49 1154.61 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -888.021535 Model 2: PositiveSelection -888.021533 Model 0: one-ratio -888.021536 Model 7: beta -888.021556 Model 8: beta&w>1 -888.021529 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 5.400000009103678E-5
>C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=229 C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP ************************************************** C1 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C2 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C3 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C4 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C5 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C6 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR ************************************************** C1 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C2 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C3 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C4 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C5 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C6 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP ************************************************** C1 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C2 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C3 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C4 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C5 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C6 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV ************************************************** C1 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C2 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C3 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C4 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C5 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C6 AVVRDGVPTRRRERRSTFYRNVEGWMLVR ***************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6870] Library Relaxation: Multi_proc [96] Relaxation Summary: [6870]--->[6870] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.488 Mb, Max= 30.778 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP ************************************************** C1 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C2 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C3 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C4 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C5 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR C6 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR ************************************************** C1 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C2 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C3 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C4 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C5 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP C6 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP ************************************************** C1 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C2 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C3 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C4 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C5 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV C6 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV ************************************************** C1 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C2 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C3 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C4 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C5 AVVRDGVPTRRRERRSTFYRNVEGWMLVR C6 AVVRDGVPTRRRERRSTFYRNVEGWMLVR ***************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C2 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C3 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C4 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C5 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA C6 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA ************************************************** C1 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C2 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C3 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C4 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C5 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC C6 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC ************************************************** C1 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C2 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C3 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C4 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C5 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG C6 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG ************************************************** C1 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C2 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C3 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C4 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C5 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT C6 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT ************************************************** C1 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C2 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C3 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C4 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C5 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC C6 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC ************************************************** C1 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C2 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C3 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C4 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C5 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC C6 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC ************************************************** C1 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C2 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C3 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C4 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C5 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT C6 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT ************************************************** C1 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C2 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C3 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C4 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C5 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG C6 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG ************************************************** C1 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C2 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C3 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C4 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C5 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG C6 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG ************************************************** C1 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C2 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C3 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C4 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C5 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT C6 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT ************************************************** C1 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C2 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C3 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C4 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C5 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT C6 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT ************************************************** C1 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C2 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C3 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C4 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C5 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC C6 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC ************************************************** C1 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C2 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C3 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C4 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C5 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC C6 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC ************************************************** C1 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C2 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C3 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C4 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C5 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG C6 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG ************************************* >C1 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C2 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C3 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C4 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C5 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C6 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 687 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579796927 Setting output file names to "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 299928934 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0409461546 Seed = 2062896686 Swapseed = 1579796927 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1537.538934 -- -24.965149 Chain 2 -- -1537.538934 -- -24.965149 Chain 3 -- -1537.538934 -- -24.965149 Chain 4 -- -1537.538700 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1537.538934 -- -24.965149 Chain 2 -- -1537.538846 -- -24.965149 Chain 3 -- -1537.538700 -- -24.965149 Chain 4 -- -1537.538846 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1537.539] (-1537.539) (-1537.539) (-1537.539) * [-1537.539] (-1537.539) (-1537.539) (-1537.539) 500 -- (-925.911) (-958.462) (-918.410) [-935.968] * [-942.271] (-934.767) (-937.791) (-942.034) -- 0:00:00 1000 -- [-918.722] (-932.088) (-927.883) (-920.798) * [-928.223] (-924.709) (-942.473) (-916.184) -- 0:00:00 1500 -- (-930.715) (-926.402) [-916.513] (-918.388) * (-916.133) (-926.106) (-936.127) [-921.655] -- 0:00:00 2000 -- (-921.812) (-928.304) (-924.207) [-918.360] * [-920.531] (-924.288) (-918.499) (-916.713) -- 0:00:00 2500 -- (-918.295) [-917.265] (-921.672) (-925.333) * (-924.967) (-919.785) (-919.630) [-916.276] -- 0:00:00 3000 -- (-920.424) (-915.803) (-924.285) [-922.634] * [-921.313] (-918.950) (-920.575) (-922.067) -- 0:00:00 3500 -- (-912.894) (-928.754) (-925.539) [-914.906] * (-918.569) [-920.278] (-916.709) (-920.004) -- 0:00:00 4000 -- (-920.294) (-914.427) (-925.139) [-921.832] * (-923.319) (-919.654) [-916.777] (-922.233) -- 0:00:00 4500 -- (-918.434) (-922.689) [-916.552] (-921.745) * (-918.311) [-920.274] (-918.480) (-922.339) -- 0:00:00 5000 -- (-920.446) (-916.597) [-920.812] (-919.018) * (-924.044) (-922.411) [-921.913] (-924.288) -- 0:00:00 Average standard deviation of split frequencies: 0.091662 5500 -- (-918.858) (-921.761) [-915.882] (-922.467) * (-922.595) (-921.933) [-930.063] (-917.958) -- 0:00:00 6000 -- (-919.751) (-920.952) [-924.037] (-921.619) * [-919.701] (-917.017) (-917.035) (-924.548) -- 0:00:00 6500 -- [-919.436] (-917.091) (-919.369) (-924.101) * [-919.877] (-926.639) (-917.255) (-922.518) -- 0:00:00 7000 -- (-922.438) (-917.120) (-917.629) [-926.528] * (-912.700) (-916.628) (-925.032) [-920.247] -- 0:00:00 7500 -- (-922.252) (-921.799) (-924.406) [-919.993] * (-923.755) (-921.457) (-919.373) [-916.359] -- 0:00:00 8000 -- [-916.687] (-924.243) (-921.831) (-920.736) * [-930.446] (-925.824) (-925.878) (-918.222) -- 0:00:00 8500 -- (-918.218) [-924.772] (-922.967) (-923.005) * (-925.421) (-918.885) (-923.522) [-915.915] -- 0:00:00 9000 -- (-927.881) (-918.947) [-929.824] (-920.858) * (-927.194) (-923.133) [-918.963] (-916.913) -- 0:01:50 9500 -- (-931.498) (-918.926) [-925.188] (-922.174) * (-926.089) (-925.157) (-926.864) [-919.328] -- 0:01:44 10000 -- (-923.730) (-918.946) (-923.021) [-916.154] * (-918.950) (-917.827) (-928.749) [-920.131] -- 0:01:39 Average standard deviation of split frequencies: 0.067344 10500 -- (-925.951) (-918.130) [-914.989] (-916.082) * (-920.135) (-927.799) [-920.793] (-926.571) -- 0:01:34 11000 -- [-927.854] (-923.741) (-923.825) (-924.319) * (-920.739) (-923.536) [-921.243] (-923.150) -- 0:01:29 11500 -- (-919.981) (-922.436) [-916.390] (-917.729) * (-922.802) (-916.165) [-917.666] (-923.941) -- 0:01:25 12000 -- [-924.296] (-923.625) (-913.248) (-923.436) * [-916.590] (-918.065) (-941.776) (-916.431) -- 0:01:22 12500 -- (-924.673) [-918.042] (-910.986) (-921.891) * (-923.312) (-920.463) (-923.069) [-918.927] -- 0:01:19 13000 -- (-914.955) (-919.776) (-911.584) [-924.145] * [-915.713] (-928.002) (-923.152) (-921.936) -- 0:01:15 13500 -- (-919.676) (-920.771) [-914.793] (-918.752) * (-919.555) (-917.134) (-920.323) [-923.155] -- 0:01:13 14000 -- (-918.994) [-917.427] (-911.839) (-930.315) * [-919.161] (-920.565) (-923.439) (-918.637) -- 0:01:10 14500 -- (-921.873) (-919.953) (-913.989) [-923.680] * [-918.574] (-922.795) (-921.072) (-916.752) -- 0:01:07 15000 -- (-924.962) [-919.391] (-912.815) (-922.807) * (-927.563) [-924.419] (-916.450) (-923.617) -- 0:01:05 Average standard deviation of split frequencies: 0.044970 15500 -- (-919.017) (-918.248) (-912.474) [-921.319] * (-921.023) (-918.111) (-918.897) [-923.268] -- 0:01:03 16000 -- (-918.526) (-923.715) [-910.537] (-925.747) * (-921.437) (-919.587) [-920.034] (-924.820) -- 0:01:01 16500 -- (-922.168) (-924.358) [-909.854] (-924.838) * [-925.379] (-924.772) (-927.785) (-924.565) -- 0:00:59 17000 -- (-922.819) (-915.115) (-912.288) [-919.066] * (-912.715) (-920.106) [-916.935] (-923.092) -- 0:00:57 17500 -- (-920.701) (-922.504) [-911.067] (-922.490) * (-911.217) (-923.314) [-920.144] (-918.734) -- 0:00:56 18000 -- (-922.954) [-918.094] (-912.000) (-921.609) * (-911.228) (-919.853) (-920.453) [-919.009] -- 0:00:54 18500 -- (-923.244) (-919.158) [-911.603] (-918.932) * (-910.899) [-916.783] (-920.497) (-918.575) -- 0:00:53 19000 -- [-918.223] (-924.110) (-912.502) (-916.843) * (-912.471) (-920.013) (-933.177) [-927.792] -- 0:00:51 19500 -- (-929.962) (-930.185) [-911.736] (-918.948) * (-911.652) (-916.939) (-920.947) [-916.844] -- 0:00:50 20000 -- (-924.275) [-923.603] (-910.330) (-916.397) * (-912.403) [-924.071] (-923.437) (-922.105) -- 0:00:49 Average standard deviation of split frequencies: 0.056264 20500 -- [-920.276] (-930.687) (-910.610) (-915.188) * (-910.656) [-925.426] (-924.526) (-917.854) -- 0:00:47 21000 -- (-921.249) (-926.391) [-910.275] (-914.501) * (-910.489) (-913.563) [-916.643] (-921.452) -- 0:00:46 21500 -- [-921.111] (-920.514) (-911.982) (-915.011) * (-910.907) (-913.716) [-920.985] (-921.850) -- 0:00:45 22000 -- [-921.748] (-922.641) (-910.736) (-911.665) * (-910.441) [-911.261] (-920.850) (-918.772) -- 0:00:44 22500 -- (-917.149) [-918.762] (-913.896) (-912.289) * (-912.415) [-913.670] (-924.064) (-924.390) -- 0:00:43 23000 -- (-926.731) [-919.815] (-916.530) (-910.967) * (-911.378) [-913.824] (-925.995) (-920.883) -- 0:00:42 23500 -- (-925.918) (-916.429) (-915.189) [-910.762] * (-912.988) (-915.123) [-924.725] (-932.716) -- 0:00:41 24000 -- (-918.398) [-918.524] (-914.447) (-911.331) * (-914.904) [-912.831] (-922.055) (-921.445) -- 0:00:40 24500 -- (-922.446) (-921.311) (-911.969) [-910.546] * [-915.919] (-912.752) (-922.025) (-919.194) -- 0:00:39 25000 -- (-921.335) (-925.764) [-913.198] (-910.882) * (-911.635) (-910.180) [-918.947] (-921.451) -- 0:01:18 Average standard deviation of split frequencies: 0.040039 25500 -- (-932.308) [-916.930] (-911.405) (-913.755) * (-911.274) [-910.538] (-918.978) (-919.425) -- 0:01:16 26000 -- (-923.997) [-921.685] (-910.336) (-912.683) * (-911.575) (-915.854) (-929.032) [-915.880] -- 0:01:14 26500 -- (-927.437) [-918.964] (-913.462) (-914.302) * (-911.127) (-912.390) [-919.111] (-921.743) -- 0:01:13 27000 -- (-918.118) [-915.896] (-912.162) (-916.303) * [-912.814] (-912.723) (-918.353) (-927.374) -- 0:01:12 27500 -- (-916.400) [-917.391] (-911.308) (-918.259) * (-914.916) (-912.782) (-920.920) [-919.097] -- 0:01:10 28000 -- (-930.756) [-918.403] (-911.963) (-914.137) * [-912.712] (-914.569) (-925.034) (-920.695) -- 0:01:09 28500 -- [-919.740] (-917.871) (-913.684) (-913.155) * (-911.133) (-914.191) (-921.096) [-920.723] -- 0:01:08 29000 -- [-919.666] (-927.342) (-912.273) (-915.755) * [-910.842] (-915.216) (-918.321) (-919.880) -- 0:01:06 29500 -- (-928.288) (-926.878) (-914.044) [-913.426] * (-913.028) (-913.312) [-920.442] (-920.044) -- 0:01:05 30000 -- (-922.607) (-925.301) [-911.997] (-911.622) * (-911.654) [-912.830] (-920.863) (-920.144) -- 0:01:04 Average standard deviation of split frequencies: 0.040992 30500 -- (-920.967) [-921.711] (-910.158) (-916.543) * (-913.863) (-911.353) [-917.323] (-922.479) -- 0:01:03 31000 -- (-928.396) [-915.973] (-911.435) (-915.851) * (-914.766) [-910.834] (-921.350) (-921.761) -- 0:01:02 31500 -- (-919.385) (-921.250) [-911.498] (-911.604) * [-912.672] (-911.428) (-913.279) (-919.405) -- 0:01:01 32000 -- (-921.921) (-922.977) (-918.622) [-909.966] * (-913.293) (-916.304) [-915.008] (-916.419) -- 0:01:00 32500 -- (-919.658) [-918.391] (-912.247) (-922.925) * (-914.760) (-913.785) (-911.014) [-919.953] -- 0:00:59 33000 -- (-920.060) (-921.055) (-912.276) [-914.575] * (-912.127) (-910.207) (-911.812) [-914.867] -- 0:00:58 33500 -- [-916.533] (-925.140) (-912.167) (-913.181) * (-912.719) (-911.082) (-910.544) [-914.996] -- 0:00:57 34000 -- (-928.262) [-921.846] (-912.099) (-910.009) * (-911.923) (-912.778) (-911.469) [-925.256] -- 0:00:56 34500 -- [-917.414] (-921.623) (-914.915) (-910.166) * (-910.278) [-913.629] (-910.702) (-919.767) -- 0:00:55 35000 -- (-941.509) (-932.660) (-914.276) [-911.369] * (-912.213) (-911.038) [-912.248] (-927.469) -- 0:00:55 Average standard deviation of split frequencies: 0.041351 35500 -- (-922.888) [-920.232] (-914.859) (-917.042) * [-911.180] (-909.973) (-912.941) (-917.602) -- 0:00:54 36000 -- (-914.767) (-920.588) [-915.435] (-913.391) * (-911.536) [-911.091] (-915.197) (-928.074) -- 0:00:53 36500 -- (-910.984) [-918.551] (-912.291) (-912.972) * (-911.039) (-912.577) (-912.592) [-916.154] -- 0:00:52 37000 -- (-913.091) [-917.376] (-913.215) (-918.186) * [-910.617] (-912.103) (-910.785) (-925.631) -- 0:00:52 37500 -- (-911.953) (-932.922) [-911.048] (-915.906) * [-911.158] (-909.998) (-910.814) (-922.735) -- 0:00:51 38000 -- (-911.880) (-929.277) (-913.154) [-911.648] * [-912.782] (-910.999) (-911.973) (-924.234) -- 0:00:50 38500 -- (-910.914) (-921.783) [-910.083] (-915.087) * (-913.373) (-911.480) (-910.208) [-922.122] -- 0:00:49 39000 -- (-912.013) [-920.759] (-910.584) (-910.798) * (-912.672) (-912.193) [-911.894] (-924.261) -- 0:00:49 39500 -- [-910.300] (-925.561) (-914.726) (-911.118) * (-911.736) [-910.534] (-910.961) (-925.961) -- 0:00:48 40000 -- [-910.583] (-923.378) (-920.970) (-910.963) * (-915.862) [-910.829] (-913.379) (-930.168) -- 0:00:48 Average standard deviation of split frequencies: 0.034132 40500 -- (-912.139) (-920.721) (-916.837) [-911.465] * (-912.123) (-911.088) [-911.710] (-927.358) -- 0:00:47 41000 -- (-914.058) [-925.779] (-910.017) (-911.522) * (-913.655) (-911.325) (-911.158) [-922.072] -- 0:01:10 41500 -- (-912.434) (-916.885) (-911.523) [-914.217] * (-910.897) (-912.830) [-912.613] (-927.814) -- 0:01:09 42000 -- (-912.620) (-925.561) [-910.939] (-915.750) * (-913.048) (-915.928) (-912.527) [-911.797] -- 0:01:08 42500 -- [-914.161] (-922.932) (-911.125) (-914.534) * [-913.807] (-912.983) (-912.253) (-912.398) -- 0:01:07 43000 -- [-911.390] (-922.766) (-914.776) (-914.463) * (-910.773) (-913.270) [-910.393] (-913.922) -- 0:01:06 43500 -- (-911.808) [-916.166] (-911.301) (-911.213) * [-910.936] (-912.305) (-911.590) (-915.155) -- 0:01:05 44000 -- [-910.157] (-924.132) (-910.526) (-910.724) * (-917.160) [-911.541] (-911.561) (-917.403) -- 0:01:05 44500 -- (-910.977) [-923.298] (-910.116) (-910.293) * (-913.796) [-912.112] (-910.995) (-918.230) -- 0:01:04 45000 -- [-911.592] (-920.068) (-914.761) (-914.982) * [-911.873] (-913.372) (-910.687) (-915.962) -- 0:01:03 Average standard deviation of split frequencies: 0.031720 45500 -- [-911.479] (-919.418) (-911.078) (-910.621) * (-914.065) (-913.446) [-910.155] (-913.583) -- 0:01:02 46000 -- (-911.344) (-918.056) [-910.672] (-911.355) * (-911.919) (-910.777) [-910.833] (-911.173) -- 0:01:02 46500 -- [-913.926] (-919.790) (-911.350) (-911.854) * [-912.073] (-913.291) (-911.372) (-912.110) -- 0:01:01 47000 -- (-912.808) (-915.252) (-911.491) [-913.456] * (-912.750) (-911.028) [-910.226] (-911.462) -- 0:01:00 47500 -- (-910.347) (-910.123) (-911.104) [-912.337] * (-913.771) (-914.286) [-910.195] (-913.991) -- 0:01:00 48000 -- [-911.685] (-912.529) (-914.807) (-910.621) * (-910.246) (-910.855) (-910.522) [-911.175] -- 0:00:59 48500 -- [-912.291] (-910.652) (-912.049) (-911.470) * (-910.691) (-912.545) [-911.458] (-912.209) -- 0:00:58 49000 -- [-911.908] (-910.021) (-910.244) (-911.538) * [-911.253] (-910.429) (-911.196) (-913.743) -- 0:00:58 49500 -- [-913.854] (-911.647) (-910.833) (-914.613) * (-910.558) [-912.323] (-911.310) (-912.392) -- 0:00:57 50000 -- (-910.672) (-911.543) [-910.458] (-911.129) * [-910.092] (-910.674) (-914.159) (-918.147) -- 0:00:57 Average standard deviation of split frequencies: 0.032809 50500 -- (-911.407) (-910.968) (-910.556) [-910.421] * (-912.356) (-916.932) (-909.646) [-911.675] -- 0:00:56 51000 -- (-910.769) (-911.295) (-911.205) [-910.089] * (-912.356) [-917.726] (-913.448) (-910.703) -- 0:00:55 51500 -- (-914.623) [-914.271] (-910.809) (-910.951) * (-909.663) [-914.481] (-912.725) (-910.681) -- 0:00:55 52000 -- [-912.842] (-911.569) (-910.638) (-910.587) * [-910.526] (-915.991) (-912.793) (-913.420) -- 0:00:54 52500 -- (-912.212) (-910.185) (-910.092) [-911.273] * (-910.056) (-911.994) (-914.310) [-914.127] -- 0:00:54 53000 -- (-911.433) [-911.192] (-914.830) (-911.856) * (-909.779) (-911.988) [-911.510] (-914.552) -- 0:00:53 53500 -- [-912.276] (-911.063) (-912.645) (-911.454) * (-910.648) [-910.745] (-914.663) (-914.061) -- 0:00:53 54000 -- (-914.812) (-910.064) [-912.054] (-912.161) * (-909.951) [-912.080] (-913.575) (-910.921) -- 0:00:52 54500 -- (-915.324) [-910.097] (-914.457) (-911.797) * (-909.951) (-913.535) [-912.372] (-910.864) -- 0:00:52 55000 -- (-910.929) (-910.015) (-914.914) [-911.649] * (-912.328) (-911.722) (-910.704) [-910.452] -- 0:00:51 Average standard deviation of split frequencies: 0.030570 55500 -- [-910.771] (-914.819) (-911.336) (-912.528) * (-911.307) [-910.440] (-912.319) (-912.514) -- 0:00:51 56000 -- [-909.664] (-913.850) (-914.536) (-911.318) * (-912.164) [-912.605] (-912.470) (-912.289) -- 0:00:50 56500 -- (-917.301) (-914.396) [-911.356] (-911.395) * (-910.607) [-911.399] (-912.821) (-911.506) -- 0:00:50 57000 -- [-911.021] (-913.840) (-910.778) (-911.629) * (-910.607) [-910.114] (-912.232) (-913.728) -- 0:00:49 57500 -- (-913.475) (-913.661) [-915.983] (-916.041) * (-913.547) (-910.429) (-910.952) [-915.285] -- 0:00:49 58000 -- [-910.539] (-913.526) (-918.083) (-914.164) * [-922.327] (-910.872) (-911.099) (-911.509) -- 0:01:04 58500 -- [-910.597] (-911.858) (-912.821) (-910.533) * (-914.546) (-912.071) (-910.602) [-911.438] -- 0:01:04 59000 -- (-915.453) [-911.708] (-911.976) (-911.587) * [-912.383] (-911.870) (-912.039) (-912.753) -- 0:01:03 59500 -- (-917.112) (-911.501) [-910.054] (-911.838) * (-914.557) [-911.825] (-911.135) (-912.763) -- 0:01:03 60000 -- (-915.894) [-910.701] (-911.030) (-913.968) * (-910.715) (-913.329) [-912.133] (-912.521) -- 0:01:02 Average standard deviation of split frequencies: 0.033024 60500 -- (-911.196) (-910.924) [-911.603] (-914.957) * (-910.857) (-912.867) [-913.289] (-918.996) -- 0:01:02 61000 -- (-911.468) (-909.979) (-913.350) [-918.375] * (-911.311) (-910.956) [-912.433] (-911.003) -- 0:01:01 61500 -- (-915.642) (-910.506) [-912.520] (-916.619) * [-912.885] (-910.140) (-914.487) (-912.506) -- 0:01:01 62000 -- (-911.222) (-913.188) [-913.243] (-915.456) * (-914.139) (-912.763) (-912.141) [-914.182] -- 0:01:00 62500 -- (-912.418) [-911.828] (-911.318) (-914.331) * (-911.626) (-914.389) (-912.223) [-911.559] -- 0:01:00 63000 -- (-912.281) (-914.021) (-912.929) [-911.256] * (-912.678) (-910.766) [-911.775] (-914.156) -- 0:00:59 63500 -- (-910.966) (-912.829) (-911.883) [-912.787] * (-914.194) (-911.947) [-912.044] (-914.237) -- 0:00:58 64000 -- [-911.794] (-910.266) (-910.123) (-913.080) * (-914.867) (-911.140) [-912.897] (-914.690) -- 0:00:58 64500 -- (-910.218) (-909.913) [-909.547] (-913.333) * (-913.674) (-911.057) (-911.476) [-915.331] -- 0:00:58 65000 -- (-911.022) (-912.132) (-910.677) [-914.265] * (-912.550) (-913.972) [-913.443] (-911.091) -- 0:00:57 Average standard deviation of split frequencies: 0.026784 65500 -- (-914.448) [-911.466] (-911.672) (-912.329) * (-911.652) [-910.710] (-913.746) (-913.261) -- 0:00:57 66000 -- (-917.622) (-913.976) [-910.775] (-911.058) * [-910.262] (-911.333) (-913.503) (-912.275) -- 0:00:56 66500 -- [-913.434] (-915.826) (-910.775) (-913.136) * [-911.150] (-912.405) (-912.317) (-912.455) -- 0:00:56 67000 -- (-913.476) (-911.407) [-910.996] (-913.511) * [-910.761] (-914.751) (-911.281) (-912.942) -- 0:00:55 67500 -- (-910.818) (-915.011) (-911.696) [-914.849] * (-910.795) (-913.548) [-910.985] (-913.588) -- 0:00:55 68000 -- (-913.109) [-910.961] (-910.966) (-912.733) * [-912.806] (-918.150) (-911.108) (-913.510) -- 0:00:54 68500 -- (-912.636) (-912.093) [-913.590] (-914.445) * [-911.920] (-915.163) (-911.222) (-910.933) -- 0:00:54 69000 -- (-911.846) (-911.243) [-912.522] (-911.146) * (-911.047) (-910.679) (-910.769) [-911.959] -- 0:00:53 69500 -- [-910.218] (-912.249) (-911.594) (-912.071) * (-912.944) (-910.432) [-910.164] (-913.208) -- 0:00:53 70000 -- (-909.887) [-911.384] (-913.946) (-913.587) * (-911.175) (-910.634) [-911.476] (-913.550) -- 0:00:53 Average standard deviation of split frequencies: 0.026350 70500 -- (-910.933) [-912.317] (-909.977) (-915.920) * (-911.751) [-914.137] (-910.225) (-918.596) -- 0:00:52 71000 -- [-910.766] (-913.800) (-910.415) (-911.403) * [-911.067] (-913.960) (-914.902) (-915.376) -- 0:00:52 71500 -- (-910.654) [-913.030] (-910.643) (-912.176) * [-911.860] (-911.698) (-911.022) (-911.850) -- 0:00:51 72000 -- (-910.440) (-912.874) (-913.206) [-910.365] * [-912.539] (-914.463) (-915.941) (-910.507) -- 0:00:51 72500 -- (-911.715) (-911.259) (-911.489) [-911.071] * (-913.495) (-911.078) [-910.519] (-911.333) -- 0:00:51 73000 -- (-911.346) (-912.956) (-910.442) [-913.674] * [-911.862] (-911.498) (-911.144) (-910.408) -- 0:00:50 73500 -- (-911.059) [-909.700] (-913.243) (-913.593) * (-912.162) (-911.691) (-910.743) [-910.498] -- 0:00:50 74000 -- (-911.753) [-911.388] (-910.821) (-914.875) * [-911.820] (-910.780) (-912.864) (-913.648) -- 0:00:50 74500 -- (-909.866) (-911.055) [-910.520] (-911.623) * (-912.766) (-912.040) [-910.664] (-912.910) -- 0:01:02 75000 -- (-910.590) (-911.224) [-910.343] (-912.927) * (-914.327) (-912.028) [-911.928] (-914.300) -- 0:01:01 Average standard deviation of split frequencies: 0.026051 75500 -- [-909.767] (-910.977) (-910.077) (-912.721) * (-916.054) (-909.914) (-913.604) [-910.597] -- 0:01:01 76000 -- (-913.426) (-910.255) [-909.865] (-912.769) * (-912.610) (-910.171) [-915.167] (-911.886) -- 0:01:00 76500 -- [-910.751] (-914.203) (-911.141) (-911.743) * [-912.240] (-910.164) (-912.712) (-911.496) -- 0:01:00 77000 -- (-912.623) (-910.980) (-912.346) [-912.671] * (-911.728) (-911.298) [-910.825] (-913.295) -- 0:00:59 77500 -- (-911.219) (-911.447) (-913.428) [-911.775] * (-913.314) (-915.512) (-911.091) [-913.004] -- 0:00:59 78000 -- (-910.259) (-910.213) (-910.785) [-912.154] * (-914.364) (-910.541) [-910.080] (-913.336) -- 0:00:59 78500 -- (-912.266) [-911.281] (-911.502) (-910.124) * (-911.434) [-910.671] (-913.397) (-912.114) -- 0:00:58 79000 -- (-914.113) (-910.899) (-915.395) [-909.937] * (-912.683) [-913.144] (-911.230) (-910.510) -- 0:00:58 79500 -- [-910.015] (-915.500) (-910.516) (-912.830) * (-912.311) (-910.834) (-914.401) [-910.456] -- 0:00:57 80000 -- [-909.731] (-915.042) (-914.255) (-914.833) * [-913.168] (-912.394) (-913.077) (-911.325) -- 0:00:57 Average standard deviation of split frequencies: 0.020746 80500 -- (-910.105) (-918.141) (-913.972) [-915.129] * [-911.898] (-912.524) (-910.425) (-914.930) -- 0:00:57 81000 -- (-911.541) (-913.646) [-912.473] (-913.384) * (-910.630) [-911.756] (-911.106) (-910.514) -- 0:00:56 81500 -- [-911.769] (-910.422) (-913.816) (-914.593) * (-915.790) (-915.748) (-913.668) [-910.755] -- 0:00:56 82000 -- [-909.878] (-909.943) (-911.138) (-911.588) * (-914.452) [-914.464] (-916.104) (-910.361) -- 0:00:55 82500 -- (-910.004) (-914.278) [-913.351] (-911.058) * [-915.325] (-914.614) (-910.501) (-910.547) -- 0:00:55 83000 -- (-912.273) [-911.707] (-910.285) (-913.707) * (-913.108) (-911.892) [-910.003] (-911.630) -- 0:00:55 83500 -- (-911.457) [-909.718] (-910.680) (-911.794) * (-911.434) (-911.968) [-909.781] (-915.529) -- 0:00:54 84000 -- (-911.442) (-911.760) [-910.616] (-912.236) * [-911.909] (-911.864) (-912.577) (-911.852) -- 0:00:54 84500 -- [-911.448] (-912.549) (-913.683) (-916.262) * (-910.804) (-911.277) (-912.403) [-918.418] -- 0:00:54 85000 -- (-913.320) (-913.390) [-915.247] (-913.570) * [-912.109] (-911.978) (-911.793) (-912.875) -- 0:00:53 Average standard deviation of split frequencies: 0.022748 85500 -- (-916.450) (-917.855) (-913.099) [-912.700] * [-912.167] (-912.931) (-912.330) (-911.265) -- 0:00:53 86000 -- [-912.276] (-913.586) (-914.585) (-912.544) * (-909.949) (-916.209) (-913.155) [-911.508] -- 0:00:53 86500 -- [-911.483] (-913.769) (-912.580) (-910.711) * (-910.543) (-917.252) [-912.325] (-916.393) -- 0:00:52 87000 -- [-909.944] (-911.980) (-910.794) (-915.128) * (-910.738) [-909.981] (-913.124) (-920.099) -- 0:00:52 87500 -- (-911.328) (-912.414) (-911.029) [-917.439] * (-910.389) [-910.250] (-913.892) (-915.162) -- 0:00:52 88000 -- (-911.405) (-911.614) (-910.410) [-912.536] * [-910.677] (-911.619) (-912.314) (-916.014) -- 0:00:51 88500 -- (-911.327) (-910.665) (-912.186) [-912.691] * [-909.764] (-910.675) (-913.428) (-910.665) -- 0:00:51 89000 -- [-909.678] (-911.684) (-910.708) (-911.104) * (-909.766) [-910.747] (-912.840) (-914.329) -- 0:00:51 89500 -- (-911.835) [-910.389] (-911.033) (-910.927) * (-912.628) (-910.150) (-915.014) [-913.000] -- 0:00:50 90000 -- (-911.689) (-910.176) [-912.094] (-910.368) * (-912.461) [-909.966] (-917.095) (-909.568) -- 0:00:50 Average standard deviation of split frequencies: 0.022713 90500 -- (-914.529) (-910.355) [-912.818] (-912.201) * (-914.859) (-914.011) (-912.106) [-910.220] -- 0:01:00 91000 -- [-911.474] (-912.492) (-911.680) (-916.116) * (-911.548) (-914.730) (-910.408) [-911.775] -- 0:00:59 91500 -- (-911.493) (-912.161) [-910.356] (-911.102) * (-913.732) [-911.141] (-915.473) (-912.290) -- 0:00:59 92000 -- (-910.202) (-910.629) (-914.512) [-911.666] * (-915.097) [-911.507] (-910.885) (-917.860) -- 0:00:59 92500 -- [-910.851] (-910.469) (-911.252) (-914.755) * (-914.466) (-912.685) [-912.173] (-914.433) -- 0:00:58 93000 -- (-910.841) (-911.054) (-911.054) [-913.259] * (-909.952) [-916.447] (-911.748) (-914.872) -- 0:00:58 93500 -- [-910.257] (-910.441) (-912.118) (-911.542) * (-912.737) (-915.679) [-915.067] (-914.497) -- 0:00:58 94000 -- (-914.175) [-913.184] (-914.133) (-911.233) * (-918.518) (-913.660) [-911.947] (-911.643) -- 0:00:57 94500 -- [-915.846] (-910.587) (-913.479) (-910.166) * [-913.061] (-912.921) (-911.567) (-914.438) -- 0:00:57 95000 -- [-916.261] (-913.900) (-915.515) (-913.009) * [-911.331] (-911.075) (-911.005) (-916.905) -- 0:00:57 Average standard deviation of split frequencies: 0.024841 95500 -- (-910.744) (-912.786) [-910.309] (-911.296) * (-911.250) [-911.267] (-910.922) (-918.262) -- 0:00:56 96000 -- (-912.234) (-910.617) (-920.144) [-910.987] * (-912.069) [-911.742] (-913.383) (-915.433) -- 0:00:56 96500 -- [-910.341] (-911.906) (-923.510) (-913.923) * (-911.956) [-910.219] (-915.054) (-911.924) -- 0:00:56 97000 -- (-911.636) (-912.144) (-914.864) [-912.665] * [-910.288] (-911.638) (-913.122) (-911.130) -- 0:00:55 97500 -- (-913.530) (-912.066) [-912.440] (-919.981) * [-912.328] (-912.838) (-911.298) (-911.075) -- 0:00:55 98000 -- (-911.370) [-911.742] (-915.634) (-916.244) * [-915.982] (-910.122) (-916.720) (-913.077) -- 0:00:55 98500 -- (-915.563) (-910.218) [-911.696] (-918.352) * [-912.965] (-913.014) (-912.790) (-913.620) -- 0:00:54 99000 -- (-914.920) [-910.430] (-913.313) (-910.243) * (-911.168) (-910.439) [-912.660] (-913.087) -- 0:00:54 99500 -- (-913.475) (-913.251) [-911.750] (-911.924) * (-911.306) [-909.916] (-911.465) (-910.914) -- 0:00:54 100000 -- (-910.075) (-910.945) [-911.262] (-913.086) * (-911.362) (-913.189) (-913.597) [-910.786] -- 0:00:54 Average standard deviation of split frequencies: 0.023414 100500 -- (-910.455) [-911.262] (-912.764) (-910.651) * [-911.737] (-910.395) (-911.829) (-910.371) -- 0:00:53 101000 -- (-910.748) (-914.096) [-910.981] (-910.230) * (-912.754) (-914.151) (-912.304) [-911.724] -- 0:00:53 101500 -- (-911.295) [-912.827] (-910.594) (-909.971) * (-911.711) (-915.143) [-913.171] (-913.199) -- 0:00:53 102000 -- (-912.175) (-909.884) [-911.198] (-911.348) * [-913.414] (-913.949) (-912.737) (-912.208) -- 0:00:52 102500 -- (-910.482) (-911.037) [-912.403] (-910.468) * (-910.475) (-911.056) (-912.573) [-910.899] -- 0:00:52 103000 -- [-910.425] (-910.969) (-910.417) (-914.585) * (-911.819) [-911.440] (-913.998) (-912.202) -- 0:00:52 103500 -- (-912.768) (-911.262) [-915.207] (-912.938) * (-909.800) [-910.903] (-915.124) (-913.405) -- 0:00:51 104000 -- (-913.902) [-911.358] (-911.447) (-912.115) * [-914.239] (-911.502) (-913.498) (-913.563) -- 0:00:51 104500 -- (-911.091) [-911.070] (-910.839) (-912.818) * (-911.558) (-912.350) [-915.501] (-911.182) -- 0:00:51 105000 -- (-913.741) (-910.263) (-911.136) [-911.690] * [-910.513] (-911.456) (-912.168) (-915.900) -- 0:00:51 Average standard deviation of split frequencies: 0.023793 105500 -- (-910.483) (-910.770) [-911.830] (-910.619) * (-910.764) (-909.808) [-910.177] (-913.169) -- 0:00:50 106000 -- (-912.119) [-910.052] (-915.488) (-910.500) * (-912.769) (-910.608) [-910.040] (-912.954) -- 0:00:50 106500 -- [-910.339] (-917.464) (-910.452) (-910.455) * (-911.922) (-910.083) (-910.643) [-914.145] -- 0:00:50 107000 -- (-913.395) [-909.876] (-914.259) (-911.990) * (-913.962) (-913.304) [-911.628] (-914.379) -- 0:00:58 107500 -- (-911.498) (-910.656) [-914.861] (-914.559) * (-913.892) (-911.436) [-914.926] (-914.677) -- 0:00:58 108000 -- (-910.460) (-910.528) [-918.978] (-910.916) * (-921.250) (-913.791) (-910.730) [-911.885] -- 0:00:57 108500 -- [-910.442] (-909.945) (-911.702) (-911.201) * (-915.421) (-911.772) [-909.586] (-912.192) -- 0:00:57 109000 -- (-916.075) [-911.202] (-912.573) (-910.747) * [-912.184] (-912.035) (-911.930) (-911.041) -- 0:00:57 109500 -- (-912.370) (-912.823) [-911.565] (-913.635) * [-910.493] (-913.046) (-912.066) (-913.548) -- 0:00:56 110000 -- (-916.022) (-912.979) [-911.555] (-911.328) * (-910.717) (-912.322) (-911.429) [-910.912] -- 0:00:56 Average standard deviation of split frequencies: 0.024138 110500 -- (-912.000) (-912.801) (-916.294) [-912.757] * (-910.432) [-912.078] (-918.167) (-912.375) -- 0:00:56 111000 -- (-914.410) (-910.545) (-912.318) [-911.960] * (-910.443) (-915.373) [-912.913] (-911.869) -- 0:00:56 111500 -- (-910.823) [-910.551] (-914.883) (-912.357) * (-909.991) [-913.936] (-912.442) (-914.538) -- 0:00:55 112000 -- [-912.856] (-909.810) (-915.020) (-912.236) * (-910.413) (-911.150) [-914.708] (-913.426) -- 0:00:55 112500 -- (-911.708) [-909.847] (-918.082) (-910.617) * [-914.900] (-915.663) (-913.043) (-912.789) -- 0:00:55 113000 -- [-912.216] (-912.679) (-915.600) (-910.961) * (-912.984) (-913.164) [-911.902] (-912.424) -- 0:00:54 113500 -- (-912.984) (-911.379) (-915.216) [-911.217] * (-910.442) [-912.380] (-914.795) (-910.248) -- 0:00:54 114000 -- (-914.556) (-911.926) (-911.470) [-910.986] * (-911.118) (-910.636) [-915.309] (-912.234) -- 0:00:54 114500 -- (-913.321) (-918.229) (-912.870) [-915.459] * (-911.419) [-916.066] (-912.951) (-912.284) -- 0:00:54 115000 -- (-910.529) (-912.475) [-911.191] (-915.044) * (-911.684) (-911.360) (-914.547) [-912.940] -- 0:00:53 Average standard deviation of split frequencies: 0.024383 115500 -- (-910.837) [-910.893] (-914.032) (-919.377) * (-914.445) (-914.418) [-913.411] (-915.765) -- 0:00:53 116000 -- (-910.085) (-910.124) (-912.720) [-912.937] * (-909.610) [-910.046] (-913.592) (-910.446) -- 0:00:53 116500 -- [-913.326] (-911.752) (-911.759) (-911.354) * [-914.517] (-911.656) (-915.030) (-909.964) -- 0:00:53 117000 -- (-911.730) (-911.301) [-915.277] (-911.129) * (-915.663) (-911.316) (-914.609) [-912.355] -- 0:00:52 117500 -- [-913.847] (-913.100) (-913.779) (-914.183) * (-910.166) (-911.164) [-913.500] (-910.933) -- 0:00:52 118000 -- [-916.531] (-914.428) (-911.029) (-911.180) * (-909.684) [-910.748] (-910.532) (-910.914) -- 0:00:52 118500 -- (-917.390) (-916.723) [-910.345] (-911.816) * [-911.538] (-911.577) (-912.760) (-913.960) -- 0:00:52 119000 -- (-913.804) (-912.834) (-910.302) [-913.678] * (-912.079) (-911.434) (-913.512) [-911.504] -- 0:00:51 119500 -- [-913.438] (-911.905) (-914.748) (-912.328) * (-913.835) (-910.674) (-910.147) [-911.442] -- 0:00:51 120000 -- (-912.635) (-911.349) (-912.353) [-912.325] * (-909.801) [-910.806] (-910.509) (-914.331) -- 0:00:51 Average standard deviation of split frequencies: 0.024674 120500 -- (-914.204) (-912.672) [-915.147] (-911.695) * (-909.930) (-913.185) (-914.757) [-914.718] -- 0:00:51 121000 -- (-914.131) [-910.055] (-912.646) (-912.909) * [-912.962] (-912.263) (-914.485) (-912.362) -- 0:00:50 121500 -- [-914.250] (-909.972) (-912.321) (-913.049) * [-910.687] (-911.471) (-914.411) (-915.956) -- 0:00:50 122000 -- (-914.888) (-910.386) (-914.001) [-910.749] * (-914.096) (-910.615) (-916.035) [-919.753] -- 0:00:50 122500 -- (-911.697) [-913.965] (-913.241) (-910.416) * (-913.225) (-912.148) [-912.075] (-914.037) -- 0:00:50 123000 -- [-912.896] (-909.875) (-914.216) (-909.977) * (-910.126) (-910.581) [-911.116] (-914.093) -- 0:00:57 123500 -- (-913.946) (-910.699) (-912.736) [-910.375] * (-912.821) [-913.501] (-911.827) (-912.484) -- 0:00:56 124000 -- [-911.319] (-912.680) (-913.361) (-912.268) * (-914.513) (-913.657) (-912.288) [-911.551] -- 0:00:56 124500 -- (-911.672) (-910.963) (-919.248) [-911.783] * (-911.907) (-911.510) [-910.841] (-911.399) -- 0:00:56 125000 -- (-912.143) (-910.153) (-914.680) [-912.715] * (-914.672) [-911.559] (-913.043) (-913.753) -- 0:00:56 Average standard deviation of split frequencies: 0.024417 125500 -- [-911.425] (-912.290) (-916.497) (-911.849) * (-912.403) [-912.198] (-912.159) (-912.584) -- 0:00:55 126000 -- (-910.734) (-911.990) (-911.148) [-911.562] * (-911.508) (-915.526) (-910.473) [-910.611] -- 0:00:55 126500 -- (-909.798) [-911.719] (-910.348) (-918.998) * (-912.640) [-911.109] (-910.100) (-911.223) -- 0:00:55 127000 -- [-911.630] (-912.682) (-910.006) (-912.433) * (-912.187) (-910.871) (-911.690) [-911.704] -- 0:00:54 127500 -- [-910.822] (-912.416) (-911.720) (-913.533) * (-910.550) (-913.877) (-913.147) [-910.344] -- 0:00:54 128000 -- [-910.049] (-916.006) (-909.770) (-912.353) * (-910.766) [-912.917] (-912.403) (-911.078) -- 0:00:54 128500 -- [-910.455] (-916.006) (-911.595) (-911.204) * (-911.188) (-912.076) [-913.385] (-910.319) -- 0:00:54 129000 -- (-909.871) (-910.884) (-914.154) [-912.769] * [-915.778] (-911.176) (-920.116) (-910.387) -- 0:00:54 129500 -- (-909.959) (-912.967) (-913.600) [-911.894] * [-910.342] (-911.940) (-913.996) (-910.294) -- 0:00:53 130000 -- [-910.932] (-914.925) (-913.690) (-911.240) * (-910.840) (-911.654) [-913.521] (-914.489) -- 0:00:53 Average standard deviation of split frequencies: 0.021646 130500 -- (-910.371) (-920.848) (-910.180) [-911.881] * (-911.131) (-914.051) [-910.298] (-914.002) -- 0:00:53 131000 -- (-914.615) [-918.380] (-910.375) (-914.227) * (-910.207) (-914.238) (-914.528) [-913.532] -- 0:00:53 131500 -- (-911.619) (-915.051) [-912.023] (-913.389) * [-909.910] (-913.853) (-913.626) (-912.625) -- 0:00:52 132000 -- (-910.696) (-920.058) [-917.395] (-911.006) * (-910.769) (-911.925) [-913.063] (-910.030) -- 0:00:52 132500 -- [-911.016] (-913.748) (-913.605) (-910.760) * (-911.880) (-914.628) (-914.321) [-910.376] -- 0:00:52 133000 -- (-911.604) (-913.012) (-911.943) [-910.784] * (-910.851) (-910.513) (-913.809) [-910.536] -- 0:00:52 133500 -- (-911.663) [-911.103] (-913.107) (-913.494) * (-910.320) (-911.332) (-914.141) [-910.335] -- 0:00:51 134000 -- (-911.944) (-914.671) (-912.627) [-911.633] * (-915.846) [-911.472] (-910.933) (-912.754) -- 0:00:51 134500 -- (-910.186) (-912.629) [-910.638] (-910.856) * [-913.768] (-912.610) (-911.779) (-911.608) -- 0:00:51 135000 -- (-910.038) (-910.609) (-910.846) [-912.082] * (-916.370) (-912.295) (-911.681) [-911.068] -- 0:00:51 Average standard deviation of split frequencies: 0.019885 135500 -- [-910.715] (-910.087) (-910.819) (-910.726) * (-911.861) [-913.552] (-914.549) (-911.101) -- 0:00:51 136000 -- (-911.545) [-911.695] (-910.986) (-911.843) * (-912.245) (-915.626) [-910.985] (-912.178) -- 0:00:50 136500 -- (-913.740) [-911.157] (-910.986) (-910.441) * (-910.944) (-914.233) (-910.694) [-912.430] -- 0:00:50 137000 -- (-913.206) (-911.623) (-912.197) [-912.134] * [-911.776] (-911.026) (-910.844) (-909.937) -- 0:00:50 137500 -- (-915.522) (-912.181) (-912.633) [-912.671] * (-912.795) (-911.870) [-912.263] (-910.889) -- 0:00:50 138000 -- [-911.076] (-911.353) (-911.891) (-912.802) * (-913.776) (-910.786) (-913.184) [-911.215] -- 0:00:49 138500 -- (-911.605) (-912.395) [-914.138] (-911.039) * [-911.543] (-911.597) (-913.806) (-913.359) -- 0:00:49 139000 -- (-915.518) [-909.802] (-912.224) (-912.318) * (-910.584) [-911.597] (-914.651) (-914.198) -- 0:00:49 139500 -- (-912.465) (-910.619) [-911.464] (-911.115) * [-910.925] (-911.848) (-911.792) (-913.341) -- 0:00:49 140000 -- (-914.774) [-910.483] (-911.355) (-911.211) * (-910.083) (-912.517) [-910.244] (-915.398) -- 0:00:55 Average standard deviation of split frequencies: 0.019755 140500 -- (-912.453) (-911.691) [-912.416] (-919.949) * [-910.742] (-911.462) (-910.003) (-914.781) -- 0:00:55 141000 -- (-911.830) (-911.776) (-916.665) [-913.135] * (-911.383) (-913.707) (-910.005) [-912.493] -- 0:00:54 141500 -- (-911.128) [-910.500] (-911.709) (-913.901) * (-911.873) (-913.273) [-910.909] (-915.427) -- 0:00:54 142000 -- [-910.481] (-913.531) (-910.559) (-913.606) * (-910.626) (-913.636) [-910.551] (-912.213) -- 0:00:54 142500 -- [-912.901] (-912.299) (-911.053) (-911.191) * (-910.673) (-910.166) [-910.961] (-911.220) -- 0:00:54 143000 -- (-911.580) (-911.796) (-913.767) [-911.241] * (-910.673) (-911.655) (-910.470) [-911.942] -- 0:00:53 143500 -- (-913.935) [-913.813] (-914.207) (-912.960) * (-910.645) (-909.812) (-909.953) [-911.451] -- 0:00:53 144000 -- (-911.794) (-911.673) [-910.716] (-911.524) * (-910.474) [-915.405] (-911.472) (-911.703) -- 0:00:53 144500 -- [-917.356] (-914.413) (-911.431) (-912.846) * (-913.276) (-914.411) [-912.603] (-910.129) -- 0:00:53 145000 -- (-911.578) (-911.602) [-909.946] (-912.667) * (-911.702) (-915.125) (-918.580) [-909.643] -- 0:00:53 Average standard deviation of split frequencies: 0.019883 145500 -- (-911.789) (-912.131) (-909.766) [-911.633] * (-913.582) [-912.966] (-914.224) (-910.486) -- 0:00:52 146000 -- (-912.758) (-910.912) (-909.891) [-910.952] * (-911.693) (-910.858) (-914.989) [-912.920] -- 0:00:52 146500 -- (-912.796) (-911.789) (-909.897) [-910.059] * [-911.192] (-912.782) (-914.362) (-922.037) -- 0:00:52 147000 -- (-912.793) (-911.476) [-909.897] (-911.838) * (-915.438) (-915.714) (-911.699) [-914.408] -- 0:00:52 147500 -- (-910.600) [-913.471] (-913.039) (-913.810) * (-917.553) [-911.310] (-912.005) (-915.417) -- 0:00:52 148000 -- [-911.227] (-913.655) (-910.520) (-913.134) * (-913.298) [-910.398] (-912.201) (-911.845) -- 0:00:51 148500 -- [-912.097] (-910.569) (-911.693) (-914.445) * [-911.493] (-912.811) (-909.976) (-911.478) -- 0:00:51 149000 -- [-911.951] (-910.508) (-910.913) (-914.210) * (-911.236) [-910.486] (-910.081) (-912.436) -- 0:00:51 149500 -- (-914.624) (-913.513) [-912.685] (-917.426) * (-911.377) [-911.611] (-912.410) (-913.907) -- 0:00:51 150000 -- [-909.740] (-914.630) (-912.754) (-913.369) * (-912.030) [-912.179] (-911.084) (-912.513) -- 0:00:51 Average standard deviation of split frequencies: 0.020749 150500 -- (-915.503) (-913.095) [-913.230] (-910.781) * (-913.232) (-912.002) (-911.882) [-910.768] -- 0:00:50 151000 -- [-910.996] (-911.792) (-917.479) (-910.987) * [-912.579] (-913.863) (-914.235) (-910.488) -- 0:00:50 151500 -- (-911.518) [-910.892] (-915.335) (-916.293) * (-915.265) (-914.381) [-911.666] (-910.436) -- 0:00:50 152000 -- (-911.890) (-911.855) (-911.713) [-911.421] * [-912.308] (-915.865) (-910.233) (-912.471) -- 0:00:50 152500 -- (-913.225) (-913.899) [-911.792] (-913.421) * (-910.976) (-913.022) (-910.819) [-910.128] -- 0:00:50 153000 -- (-910.192) (-913.249) (-911.849) [-910.904] * (-909.698) (-911.908) (-914.601) [-913.185] -- 0:00:49 153500 -- (-910.176) [-911.006] (-910.886) (-915.322) * (-917.599) (-916.628) (-911.608) [-910.650] -- 0:00:49 154000 -- (-910.577) [-910.424] (-911.759) (-912.296) * [-911.484] (-912.328) (-917.894) (-909.839) -- 0:00:49 154500 -- (-914.549) (-910.459) [-911.111] (-910.580) * (-913.380) (-911.027) (-915.036) [-911.079] -- 0:00:49 155000 -- (-912.841) (-911.770) [-909.847] (-910.216) * [-913.402] (-911.839) (-911.277) (-915.242) -- 0:00:49 Average standard deviation of split frequencies: 0.023872 155500 -- (-915.882) [-912.597] (-914.031) (-910.632) * (-913.288) (-912.205) (-914.509) [-914.548] -- 0:00:48 156000 -- (-912.492) (-912.094) (-913.393) [-910.300] * [-913.789] (-911.961) (-914.045) (-912.917) -- 0:00:54 156500 -- [-913.530] (-912.449) (-914.159) (-912.831) * (-911.900) (-909.675) (-912.694) [-916.626] -- 0:00:53 157000 -- (-914.401) (-911.108) [-915.747] (-912.244) * [-912.118] (-910.055) (-912.698) (-911.943) -- 0:00:53 157500 -- [-916.487] (-912.804) (-917.028) (-911.906) * [-913.349] (-911.881) (-910.263) (-910.675) -- 0:00:53 158000 -- (-913.399) (-911.344) [-911.634] (-912.075) * [-915.302] (-910.819) (-914.116) (-912.943) -- 0:00:53 158500 -- [-913.812] (-912.052) (-913.255) (-913.712) * [-914.454] (-913.665) (-914.019) (-913.662) -- 0:00:53 159000 -- [-912.786] (-912.935) (-917.618) (-910.916) * (-912.967) [-913.764] (-912.696) (-911.104) -- 0:00:52 159500 -- [-913.965] (-910.504) (-916.339) (-910.314) * (-913.357) (-913.974) [-915.661] (-912.671) -- 0:00:52 160000 -- (-913.968) [-911.548] (-912.837) (-910.304) * (-914.603) (-912.491) [-916.284] (-910.876) -- 0:00:52 Average standard deviation of split frequencies: 0.022592 160500 -- (-913.104) (-914.241) (-910.950) [-910.594] * (-913.275) (-912.124) (-909.918) [-910.009] -- 0:00:52 161000 -- (-913.326) (-912.602) (-910.479) [-914.779] * (-914.667) (-911.643) [-913.650] (-912.031) -- 0:00:52 161500 -- [-912.182] (-912.012) (-913.094) (-910.295) * (-914.496) (-909.865) (-910.548) [-912.062] -- 0:00:51 162000 -- (-912.334) (-915.189) [-911.189] (-911.679) * (-911.729) (-909.835) (-914.623) [-912.171] -- 0:00:51 162500 -- (-914.436) (-912.305) [-912.362] (-910.357) * (-911.483) (-912.370) [-910.623] (-910.932) -- 0:00:51 163000 -- (-911.284) [-910.423] (-910.811) (-910.152) * (-911.649) [-914.640] (-910.553) (-912.881) -- 0:00:51 163500 -- (-910.959) (-914.199) [-911.970] (-910.090) * (-911.018) (-911.434) [-911.689] (-912.477) -- 0:00:51 164000 -- (-911.846) (-914.642) [-909.974] (-910.478) * [-915.178] (-909.768) (-913.385) (-913.160) -- 0:00:50 164500 -- (-910.806) (-914.588) [-910.474] (-910.041) * (-913.340) [-909.823] (-915.165) (-916.739) -- 0:00:50 165000 -- [-911.756] (-913.591) (-910.709) (-911.213) * (-916.118) [-911.496] (-911.210) (-918.188) -- 0:00:50 Average standard deviation of split frequencies: 0.020446 165500 -- (-912.296) (-912.838) [-910.717] (-913.633) * (-911.692) [-911.555] (-914.334) (-912.395) -- 0:00:50 166000 -- (-911.291) (-911.963) [-914.158] (-910.370) * (-915.334) [-913.224] (-918.679) (-910.798) -- 0:00:50 166500 -- (-914.592) [-910.646] (-913.177) (-915.207) * (-914.787) (-913.763) [-912.460] (-912.462) -- 0:00:50 167000 -- (-910.499) [-909.974] (-910.062) (-913.670) * (-914.017) (-913.626) (-913.735) [-911.640] -- 0:00:49 167500 -- [-912.875] (-910.713) (-912.977) (-913.074) * (-912.727) (-912.258) (-912.999) [-911.390] -- 0:00:49 168000 -- (-910.808) (-912.614) [-914.763] (-915.010) * [-914.238] (-915.443) (-910.864) (-911.037) -- 0:00:49 168500 -- (-910.993) (-914.423) (-921.444) [-911.527] * (-911.175) (-912.447) (-911.568) [-910.255] -- 0:00:49 169000 -- (-910.545) (-918.011) [-913.199] (-911.992) * [-911.761] (-911.517) (-912.780) (-917.048) -- 0:00:49 169500 -- (-912.742) (-922.857) [-910.895] (-912.336) * (-911.762) (-913.924) (-911.647) [-916.052] -- 0:00:48 170000 -- (-913.321) [-914.324] (-910.879) (-910.668) * (-912.331) [-914.366] (-912.355) (-914.600) -- 0:00:48 Average standard deviation of split frequencies: 0.019887 170500 -- [-912.196] (-911.898) (-909.914) (-913.205) * (-912.363) (-911.723) [-912.077] (-910.497) -- 0:00:48 171000 -- (-912.174) (-911.923) [-911.395] (-914.193) * [-916.304] (-910.536) (-911.296) (-911.664) -- 0:00:48 171500 -- (-912.418) (-910.423) (-913.477) [-914.888] * (-914.680) (-910.958) (-915.990) [-912.026] -- 0:00:48 172000 -- (-910.638) (-910.928) (-910.401) [-911.327] * (-912.783) [-914.421] (-914.002) (-911.561) -- 0:00:48 172500 -- (-910.892) (-915.359) [-911.170] (-913.083) * (-912.122) (-914.653) (-914.087) [-910.679] -- 0:00:52 173000 -- (-911.180) (-912.617) (-912.302) [-913.291] * (-911.729) (-912.071) (-915.036) [-913.365] -- 0:00:52 173500 -- (-912.867) [-913.946] (-910.632) (-913.420) * (-911.658) (-910.820) (-911.783) [-912.185] -- 0:00:52 174000 -- [-911.024] (-915.779) (-914.365) (-911.507) * (-910.670) (-911.432) (-913.129) [-912.487] -- 0:00:52 174500 -- [-911.266] (-910.205) (-910.820) (-915.339) * (-909.760) (-913.014) (-912.761) [-913.451] -- 0:00:52 175000 -- (-912.247) (-910.149) (-911.860) [-910.068] * (-911.475) (-911.210) [-912.162] (-910.239) -- 0:00:51 Average standard deviation of split frequencies: 0.018326 175500 -- (-915.150) [-910.183] (-912.352) (-911.096) * (-915.862) (-910.631) (-913.229) [-912.332] -- 0:00:51 176000 -- [-915.245] (-911.677) (-915.254) (-910.981) * (-914.692) [-910.217] (-912.094) (-911.384) -- 0:00:51 176500 -- (-914.367) (-911.672) [-913.341] (-910.733) * (-910.288) (-910.220) [-911.201] (-913.890) -- 0:00:51 177000 -- [-911.909] (-910.825) (-915.452) (-911.405) * (-910.971) (-910.135) (-913.611) [-914.125] -- 0:00:51 177500 -- (-912.058) (-912.582) (-913.009) [-911.734] * (-910.761) (-910.202) [-911.609] (-910.290) -- 0:00:50 178000 -- (-913.662) (-911.519) (-912.241) [-910.528] * [-914.822] (-912.135) (-911.141) (-912.681) -- 0:00:50 178500 -- (-913.056) [-912.739] (-912.864) (-911.596) * (-912.949) (-917.434) [-911.197] (-913.807) -- 0:00:50 179000 -- [-911.737] (-912.868) (-913.830) (-911.716) * (-922.982) [-914.024] (-913.130) (-915.055) -- 0:00:50 179500 -- (-911.603) (-913.838) (-913.969) [-915.403] * (-911.824) (-913.626) (-913.631) [-912.075] -- 0:00:50 180000 -- (-910.027) (-915.692) (-913.434) [-912.197] * (-911.137) (-913.131) (-912.854) [-911.057] -- 0:00:50 Average standard deviation of split frequencies: 0.017303 180500 -- [-912.733] (-911.801) (-912.845) (-911.052) * [-912.409] (-917.976) (-913.431) (-910.426) -- 0:00:49 181000 -- [-910.259] (-915.356) (-913.202) (-911.816) * (-912.643) (-910.943) [-910.480] (-913.237) -- 0:00:49 181500 -- (-912.862) [-913.478] (-910.329) (-910.727) * (-912.584) (-913.770) (-910.629) [-914.521] -- 0:00:49 182000 -- [-917.409] (-913.837) (-911.034) (-911.648) * (-912.507) (-912.950) [-910.793] (-914.416) -- 0:00:49 182500 -- (-912.365) (-913.841) (-911.349) [-912.131] * (-914.305) (-917.754) (-911.885) [-914.329] -- 0:00:49 183000 -- (-911.239) (-914.017) (-911.867) [-910.314] * (-911.947) (-918.141) [-912.406] (-914.739) -- 0:00:49 183500 -- (-910.656) (-912.064) (-911.732) [-910.065] * [-912.018] (-914.604) (-912.536) (-912.356) -- 0:00:48 184000 -- (-914.188) [-912.361] (-911.338) (-910.846) * (-912.081) [-914.180] (-913.699) (-911.594) -- 0:00:48 184500 -- (-913.911) (-913.548) [-914.705] (-915.222) * [-913.376] (-912.098) (-912.082) (-915.803) -- 0:00:48 185000 -- [-911.292] (-916.058) (-911.994) (-910.847) * [-911.299] (-917.579) (-911.481) (-918.333) -- 0:00:48 Average standard deviation of split frequencies: 0.019135 185500 -- (-910.558) [-910.690] (-913.658) (-909.677) * (-914.636) (-910.165) (-915.505) [-912.214] -- 0:00:48 186000 -- (-915.807) [-909.943] (-913.198) (-911.443) * (-914.459) (-909.765) [-913.800] (-909.987) -- 0:00:48 186500 -- (-910.576) (-910.234) (-913.513) [-910.054] * [-910.070] (-911.585) (-912.026) (-918.787) -- 0:00:47 187000 -- (-919.283) (-910.492) [-911.187] (-911.145) * [-910.048] (-910.787) (-912.867) (-914.560) -- 0:00:47 187500 -- (-910.851) (-911.287) [-911.829] (-909.621) * (-914.393) [-909.913] (-911.703) (-910.385) -- 0:00:47 188000 -- (-911.076) (-911.377) (-912.327) [-911.450] * [-910.535] (-916.116) (-910.687) (-910.090) -- 0:00:47 188500 -- (-915.027) [-910.947] (-914.250) (-920.086) * (-916.365) (-915.385) [-914.779] (-911.451) -- 0:00:47 189000 -- (-911.704) [-912.447] (-917.568) (-912.364) * (-914.019) (-911.148) [-911.439] (-913.083) -- 0:00:51 189500 -- (-911.643) (-911.414) [-912.841] (-917.993) * (-909.714) [-911.891] (-912.422) (-913.883) -- 0:00:51 190000 -- [-911.519] (-914.549) (-914.963) (-911.926) * (-910.917) (-911.350) (-912.677) [-912.795] -- 0:00:51 Average standard deviation of split frequencies: 0.020768 190500 -- [-910.687] (-913.927) (-910.585) (-914.300) * (-911.354) (-911.827) [-913.739] (-911.641) -- 0:00:50 191000 -- (-910.000) (-916.646) (-909.685) [-914.259] * (-911.738) [-910.617] (-911.038) (-913.471) -- 0:00:50 191500 -- (-911.318) [-916.585] (-912.180) (-914.644) * (-911.947) (-910.105) (-910.476) [-913.213] -- 0:00:50 192000 -- (-911.320) (-914.483) [-912.388] (-911.322) * (-910.480) (-912.026) [-914.862] (-911.351) -- 0:00:50 192500 -- (-910.246) (-915.040) [-913.816] (-910.255) * (-910.591) (-911.291) (-914.287) [-912.172] -- 0:00:50 193000 -- (-910.050) (-910.404) (-911.366) [-910.327] * (-914.257) [-912.087] (-912.827) (-913.974) -- 0:00:50 193500 -- [-911.129] (-912.738) (-911.149) (-912.659) * (-918.618) (-911.230) [-910.531] (-912.094) -- 0:00:50 194000 -- (-912.440) [-911.173] (-914.293) (-913.212) * (-912.215) [-910.467] (-913.055) (-911.401) -- 0:00:49 194500 -- (-911.928) (-913.874) (-913.852) [-910.706] * (-914.862) (-910.467) (-914.358) [-914.098] -- 0:00:49 195000 -- (-911.081) [-912.722] (-910.478) (-914.528) * (-916.230) [-911.188] (-913.252) (-913.117) -- 0:00:49 Average standard deviation of split frequencies: 0.019963 195500 -- (-911.293) [-912.371] (-910.809) (-912.343) * (-915.142) (-912.797) (-911.971) [-911.334] -- 0:00:49 196000 -- (-913.445) (-909.615) (-911.697) [-912.321] * (-912.686) [-909.808] (-911.667) (-911.626) -- 0:00:49 196500 -- (-911.234) [-909.925] (-912.958) (-914.506) * (-918.293) (-911.741) [-910.636] (-912.562) -- 0:00:49 197000 -- (-914.430) (-912.333) [-910.465] (-911.833) * (-923.685) (-911.741) (-910.985) [-912.675] -- 0:00:48 197500 -- (-913.267) (-913.220) [-911.074] (-912.419) * [-912.060] (-912.673) (-911.421) (-910.190) -- 0:00:48 198000 -- (-917.623) (-911.057) [-913.613] (-913.473) * (-911.017) [-911.274] (-910.823) (-912.349) -- 0:00:48 198500 -- (-915.998) (-914.258) (-913.101) [-910.595] * (-910.877) (-910.636) (-911.462) [-912.356] -- 0:00:48 199000 -- (-915.407) (-913.383) (-910.918) [-911.546] * (-912.321) [-910.748] (-911.678) (-911.908) -- 0:00:48 199500 -- (-909.597) (-911.921) (-910.875) [-911.893] * [-911.137] (-913.187) (-915.332) (-911.414) -- 0:00:48 200000 -- (-909.575) [-915.920] (-911.674) (-913.455) * (-913.524) (-912.605) [-913.519] (-911.929) -- 0:00:48 Average standard deviation of split frequencies: 0.018676 200500 -- (-912.786) (-911.185) (-913.320) [-913.835] * (-917.911) (-911.204) (-915.339) [-911.940] -- 0:00:47 201000 -- (-912.622) [-911.362] (-911.575) (-912.325) * [-912.828] (-912.303) (-913.837) (-913.221) -- 0:00:47 201500 -- [-911.537] (-912.469) (-914.312) (-911.626) * (-910.512) [-912.323] (-914.152) (-918.479) -- 0:00:47 202000 -- (-910.714) (-912.198) (-916.196) [-911.272] * (-916.647) (-914.626) [-911.941] (-916.473) -- 0:00:47 202500 -- (-911.259) (-912.236) (-913.987) [-912.972] * (-914.051) (-917.142) [-912.525] (-915.484) -- 0:00:47 203000 -- [-910.251] (-912.871) (-911.947) (-910.684) * (-918.859) (-915.008) (-913.080) [-912.853] -- 0:00:47 203500 -- (-910.186) (-915.431) (-916.052) [-912.934] * (-910.241) (-914.813) (-919.388) [-910.584] -- 0:00:46 204000 -- (-910.929) (-913.912) [-912.891] (-912.217) * (-911.932) [-912.222] (-915.519) (-911.672) -- 0:00:46 204500 -- [-910.252] (-913.261) (-913.726) (-914.063) * [-913.427] (-912.900) (-912.130) (-915.011) -- 0:00:46 205000 -- (-911.750) (-911.617) [-912.028] (-912.352) * [-911.520] (-916.493) (-911.816) (-917.051) -- 0:00:50 Average standard deviation of split frequencies: 0.018421 205500 -- (-915.149) (-911.887) [-910.052] (-910.851) * (-913.776) (-912.653) [-912.895] (-913.069) -- 0:00:50 206000 -- (-911.707) [-912.579] (-911.623) (-913.756) * (-914.858) [-910.749] (-911.483) (-913.598) -- 0:00:50 206500 -- (-914.770) (-913.657) [-909.971] (-912.741) * [-912.931] (-911.432) (-914.237) (-910.882) -- 0:00:49 207000 -- (-913.411) [-911.162] (-909.876) (-910.981) * (-910.632) (-912.727) (-912.408) [-910.197] -- 0:00:49 207500 -- (-912.860) [-910.813] (-910.762) (-911.696) * (-911.623) (-910.405) [-910.170] (-912.010) -- 0:00:49 208000 -- (-912.698) (-910.898) [-911.634] (-913.712) * (-910.179) (-910.968) [-914.617] (-914.584) -- 0:00:49 208500 -- (-912.470) (-911.877) (-911.906) [-911.234] * [-911.677] (-909.674) (-914.725) (-914.063) -- 0:00:49 209000 -- (-917.864) (-911.384) (-910.253) [-914.121] * (-911.574) [-911.126] (-911.536) (-913.777) -- 0:00:49 209500 -- (-914.761) (-911.832) [-910.208] (-913.232) * (-917.812) (-911.079) [-910.272] (-911.775) -- 0:00:49 210000 -- (-913.542) (-910.691) (-910.767) [-912.106] * (-920.196) [-911.962] (-913.622) (-910.311) -- 0:00:48 Average standard deviation of split frequencies: 0.018844 210500 -- [-914.630] (-909.687) (-912.124) (-911.871) * (-910.021) (-912.946) (-911.692) [-914.623] -- 0:00:48 211000 -- (-912.582) [-909.781] (-911.615) (-913.051) * (-910.401) [-911.208] (-914.338) (-916.243) -- 0:00:48 211500 -- [-912.135] (-910.857) (-911.725) (-914.060) * (-912.778) (-912.821) (-914.722) [-910.831] -- 0:00:48 212000 -- (-911.861) (-914.780) (-911.392) [-911.608] * (-913.269) [-914.845] (-916.488) (-911.375) -- 0:00:48 212500 -- [-911.349] (-913.953) (-910.970) (-913.453) * (-912.546) (-911.730) (-912.749) [-910.971] -- 0:00:48 213000 -- (-912.306) (-913.133) [-910.550] (-911.012) * (-910.946) [-911.154] (-917.474) (-909.970) -- 0:00:48 213500 -- [-913.288] (-910.678) (-912.239) (-912.495) * (-911.041) [-911.817] (-915.411) (-913.690) -- 0:00:47 214000 -- (-913.721) [-911.035] (-917.002) (-913.440) * [-912.560] (-913.525) (-913.712) (-911.152) -- 0:00:47 214500 -- (-914.472) (-911.051) (-911.253) [-911.149] * [-912.518] (-909.805) (-912.324) (-910.249) -- 0:00:47 215000 -- [-912.344] (-912.458) (-912.409) (-912.924) * (-911.153) (-910.192) (-913.781) [-909.951] -- 0:00:47 Average standard deviation of split frequencies: 0.016974 215500 -- (-913.114) (-911.467) (-913.095) [-914.603] * (-914.309) (-912.774) (-911.492) [-915.717] -- 0:00:47 216000 -- (-914.158) (-911.456) [-911.322] (-910.940) * (-913.898) [-913.748] (-910.630) (-914.872) -- 0:00:47 216500 -- (-913.511) [-914.392] (-911.966) (-912.312) * [-912.903] (-913.974) (-910.034) (-915.390) -- 0:00:47 217000 -- (-917.932) [-911.874] (-913.012) (-912.646) * [-915.709] (-911.703) (-911.399) (-913.586) -- 0:00:46 217500 -- (-914.699) (-910.757) (-912.703) [-910.273] * [-916.513] (-910.185) (-910.598) (-918.035) -- 0:00:46 218000 -- (-914.408) [-911.954] (-911.543) (-911.155) * (-912.730) [-910.134] (-913.694) (-912.626) -- 0:00:46 218500 -- [-915.141] (-910.561) (-913.032) (-912.872) * (-909.987) [-909.984] (-912.422) (-913.985) -- 0:00:46 219000 -- [-914.173] (-912.798) (-911.556) (-914.610) * [-914.210] (-913.572) (-912.963) (-913.477) -- 0:00:46 219500 -- [-913.689] (-911.128) (-912.943) (-913.008) * (-911.929) (-910.241) [-911.343] (-911.279) -- 0:00:46 220000 -- (-912.085) (-913.157) (-919.302) [-911.784] * (-914.303) (-911.242) [-909.916] (-912.162) -- 0:00:46 Average standard deviation of split frequencies: 0.016022 220500 -- (-912.189) [-912.998] (-913.886) (-911.312) * (-912.464) [-911.840] (-910.695) (-912.676) -- 0:00:45 221000 -- (-913.369) (-910.140) [-911.418] (-915.006) * [-913.001] (-911.412) (-911.021) (-910.723) -- 0:00:45 221500 -- (-916.028) [-910.144] (-911.603) (-916.396) * (-911.584) (-916.099) (-912.392) [-910.555] -- 0:00:49 222000 -- (-913.266) (-912.063) [-910.307] (-912.427) * (-912.624) (-911.864) [-910.992] (-914.469) -- 0:00:49 222500 -- (-912.490) (-911.765) [-910.242] (-910.003) * (-911.423) (-913.444) (-913.975) [-911.059] -- 0:00:48 223000 -- (-915.236) [-911.673] (-914.282) (-913.215) * [-910.049] (-912.491) (-913.776) (-913.540) -- 0:00:48 223500 -- [-911.983] (-912.643) (-911.619) (-913.810) * (-912.947) (-914.312) [-912.323] (-911.050) -- 0:00:48 224000 -- (-910.964) (-912.957) (-911.920) [-913.488] * (-911.170) (-910.482) [-912.650] (-910.842) -- 0:00:48 224500 -- (-913.829) (-910.126) [-913.316] (-910.935) * (-913.032) [-910.099] (-912.751) (-913.221) -- 0:00:48 225000 -- (-913.358) (-912.429) (-912.539) [-914.135] * (-911.284) (-910.956) (-912.269) [-910.265] -- 0:00:48 Average standard deviation of split frequencies: 0.016223 225500 -- [-912.111] (-912.905) (-912.057) (-916.705) * (-911.950) (-910.503) [-912.039] (-909.820) -- 0:00:48 226000 -- [-911.903] (-914.052) (-911.193) (-918.212) * (-916.280) [-916.203] (-910.495) (-911.884) -- 0:00:47 226500 -- (-913.717) [-911.773] (-911.566) (-913.261) * [-917.182] (-913.584) (-912.587) (-909.863) -- 0:00:47 227000 -- (-914.532) (-911.760) [-910.727] (-912.578) * [-915.583] (-910.506) (-912.951) (-913.151) -- 0:00:47 227500 -- [-910.836] (-913.114) (-910.541) (-911.883) * [-910.676] (-910.360) (-912.581) (-910.409) -- 0:00:47 228000 -- (-912.196) [-911.370] (-911.951) (-911.802) * (-913.006) (-910.200) [-910.965] (-911.879) -- 0:00:47 228500 -- (-912.158) (-913.834) (-912.144) [-910.787] * (-911.508) (-911.697) [-909.837] (-913.007) -- 0:00:47 229000 -- (-911.581) (-912.986) (-912.035) [-911.883] * (-912.214) (-912.668) (-911.679) [-911.663] -- 0:00:47 229500 -- (-914.721) (-910.674) (-913.915) [-911.816] * (-912.983) (-915.567) (-911.793) [-910.934] -- 0:00:47 230000 -- (-918.644) (-911.081) (-913.418) [-911.012] * (-911.559) [-911.688] (-914.032) (-913.434) -- 0:00:46 Average standard deviation of split frequencies: 0.016690 230500 -- [-910.810] (-911.034) (-914.275) (-910.938) * [-911.777] (-910.228) (-913.231) (-916.614) -- 0:00:46 231000 -- [-910.094] (-912.068) (-913.475) (-910.285) * (-912.306) (-911.346) (-910.338) [-913.926] -- 0:00:46 231500 -- (-913.270) [-911.829] (-913.631) (-912.882) * (-910.905) (-913.924) (-910.358) [-912.472] -- 0:00:46 232000 -- (-911.602) [-910.680] (-912.384) (-910.120) * (-915.480) (-911.977) (-911.068) [-910.169] -- 0:00:46 232500 -- (-912.333) (-909.975) [-910.366] (-911.535) * (-911.351) (-911.081) [-909.830] (-909.809) -- 0:00:46 233000 -- (-912.071) [-910.584] (-914.432) (-914.181) * (-914.098) (-910.521) (-912.529) [-913.301] -- 0:00:46 233500 -- (-911.188) [-910.695] (-916.133) (-911.967) * [-913.860] (-910.932) (-912.066) (-912.249) -- 0:00:45 234000 -- (-913.607) [-912.541] (-914.007) (-914.231) * (-910.820) [-909.990] (-912.117) (-917.643) -- 0:00:45 234500 -- (-913.187) (-911.926) (-913.179) [-912.580] * (-910.839) (-909.671) (-913.596) [-912.631] -- 0:00:45 235000 -- [-909.984] (-912.745) (-910.437) (-910.315) * (-914.108) [-913.582] (-912.446) (-914.907) -- 0:00:45 Average standard deviation of split frequencies: 0.016091 235500 -- (-910.941) (-913.237) (-910.604) [-910.968] * (-910.815) (-912.884) (-914.305) [-912.142] -- 0:00:45 236000 -- (-910.645) (-913.814) (-909.530) [-910.194] * (-912.107) (-915.600) [-914.641] (-911.749) -- 0:00:45 236500 -- (-911.838) (-911.323) (-909.920) [-910.466] * [-911.615] (-917.019) (-914.797) (-913.322) -- 0:00:45 237000 -- (-910.809) [-911.187] (-909.646) (-912.757) * [-912.398] (-916.330) (-911.742) (-912.332) -- 0:00:45 237500 -- (-910.206) (-911.319) [-910.030] (-911.789) * (-913.213) [-910.933] (-912.553) (-910.945) -- 0:00:44 238000 -- [-911.621] (-912.268) (-911.006) (-913.643) * (-910.768) (-915.469) [-911.153] (-914.079) -- 0:00:48 238500 -- (-913.184) [-909.969] (-911.801) (-914.463) * (-911.845) (-913.189) (-912.881) [-913.439] -- 0:00:47 239000 -- (-911.521) (-909.858) [-912.694] (-912.692) * [-912.243] (-911.551) (-912.154) (-913.391) -- 0:00:47 239500 -- (-913.442) (-909.842) (-913.844) [-911.901] * (-911.124) (-913.838) (-910.043) [-911.556] -- 0:00:47 240000 -- (-911.286) [-911.586] (-911.096) (-912.875) * (-910.457) [-911.735] (-910.043) (-914.461) -- 0:00:47 Average standard deviation of split frequencies: 0.015670 240500 -- [-910.276] (-912.271) (-911.157) (-914.796) * (-912.734) [-911.905] (-909.995) (-912.480) -- 0:00:47 241000 -- (-914.127) (-912.370) (-911.036) [-912.699] * [-911.476] (-910.449) (-909.995) (-911.899) -- 0:00:47 241500 -- [-914.449] (-912.226) (-911.466) (-912.069) * (-911.807) (-913.524) [-909.992] (-913.351) -- 0:00:47 242000 -- [-912.142] (-912.214) (-911.332) (-912.429) * [-912.088] (-911.839) (-913.958) (-912.313) -- 0:00:46 242500 -- (-911.961) [-910.454] (-913.329) (-914.743) * (-910.950) (-913.709) [-914.245] (-915.279) -- 0:00:46 243000 -- (-917.328) (-910.454) [-910.846] (-914.788) * (-913.597) [-911.877] (-910.627) (-916.812) -- 0:00:46 243500 -- (-913.888) [-909.827] (-914.961) (-910.102) * (-915.536) (-914.440) [-910.620] (-916.455) -- 0:00:46 244000 -- (-915.498) (-911.273) [-913.096] (-910.127) * (-913.007) [-914.051] (-912.337) (-912.266) -- 0:00:46 244500 -- [-911.146] (-912.151) (-911.176) (-911.251) * (-910.242) (-916.407) [-913.151] (-910.759) -- 0:00:46 245000 -- (-912.850) [-910.170] (-911.616) (-911.017) * (-910.874) [-911.385] (-914.421) (-910.774) -- 0:00:46 Average standard deviation of split frequencies: 0.015028 245500 -- [-914.113] (-914.163) (-912.672) (-911.813) * [-916.954] (-914.626) (-913.465) (-910.528) -- 0:00:46 246000 -- [-912.994] (-913.508) (-910.349) (-910.977) * [-911.797] (-912.107) (-912.505) (-911.317) -- 0:00:45 246500 -- [-913.640] (-911.894) (-910.510) (-914.417) * (-910.342) (-911.885) [-914.824] (-911.504) -- 0:00:45 247000 -- (-915.327) (-911.748) [-911.283] (-911.385) * (-911.184) (-910.675) (-916.246) [-911.767] -- 0:00:45 247500 -- (-911.158) (-913.154) (-911.040) [-911.416] * [-916.912] (-914.120) (-919.658) (-911.067) -- 0:00:45 248000 -- (-911.695) (-914.776) [-914.856] (-912.180) * (-911.485) [-912.988] (-916.829) (-911.568) -- 0:00:45 248500 -- (-914.455) (-911.759) [-914.280] (-913.355) * (-911.296) (-910.813) [-915.850] (-916.287) -- 0:00:45 249000 -- (-914.115) [-912.221] (-911.300) (-911.848) * (-910.141) [-912.646] (-911.018) (-912.573) -- 0:00:45 249500 -- (-916.050) (-911.886) (-915.217) [-912.577] * (-913.380) [-911.199] (-916.841) (-914.469) -- 0:00:45 250000 -- (-913.377) [-911.155] (-913.491) (-913.090) * (-912.780) (-910.782) [-910.242] (-913.579) -- 0:00:45 Average standard deviation of split frequencies: 0.014313 250500 -- (-913.956) [-910.659] (-913.780) (-910.414) * (-915.265) (-910.732) (-912.032) [-912.606] -- 0:00:44 251000 -- (-913.785) [-911.416] (-911.364) (-912.122) * (-910.131) (-911.105) [-912.432] (-913.487) -- 0:00:44 251500 -- (-912.782) (-910.899) [-911.429] (-914.299) * (-910.642) (-911.533) [-912.447] (-912.017) -- 0:00:44 252000 -- [-911.222] (-911.011) (-910.527) (-912.101) * (-912.095) [-911.284] (-911.752) (-911.340) -- 0:00:44 252500 -- (-912.567) [-912.320] (-911.664) (-912.967) * (-911.483) (-913.211) (-910.282) [-910.469] -- 0:00:44 253000 -- (-910.371) [-911.447] (-912.433) (-911.632) * [-913.802] (-911.633) (-912.711) (-913.491) -- 0:00:44 253500 -- (-911.930) (-911.939) (-912.968) [-911.062] * (-911.936) (-911.547) (-912.393) [-913.110] -- 0:00:44 254000 -- (-910.981) [-913.914] (-911.981) (-911.008) * [-915.079] (-912.919) (-911.327) (-912.060) -- 0:00:44 254500 -- (-911.810) (-911.163) (-911.082) [-913.940] * (-915.029) (-910.879) [-911.969] (-911.496) -- 0:00:46 255000 -- (-911.229) [-911.533] (-910.740) (-919.338) * (-911.851) (-912.118) (-909.973) [-911.903] -- 0:00:46 Average standard deviation of split frequencies: 0.013811 255500 -- (-911.277) (-912.610) [-911.919] (-914.821) * [-911.086] (-912.127) (-912.371) (-911.019) -- 0:00:46 256000 -- (-914.746) [-912.252] (-910.347) (-919.043) * (-910.907) (-912.099) (-912.749) [-910.080] -- 0:00:46 256500 -- (-912.438) [-912.960] (-910.494) (-912.620) * (-910.518) (-910.150) (-913.949) [-912.848] -- 0:00:46 257000 -- (-911.278) (-910.513) [-911.160] (-915.377) * (-911.015) (-913.885) (-914.769) [-910.048] -- 0:00:46 257500 -- (-912.197) [-910.393] (-910.809) (-912.728) * (-910.974) (-910.510) (-914.315) [-912.130] -- 0:00:46 258000 -- [-910.759] (-911.215) (-917.321) (-911.498) * (-914.160) (-910.666) (-913.181) [-911.062] -- 0:00:46 258500 -- (-910.943) (-914.569) (-910.115) [-911.957] * (-911.094) (-912.175) [-912.585] (-911.473) -- 0:00:45 259000 -- (-910.213) (-914.768) [-910.282] (-911.197) * (-911.027) (-911.512) [-912.598] (-914.933) -- 0:00:45 259500 -- (-911.104) (-911.873) (-911.497) [-912.762] * (-911.278) (-910.967) (-911.702) [-911.209] -- 0:00:45 260000 -- [-910.744] (-910.184) (-911.517) (-912.087) * (-912.007) (-912.318) (-910.723) [-911.609] -- 0:00:45 Average standard deviation of split frequencies: 0.013897 260500 -- (-911.458) (-910.477) (-910.586) [-910.445] * (-912.823) [-911.477] (-910.225) (-914.373) -- 0:00:45 261000 -- (-913.164) [-910.379] (-911.401) (-911.311) * (-913.003) (-914.863) [-912.548] (-914.221) -- 0:00:45 261500 -- (-910.189) [-910.307] (-911.497) (-911.334) * (-911.677) (-910.530) (-910.109) [-916.590] -- 0:00:45 262000 -- (-913.650) (-911.694) (-910.824) [-909.949] * (-912.533) (-911.998) [-909.965] (-912.298) -- 0:00:45 262500 -- (-911.075) (-912.109) (-911.272) [-910.029] * [-913.783] (-909.980) (-910.853) (-910.994) -- 0:00:44 263000 -- [-909.998] (-910.957) (-912.022) (-910.064) * (-912.204) [-910.490] (-909.799) (-910.958) -- 0:00:44 263500 -- (-910.687) (-913.496) (-910.727) [-909.847] * [-912.515] (-910.644) (-913.022) (-914.571) -- 0:00:44 264000 -- [-911.619] (-912.904) (-910.757) (-910.897) * [-910.483] (-913.914) (-913.114) (-912.758) -- 0:00:44 264500 -- (-911.054) (-910.406) [-911.638] (-913.413) * (-911.243) (-911.388) [-915.830] (-916.984) -- 0:00:44 265000 -- (-913.352) (-911.538) [-911.548] (-913.264) * [-909.854] (-911.698) (-910.263) (-915.334) -- 0:00:44 Average standard deviation of split frequencies: 0.013618 265500 -- [-912.729] (-912.576) (-910.177) (-913.274) * (-911.788) (-913.343) (-911.978) [-916.653] -- 0:00:44 266000 -- (-916.550) (-912.944) (-913.894) [-912.018] * (-910.823) [-910.570] (-911.936) (-912.927) -- 0:00:44 266500 -- (-910.764) (-913.864) [-914.861] (-915.296) * (-912.014) [-910.348] (-911.210) (-913.328) -- 0:00:44 267000 -- (-911.568) (-913.375) [-913.768] (-910.774) * (-913.820) [-911.275] (-910.611) (-913.500) -- 0:00:43 267500 -- (-910.863) (-911.741) [-910.382] (-910.389) * (-912.001) (-913.750) [-911.590] (-912.486) -- 0:00:43 268000 -- (-911.082) (-910.491) [-911.871] (-911.991) * [-911.495] (-915.025) (-914.582) (-910.193) -- 0:00:43 268500 -- (-910.900) (-910.454) [-915.861] (-912.089) * (-909.986) (-924.448) (-911.389) [-911.144] -- 0:00:43 269000 -- (-910.392) (-912.187) (-914.038) [-914.561] * [-910.490] (-914.732) (-913.752) (-911.746) -- 0:00:43 269500 -- [-913.007] (-912.258) (-912.729) (-912.871) * (-916.208) (-909.963) (-911.462) [-912.855] -- 0:00:43 270000 -- (-912.392) (-911.273) (-913.981) [-910.753] * (-914.068) (-914.062) [-910.242] (-911.838) -- 0:00:43 Average standard deviation of split frequencies: 0.011372 270500 -- (-910.682) (-912.003) [-911.204] (-911.681) * (-912.003) [-911.145] (-912.630) (-912.649) -- 0:00:43 271000 -- (-911.207) (-915.402) [-911.621] (-912.050) * (-911.318) (-913.613) [-913.304] (-916.303) -- 0:00:45 271500 -- (-912.600) (-911.149) (-911.382) [-914.236] * (-911.163) [-911.726] (-913.122) (-912.557) -- 0:00:45 272000 -- [-917.464] (-911.368) (-913.908) (-914.350) * (-914.926) (-913.307) [-913.302] (-910.516) -- 0:00:45 272500 -- (-912.488) [-911.348] (-914.819) (-910.806) * (-919.859) [-910.284] (-910.913) (-910.178) -- 0:00:45 273000 -- (-916.371) (-911.311) (-911.718) [-912.193] * (-916.225) (-910.940) (-911.271) [-911.165] -- 0:00:45 273500 -- (-912.575) (-914.550) [-911.442] (-913.465) * (-913.469) (-910.880) [-911.522] (-912.271) -- 0:00:45 274000 -- (-913.427) (-913.726) [-910.939] (-910.352) * (-914.507) [-910.339] (-910.285) (-911.858) -- 0:00:45 274500 -- (-912.071) (-910.466) (-911.354) [-910.503] * (-921.011) [-909.880] (-910.836) (-912.193) -- 0:00:44 275000 -- (-911.655) [-911.875] (-911.974) (-912.135) * [-911.838] (-913.945) (-913.699) (-915.598) -- 0:00:44 Average standard deviation of split frequencies: 0.011253 275500 -- (-915.800) (-909.827) (-910.395) [-910.148] * (-912.345) (-912.416) [-909.759] (-910.683) -- 0:00:44 276000 -- (-915.551) (-912.394) [-910.138] (-910.819) * (-919.419) (-912.158) (-910.580) [-910.986] -- 0:00:44 276500 -- (-920.057) (-911.747) (-911.408) [-911.714] * (-912.627) [-912.739] (-913.175) (-912.201) -- 0:00:44 277000 -- (-917.618) (-910.021) (-912.621) [-910.023] * (-912.962) (-911.229) [-913.235] (-909.904) -- 0:00:44 277500 -- (-915.168) (-911.555) (-913.966) [-909.660] * (-913.937) [-911.804] (-912.926) (-911.193) -- 0:00:44 278000 -- (-911.434) (-910.354) (-912.069) [-911.657] * (-914.331) (-913.853) [-914.808] (-910.769) -- 0:00:44 278500 -- [-912.945] (-910.494) (-913.542) (-912.047) * (-913.362) [-912.302] (-912.247) (-912.923) -- 0:00:44 279000 -- (-914.368) [-911.192] (-916.044) (-912.247) * (-911.498) [-910.127] (-914.014) (-909.883) -- 0:00:43 279500 -- [-912.802] (-912.541) (-915.877) (-913.131) * (-911.159) [-910.810] (-913.000) (-910.368) -- 0:00:43 280000 -- (-910.961) [-911.257] (-911.801) (-911.785) * [-910.172] (-912.692) (-913.666) (-911.292) -- 0:00:43 Average standard deviation of split frequencies: 0.009781 280500 -- [-911.232] (-910.296) (-911.725) (-918.941) * [-912.746] (-912.986) (-917.449) (-910.677) -- 0:00:43 281000 -- (-911.219) [-912.444] (-910.144) (-915.424) * (-914.615) (-911.967) (-913.994) [-913.409] -- 0:00:43 281500 -- [-915.171] (-916.733) (-911.564) (-910.600) * (-911.131) (-910.761) (-910.808) [-911.744] -- 0:00:43 282000 -- (-911.580) [-915.155] (-913.427) (-912.670) * (-913.246) [-911.361] (-910.335) (-916.063) -- 0:00:43 282500 -- (-914.857) (-912.058) [-912.406] (-912.694) * (-911.573) [-911.364] (-913.054) (-914.714) -- 0:00:43 283000 -- (-914.746) (-913.494) [-913.018] (-913.274) * [-911.926] (-912.940) (-910.361) (-910.486) -- 0:00:43 283500 -- (-912.575) (-913.089) (-912.718) [-910.349] * (-912.718) [-911.713] (-910.386) (-910.189) -- 0:00:42 284000 -- (-914.378) [-912.575] (-913.173) (-910.154) * (-910.317) (-911.689) (-910.244) [-912.568] -- 0:00:42 284500 -- (-914.909) (-916.567) (-913.906) [-911.935] * (-911.731) (-910.054) (-911.248) [-913.936] -- 0:00:42 285000 -- (-915.288) [-913.253] (-914.965) (-911.306) * (-912.422) (-911.985) [-910.376] (-911.635) -- 0:00:42 Average standard deviation of split frequencies: 0.009017 285500 -- [-910.684] (-912.807) (-911.091) (-912.367) * (-912.447) (-910.313) (-910.380) [-910.785] -- 0:00:42 286000 -- (-912.197) [-910.483] (-913.298) (-911.505) * (-912.353) (-911.914) (-911.728) [-913.885] -- 0:00:42 286500 -- (-911.049) (-910.466) (-911.120) [-912.414] * (-914.452) [-912.816] (-913.973) (-913.945) -- 0:00:42 287000 -- (-911.204) [-910.650] (-910.526) (-911.759) * [-910.844] (-911.413) (-914.468) (-912.142) -- 0:00:42 287500 -- (-911.298) [-912.399] (-912.541) (-910.978) * (-910.135) (-910.573) [-910.956] (-910.885) -- 0:00:44 288000 -- (-911.140) (-912.853) (-910.921) [-911.243] * (-909.936) (-910.479) [-913.632] (-910.536) -- 0:00:44 288500 -- [-911.587] (-911.180) (-912.201) (-911.945) * [-911.223] (-913.101) (-913.269) (-910.588) -- 0:00:44 289000 -- [-912.369] (-916.681) (-911.879) (-910.171) * (-911.057) (-913.653) (-915.307) [-910.322] -- 0:00:44 289500 -- (-912.977) (-920.961) (-911.216) [-913.431] * (-912.277) (-913.207) [-911.815] (-910.464) -- 0:00:44 290000 -- (-914.145) [-911.970] (-912.684) (-914.368) * [-912.717] (-912.553) (-910.941) (-915.137) -- 0:00:44 Average standard deviation of split frequencies: 0.008586 290500 -- (-916.239) (-911.003) (-911.350) [-914.170] * [-910.810] (-912.789) (-911.346) (-911.950) -- 0:00:43 291000 -- (-911.464) (-911.893) [-913.123] (-912.337) * [-911.243] (-912.465) (-917.327) (-911.475) -- 0:00:43 291500 -- (-912.071) (-911.775) [-911.329] (-914.791) * [-912.541] (-918.462) (-916.688) (-912.848) -- 0:00:43 292000 -- (-912.764) [-915.333] (-909.756) (-911.467) * (-911.421) (-919.383) [-911.977] (-911.049) -- 0:00:43 292500 -- (-911.834) (-912.175) [-909.887] (-911.560) * (-913.773) [-914.097] (-910.512) (-912.014) -- 0:00:43 293000 -- (-914.116) (-913.988) [-910.061] (-911.606) * (-911.361) (-911.125) [-910.933] (-910.820) -- 0:00:43 293500 -- (-919.420) [-912.081] (-912.533) (-913.083) * [-912.239] (-911.415) (-912.378) (-913.982) -- 0:00:43 294000 -- [-913.456] (-910.928) (-917.776) (-911.974) * (-912.726) [-910.840] (-914.700) (-911.901) -- 0:00:43 294500 -- (-910.599) [-912.037] (-911.218) (-911.789) * (-912.652) (-910.925) [-911.358] (-909.762) -- 0:00:43 295000 -- (-910.211) (-913.311) (-911.212) [-911.395] * [-910.275] (-910.661) (-910.841) (-914.475) -- 0:00:43 Average standard deviation of split frequencies: 0.008806 295500 -- (-912.317) (-912.070) (-911.154) [-910.621] * (-912.103) (-914.130) [-911.002] (-912.067) -- 0:00:42 296000 -- [-912.832] (-912.488) (-912.516) (-912.485) * (-913.760) (-913.163) (-912.374) [-913.319] -- 0:00:42 296500 -- (-916.091) (-913.175) [-913.514] (-914.256) * (-914.536) (-911.621) (-912.728) [-911.785] -- 0:00:42 297000 -- (-910.482) (-913.058) [-910.131] (-913.570) * (-911.638) (-913.921) [-910.307] (-914.110) -- 0:00:42 297500 -- (-910.323) (-910.490) [-911.082] (-911.408) * (-911.205) [-910.968] (-913.493) (-911.016) -- 0:00:42 298000 -- (-915.804) (-911.881) [-913.846] (-911.754) * (-911.466) [-910.410] (-910.794) (-910.820) -- 0:00:42 298500 -- (-914.064) (-911.769) (-916.176) [-910.263] * (-916.798) (-911.828) (-911.060) [-913.923] -- 0:00:42 299000 -- [-912.495] (-910.454) (-912.206) (-914.199) * [-911.620] (-910.961) (-910.636) (-912.823) -- 0:00:42 299500 -- (-911.877) (-910.396) (-913.867) [-911.463] * (-915.218) [-910.668] (-916.231) (-913.170) -- 0:00:42 300000 -- (-911.454) (-910.147) (-911.409) [-911.556] * [-911.119] (-911.041) (-912.768) (-913.705) -- 0:00:42 Average standard deviation of split frequencies: 0.008035 300500 -- [-909.792] (-912.345) (-914.809) (-911.793) * (-911.090) (-910.857) [-911.246] (-914.486) -- 0:00:41 301000 -- (-910.483) (-910.275) (-912.744) [-911.791] * (-911.754) (-911.790) (-911.335) [-911.634] -- 0:00:41 301500 -- (-912.605) [-912.011] (-910.573) (-912.422) * (-913.286) [-911.584] (-910.863) (-911.809) -- 0:00:41 302000 -- [-911.596] (-914.992) (-910.992) (-913.727) * (-911.411) [-910.848] (-912.470) (-913.371) -- 0:00:41 302500 -- [-911.121] (-911.448) (-910.506) (-914.538) * (-910.565) (-914.743) (-912.035) [-911.914] -- 0:00:41 303000 -- [-910.381] (-911.346) (-913.529) (-912.372) * (-910.392) (-911.360) (-914.941) [-910.669] -- 0:00:41 303500 -- (-913.433) [-911.307] (-913.506) (-915.119) * (-911.243) (-911.812) (-918.370) [-910.504] -- 0:00:43 304000 -- (-910.865) (-913.538) [-909.646] (-914.161) * (-910.496) [-911.508] (-912.347) (-912.276) -- 0:00:43 304500 -- (-910.876) (-911.715) [-911.086] (-913.764) * (-910.597) [-912.531] (-913.627) (-910.947) -- 0:00:43 305000 -- [-910.852] (-911.786) (-910.939) (-914.586) * (-910.821) [-914.316] (-910.849) (-916.593) -- 0:00:43 Average standard deviation of split frequencies: 0.010013 305500 -- (-916.649) (-910.363) [-913.629] (-913.817) * (-911.221) [-912.441] (-914.214) (-912.436) -- 0:00:43 306000 -- (-911.852) (-914.190) [-911.375] (-914.133) * [-910.977] (-912.450) (-913.573) (-910.529) -- 0:00:43 306500 -- (-912.714) (-915.086) (-917.230) [-912.501] * [-912.913] (-912.024) (-914.336) (-911.827) -- 0:00:42 307000 -- (-916.169) (-915.306) (-916.367) [-911.885] * (-911.943) (-913.712) (-914.267) [-910.562] -- 0:00:42 307500 -- (-912.726) [-912.857] (-912.133) (-911.568) * (-912.046) [-911.651] (-913.385) (-913.318) -- 0:00:42 308000 -- (-911.168) (-914.054) [-912.018] (-915.654) * (-911.890) (-913.402) [-911.396] (-913.057) -- 0:00:42 308500 -- (-910.701) [-913.212] (-912.498) (-914.835) * (-912.055) (-910.823) [-911.356] (-910.980) -- 0:00:42 309000 -- (-910.530) (-911.496) [-910.232] (-911.719) * [-914.215] (-910.848) (-915.283) (-914.986) -- 0:00:42 309500 -- (-912.347) [-911.296] (-910.118) (-912.859) * (-915.402) [-910.682] (-913.994) (-910.913) -- 0:00:42 310000 -- (-911.152) [-915.839] (-910.287) (-913.329) * (-911.891) (-910.693) [-912.955] (-914.284) -- 0:00:42 Average standard deviation of split frequencies: 0.010453 310500 -- (-913.564) (-913.422) [-912.715] (-912.787) * [-912.635] (-910.570) (-912.651) (-911.637) -- 0:00:42 311000 -- (-909.987) (-913.468) (-913.897) [-911.733] * [-910.910] (-913.528) (-910.046) (-912.179) -- 0:00:42 311500 -- (-911.825) [-912.398] (-914.579) (-912.163) * (-915.771) (-913.611) [-910.500] (-911.965) -- 0:00:41 312000 -- (-911.510) (-912.667) (-910.120) [-911.867] * [-912.340] (-913.427) (-911.507) (-911.584) -- 0:00:41 312500 -- (-911.503) (-913.816) [-910.352] (-910.939) * (-912.674) (-913.226) (-912.446) [-910.821] -- 0:00:41 313000 -- [-912.482] (-912.394) (-909.881) (-911.136) * (-912.163) (-912.413) (-911.468) [-911.339] -- 0:00:41 313500 -- (-913.748) (-914.971) [-911.198] (-915.848) * (-911.100) (-912.235) [-911.003] (-911.456) -- 0:00:41 314000 -- (-911.498) [-915.812] (-911.068) (-912.756) * (-910.465) (-914.286) [-911.061] (-916.234) -- 0:00:41 314500 -- (-910.648) (-913.760) [-911.488] (-914.512) * [-914.015] (-915.325) (-913.734) (-912.379) -- 0:00:41 315000 -- (-912.883) [-910.622] (-913.229) (-911.997) * (-913.813) (-910.927) (-911.446) [-910.597] -- 0:00:41 Average standard deviation of split frequencies: 0.011520 315500 -- (-912.213) (-910.700) [-913.975] (-911.057) * [-911.218] (-916.490) (-911.716) (-910.844) -- 0:00:41 316000 -- (-910.369) [-910.666] (-914.253) (-912.146) * (-910.886) (-912.304) [-911.509] (-910.633) -- 0:00:41 316500 -- (-910.352) [-910.224] (-913.661) (-914.604) * (-912.035) (-913.629) (-914.657) [-910.714] -- 0:00:41 317000 -- [-911.428] (-909.658) (-911.851) (-911.683) * [-910.364] (-910.070) (-915.564) (-910.241) -- 0:00:40 317500 -- (-913.130) [-911.199] (-910.959) (-913.794) * (-910.772) (-910.740) [-911.115] (-912.633) -- 0:00:40 318000 -- (-913.301) [-910.828] (-910.440) (-914.825) * (-912.546) (-910.788) [-909.840] (-911.440) -- 0:00:40 318500 -- (-911.608) [-912.770] (-911.750) (-914.333) * (-915.834) [-910.267] (-912.693) (-914.525) -- 0:00:40 319000 -- (-913.480) [-912.745] (-915.720) (-911.387) * (-911.263) (-911.681) [-909.834] (-911.717) -- 0:00:40 319500 -- (-911.785) [-913.010] (-911.304) (-911.751) * [-911.264] (-911.824) (-910.947) (-912.484) -- 0:00:40 320000 -- (-914.434) (-910.056) (-913.517) [-911.517] * (-910.647) [-911.910] (-910.753) (-911.310) -- 0:00:42 Average standard deviation of split frequencies: 0.009719 320500 -- (-910.994) (-910.112) (-911.559) [-910.433] * [-911.476] (-914.144) (-910.443) (-910.812) -- 0:00:42 321000 -- (-911.662) [-909.758] (-913.358) (-910.443) * (-911.845) (-913.085) [-913.566] (-911.308) -- 0:00:42 321500 -- (-912.785) [-909.899] (-911.422) (-913.385) * (-914.532) (-910.960) (-912.248) [-911.834] -- 0:00:42 322000 -- [-913.730] (-910.239) (-911.583) (-912.799) * (-912.611) (-912.096) (-913.195) [-911.434] -- 0:00:42 322500 -- (-912.007) [-911.303] (-911.455) (-912.703) * (-909.908) [-912.501] (-910.673) (-911.538) -- 0:00:42 323000 -- (-913.376) [-910.413] (-915.473) (-912.015) * (-910.470) [-910.813] (-913.491) (-914.336) -- 0:00:41 323500 -- (-909.986) (-911.724) [-914.772] (-913.379) * [-910.471] (-914.118) (-913.015) (-918.649) -- 0:00:41 324000 -- (-911.185) [-911.979] (-916.477) (-911.067) * [-910.938] (-912.237) (-913.453) (-913.115) -- 0:00:41 324500 -- [-910.031] (-910.319) (-913.238) (-912.684) * (-912.593) (-911.967) (-911.411) [-910.530] -- 0:00:41 325000 -- (-911.334) (-911.654) [-915.189] (-911.611) * [-915.445] (-914.330) (-912.112) (-913.793) -- 0:00:41 Average standard deviation of split frequencies: 0.009640 325500 -- [-911.409] (-912.198) (-917.237) (-911.617) * (-911.400) [-911.505] (-912.525) (-912.032) -- 0:00:41 326000 -- (-912.711) (-913.014) (-913.765) [-911.594] * [-912.824] (-912.331) (-911.516) (-912.119) -- 0:00:41 326500 -- (-909.596) (-913.373) [-912.693] (-914.556) * [-913.200] (-913.355) (-920.081) (-915.730) -- 0:00:41 327000 -- (-910.355) (-910.819) (-911.576) [-919.943] * (-912.373) [-912.969] (-916.541) (-910.923) -- 0:00:41 327500 -- (-916.066) (-910.485) (-913.330) [-911.832] * (-912.006) (-912.338) (-913.299) [-911.715] -- 0:00:41 328000 -- [-913.234] (-909.872) (-917.687) (-912.010) * [-913.631] (-910.255) (-912.372) (-911.293) -- 0:00:40 328500 -- [-912.093] (-911.009) (-912.507) (-910.869) * (-913.085) (-911.148) (-913.436) [-911.720] -- 0:00:40 329000 -- (-913.780) (-912.731) [-909.942] (-911.918) * (-910.632) (-910.235) [-911.850] (-911.774) -- 0:00:40 329500 -- [-911.687] (-910.846) (-913.365) (-913.393) * (-912.623) (-911.370) [-913.954] (-914.288) -- 0:00:40 330000 -- (-911.290) (-910.877) [-911.638] (-910.205) * (-914.054) [-911.521] (-911.215) (-912.638) -- 0:00:40 Average standard deviation of split frequencies: 0.010217 330500 -- (-909.962) (-910.113) (-916.455) [-910.191] * (-911.596) (-912.620) [-912.708] (-911.200) -- 0:00:40 331000 -- (-909.870) [-914.320] (-915.983) (-911.218) * (-911.188) (-912.985) [-914.469] (-915.574) -- 0:00:40 331500 -- [-911.672] (-914.106) (-912.423) (-911.769) * (-912.690) [-913.623] (-912.680) (-911.743) -- 0:00:40 332000 -- (-911.291) (-910.962) [-911.445] (-911.407) * (-910.557) [-910.536] (-911.554) (-910.367) -- 0:00:40 332500 -- (-911.959) (-914.037) [-917.837] (-914.686) * (-911.016) (-911.267) [-910.153] (-912.184) -- 0:00:40 333000 -- [-910.030] (-911.251) (-912.730) (-911.770) * (-911.217) [-910.974] (-915.931) (-911.621) -- 0:00:40 333500 -- [-911.661] (-915.057) (-912.486) (-912.218) * (-911.035) [-910.365] (-912.496) (-911.140) -- 0:00:39 334000 -- [-910.696] (-912.588) (-915.348) (-912.592) * (-910.187) (-910.906) [-910.881] (-910.928) -- 0:00:39 334500 -- (-910.844) (-912.024) (-913.227) [-912.175] * [-911.282] (-911.314) (-913.129) (-910.033) -- 0:00:39 335000 -- [-913.261] (-915.504) (-913.697) (-915.082) * [-915.581] (-913.972) (-910.030) (-911.434) -- 0:00:39 Average standard deviation of split frequencies: 0.009587 335500 -- [-912.240] (-914.106) (-912.234) (-915.029) * (-914.494) (-910.916) [-912.285] (-910.516) -- 0:00:39 336000 -- (-911.568) (-912.214) [-912.865] (-913.415) * (-911.036) [-911.956] (-910.050) (-909.970) -- 0:00:39 336500 -- (-911.012) [-911.198] (-913.433) (-910.582) * (-911.879) (-914.431) [-910.770] (-911.422) -- 0:00:41 337000 -- (-912.328) [-911.452] (-914.900) (-913.649) * (-914.482) [-910.452] (-911.429) (-911.080) -- 0:00:41 337500 -- (-910.465) (-913.145) (-912.475) [-917.716] * (-916.053) [-912.396] (-911.156) (-914.272) -- 0:00:41 338000 -- (-921.753) (-911.159) (-912.654) [-918.091] * (-911.647) [-912.069] (-910.807) (-911.952) -- 0:00:41 338500 -- (-915.865) (-910.332) (-909.847) [-913.549] * (-911.445) (-913.912) [-913.289] (-913.805) -- 0:00:41 339000 -- (-911.696) (-911.078) (-910.238) [-911.788] * [-913.953] (-915.308) (-913.103) (-910.613) -- 0:00:40 339500 -- (-910.658) [-910.287] (-912.940) (-911.603) * [-911.290] (-912.332) (-912.537) (-910.656) -- 0:00:40 340000 -- [-909.800] (-910.641) (-912.612) (-912.230) * [-912.071] (-913.862) (-912.765) (-912.179) -- 0:00:40 Average standard deviation of split frequencies: 0.010093 340500 -- (-912.318) (-909.960) [-913.241] (-910.276) * [-910.923] (-913.288) (-914.263) (-909.905) -- 0:00:40 341000 -- [-910.069] (-911.096) (-910.375) (-911.365) * (-911.678) (-911.648) [-910.598] (-913.699) -- 0:00:40 341500 -- (-911.888) (-910.764) [-912.677] (-911.343) * (-910.611) (-910.168) [-912.560] (-913.854) -- 0:00:40 342000 -- (-911.605) (-914.283) (-912.229) [-911.023] * (-911.144) (-910.629) (-912.243) [-912.378] -- 0:00:40 342500 -- [-911.552] (-911.909) (-912.528) (-910.371) * (-912.185) (-912.351) [-913.720] (-910.773) -- 0:00:40 343000 -- (-910.589) [-911.346] (-913.493) (-911.075) * (-911.768) (-910.020) [-912.088] (-910.409) -- 0:00:40 343500 -- (-912.639) [-913.763] (-911.900) (-910.763) * (-911.808) (-910.668) (-912.006) [-911.519] -- 0:00:40 344000 -- (-911.155) (-913.291) (-911.812) [-911.033] * [-911.886] (-915.865) (-910.552) (-911.325) -- 0:00:40 344500 -- (-909.614) (-914.425) (-913.659) [-912.222] * (-914.577) (-913.779) (-910.933) [-911.104] -- 0:00:39 345000 -- (-909.614) (-914.386) (-916.736) [-909.793] * [-911.045] (-913.832) (-912.562) (-922.315) -- 0:00:39 Average standard deviation of split frequencies: 0.009938 345500 -- (-912.580) [-913.312] (-910.909) (-910.014) * [-911.626] (-915.757) (-920.422) (-913.318) -- 0:00:39 346000 -- [-913.360] (-915.287) (-913.298) (-909.780) * [-911.859] (-911.792) (-912.949) (-910.758) -- 0:00:39 346500 -- (-910.614) [-913.407] (-913.880) (-912.544) * (-913.700) [-911.718] (-914.127) (-913.418) -- 0:00:39 347000 -- [-911.342] (-917.712) (-915.117) (-912.749) * [-913.734] (-910.776) (-910.898) (-912.638) -- 0:00:39 347500 -- (-913.105) (-912.859) [-911.035] (-910.610) * (-911.880) (-910.826) [-910.962] (-910.811) -- 0:00:39 348000 -- [-913.197] (-916.056) (-911.158) (-914.273) * (-911.557) (-913.290) [-910.679] (-911.929) -- 0:00:39 348500 -- (-913.680) [-913.147] (-911.109) (-914.092) * [-911.195] (-914.198) (-911.581) (-911.634) -- 0:00:39 349000 -- (-911.341) [-913.044] (-912.963) (-910.464) * [-914.232] (-910.249) (-911.293) (-913.134) -- 0:00:39 349500 -- [-910.739] (-912.445) (-911.765) (-912.260) * [-912.432] (-911.916) (-914.477) (-910.529) -- 0:00:39 350000 -- (-915.136) [-910.840] (-911.544) (-912.646) * (-915.276) [-910.719] (-912.339) (-913.017) -- 0:00:39 Average standard deviation of split frequencies: 0.009410 350500 -- (-912.022) (-910.766) (-910.478) [-911.962] * (-911.516) [-913.766] (-910.654) (-910.533) -- 0:00:38 351000 -- (-911.287) (-910.779) [-910.892] (-918.210) * [-912.845] (-912.273) (-911.607) (-914.487) -- 0:00:38 351500 -- (-914.798) [-912.744] (-911.436) (-914.506) * [-913.403] (-913.442) (-913.141) (-910.553) -- 0:00:38 352000 -- [-913.600] (-911.854) (-912.925) (-911.733) * (-919.296) (-911.306) [-913.300] (-911.072) -- 0:00:38 352500 -- (-910.683) [-916.698] (-913.281) (-912.983) * (-912.233) (-914.727) [-912.329] (-916.821) -- 0:00:40 353000 -- (-912.843) (-911.548) [-910.544] (-909.919) * (-910.008) [-910.806] (-913.946) (-913.971) -- 0:00:40 353500 -- [-911.730] (-911.813) (-912.794) (-913.735) * [-910.465] (-911.778) (-911.430) (-915.983) -- 0:00:40 354000 -- (-917.393) (-912.817) (-912.894) [-912.861] * [-910.510] (-917.083) (-914.657) (-913.641) -- 0:00:40 354500 -- (-911.763) [-912.621] (-913.746) (-911.130) * (-910.021) (-911.226) (-910.320) [-913.111] -- 0:00:40 355000 -- (-912.523) (-913.379) [-910.814] (-911.353) * (-912.113) [-912.127] (-912.368) (-913.825) -- 0:00:39 Average standard deviation of split frequencies: 0.009581 355500 -- [-912.509] (-913.903) (-913.155) (-912.389) * (-911.442) (-913.512) [-915.447] (-916.978) -- 0:00:39 356000 -- [-912.622] (-914.223) (-910.663) (-913.439) * [-910.711] (-911.244) (-912.177) (-911.386) -- 0:00:39 356500 -- (-909.828) (-913.890) [-912.350] (-911.942) * [-911.193] (-911.184) (-910.502) (-911.190) -- 0:00:39 357000 -- (-910.410) (-911.764) (-912.543) [-911.213] * (-910.950) (-911.158) (-914.179) [-912.747] -- 0:00:39 357500 -- [-909.943] (-911.948) (-917.479) (-911.413) * (-911.632) (-913.388) (-913.002) [-914.427] -- 0:00:39 358000 -- (-910.685) [-912.640] (-911.877) (-910.965) * (-912.948) (-912.913) (-911.036) [-913.104] -- 0:00:39 358500 -- (-911.523) (-910.253) [-910.894] (-912.164) * (-910.543) (-915.554) [-911.099] (-913.038) -- 0:00:39 359000 -- (-910.507) (-920.104) (-911.981) [-910.290] * [-911.547] (-910.354) (-910.539) (-912.349) -- 0:00:39 359500 -- [-913.947] (-912.031) (-912.271) (-914.138) * (-911.839) (-911.619) (-910.607) [-912.210] -- 0:00:39 360000 -- (-911.980) (-914.605) (-911.260) [-913.638] * (-909.856) (-918.429) (-911.022) [-913.095] -- 0:00:39 Average standard deviation of split frequencies: 0.010379 360500 -- (-909.745) [-911.632] (-911.658) (-912.683) * [-910.675] (-915.038) (-913.357) (-914.137) -- 0:00:39 361000 -- (-911.274) [-913.937] (-911.605) (-911.055) * (-911.421) (-911.090) (-912.853) [-910.368] -- 0:00:38 361500 -- (-912.491) (-912.017) (-911.965) [-912.306] * (-910.335) [-911.160] (-912.579) (-912.081) -- 0:00:38 362000 -- (-913.428) [-911.237] (-910.443) (-909.668) * (-911.186) (-912.248) (-914.684) [-910.382] -- 0:00:38 362500 -- [-910.793] (-912.044) (-914.290) (-910.757) * (-912.269) [-910.187] (-910.046) (-910.842) -- 0:00:38 363000 -- [-910.364] (-913.547) (-911.810) (-912.903) * (-911.491) (-911.007) (-918.340) [-911.828] -- 0:00:38 363500 -- [-911.199] (-910.616) (-914.591) (-911.611) * [-912.178] (-910.007) (-912.410) (-910.565) -- 0:00:38 364000 -- [-910.220] (-910.535) (-912.412) (-910.150) * (-912.378) (-912.061) (-912.756) [-910.784] -- 0:00:38 364500 -- (-910.394) (-911.418) [-910.989] (-909.936) * (-912.872) (-912.811) (-913.284) [-910.700] -- 0:00:38 365000 -- (-910.051) [-911.296] (-912.763) (-910.685) * [-911.354] (-913.920) (-911.870) (-915.464) -- 0:00:38 Average standard deviation of split frequencies: 0.011137 365500 -- [-913.784] (-911.936) (-913.658) (-914.064) * (-911.165) [-911.202] (-911.737) (-914.944) -- 0:00:38 366000 -- (-909.984) (-911.372) (-915.831) [-911.669] * (-913.441) [-911.804] (-912.559) (-910.906) -- 0:00:38 366500 -- (-912.515) (-914.038) (-911.846) [-912.776] * [-910.223] (-911.613) (-911.915) (-911.356) -- 0:00:38 367000 -- (-913.341) (-916.015) (-913.363) [-911.567] * (-910.874) [-911.664] (-912.571) (-915.237) -- 0:00:37 367500 -- (-911.098) (-913.225) (-910.501) [-911.380] * (-912.693) [-912.021] (-912.317) (-913.104) -- 0:00:37 368000 -- (-911.861) (-915.123) (-912.953) [-912.895] * [-912.153] (-912.341) (-911.740) (-912.680) -- 0:00:37 368500 -- (-913.824) (-912.826) [-913.854] (-910.287) * [-911.999] (-911.947) (-910.616) (-910.800) -- 0:00:37 369000 -- [-913.750] (-912.019) (-915.571) (-913.922) * (-911.267) (-911.153) [-913.851] (-914.978) -- 0:00:39 369500 -- [-911.294] (-910.200) (-910.953) (-909.952) * [-913.230] (-914.355) (-911.500) (-913.233) -- 0:00:39 370000 -- (-913.493) (-911.202) [-911.149] (-910.662) * [-914.824] (-912.910) (-910.557) (-910.584) -- 0:00:39 Average standard deviation of split frequencies: 0.010810 370500 -- (-914.114) [-910.772] (-911.287) (-910.123) * (-914.812) (-910.522) (-911.513) [-910.881] -- 0:00:39 371000 -- (-914.146) (-912.027) (-910.134) [-909.893] * [-910.209] (-910.911) (-912.449) (-912.224) -- 0:00:38 371500 -- (-914.615) (-912.712) [-909.826] (-910.780) * (-911.516) (-911.347) [-911.792] (-911.339) -- 0:00:38 372000 -- [-912.213] (-914.106) (-912.751) (-911.337) * (-913.353) (-912.194) (-912.779) [-913.641] -- 0:00:38 372500 -- (-910.716) (-913.848) (-910.346) [-910.213] * [-912.549] (-912.972) (-912.298) (-912.896) -- 0:00:38 373000 -- [-912.752] (-920.262) (-910.362) (-911.266) * [-911.619] (-914.804) (-914.183) (-911.569) -- 0:00:38 373500 -- (-912.998) [-912.693] (-911.569) (-912.118) * (-913.023) (-914.386) [-912.768] (-911.313) -- 0:00:38 374000 -- (-915.465) (-912.772) [-916.198] (-913.494) * (-911.912) (-910.507) (-913.794) [-910.847] -- 0:00:38 374500 -- (-913.493) [-910.685] (-910.360) (-913.312) * (-911.717) (-910.034) [-922.904] (-914.281) -- 0:00:38 375000 -- (-911.407) [-911.576] (-910.512) (-912.489) * [-911.902] (-910.698) (-916.375) (-913.847) -- 0:00:38 Average standard deviation of split frequencies: 0.010500 375500 -- [-911.054] (-913.767) (-912.262) (-912.166) * [-911.553] (-911.572) (-914.321) (-911.689) -- 0:00:38 376000 -- [-910.279] (-912.539) (-912.893) (-913.253) * [-911.582] (-913.430) (-911.615) (-911.228) -- 0:00:38 376500 -- (-912.150) (-912.238) (-910.120) [-919.902] * (-911.664) [-910.533] (-911.161) (-911.576) -- 0:00:38 377000 -- (-912.333) [-913.214] (-910.049) (-909.954) * (-913.686) [-912.003] (-912.084) (-914.607) -- 0:00:38 377500 -- (-910.914) [-909.727] (-913.069) (-911.238) * (-914.169) [-910.712] (-910.644) (-913.609) -- 0:00:37 378000 -- [-911.965] (-911.600) (-912.288) (-911.692) * (-913.453) [-910.669] (-911.832) (-912.954) -- 0:00:37 378500 -- [-911.306] (-912.954) (-912.658) (-916.518) * (-913.974) (-910.953) [-913.669] (-911.600) -- 0:00:37 379000 -- [-909.815] (-911.796) (-911.782) (-912.513) * (-914.626) (-911.641) [-913.168] (-911.717) -- 0:00:37 379500 -- [-909.683] (-909.684) (-914.012) (-913.822) * (-915.272) (-911.923) (-913.427) [-910.894] -- 0:00:37 380000 -- (-913.500) (-909.680) [-915.522] (-912.786) * [-915.363] (-911.754) (-912.823) (-917.137) -- 0:00:37 Average standard deviation of split frequencies: 0.009752 380500 -- (-912.777) [-910.435] (-913.230) (-918.622) * (-912.771) (-910.666) [-912.149] (-916.165) -- 0:00:37 381000 -- (-912.380) (-910.957) (-911.734) [-910.875] * (-911.289) (-910.790) [-911.548] (-913.453) -- 0:00:37 381500 -- (-910.357) (-911.161) (-910.228) [-910.442] * (-910.442) (-911.721) [-910.965] (-912.806) -- 0:00:37 382000 -- (-912.976) [-910.173] (-915.244) (-910.868) * (-911.190) (-912.699) (-914.335) [-913.893] -- 0:00:37 382500 -- (-915.098) (-910.317) [-910.017] (-910.481) * (-912.794) (-911.693) [-909.858] (-913.417) -- 0:00:37 383000 -- (-911.433) [-912.318] (-911.996) (-912.104) * (-914.985) (-911.116) [-910.816] (-911.961) -- 0:00:37 383500 -- [-912.686] (-911.301) (-915.577) (-910.628) * (-911.354) (-910.973) [-910.652] (-913.560) -- 0:00:36 384000 -- (-912.742) [-910.902] (-912.208) (-911.107) * (-916.982) (-911.074) [-910.972] (-914.005) -- 0:00:36 384500 -- [-912.165] (-912.598) (-913.776) (-911.394) * [-913.574] (-920.162) (-911.299) (-910.034) -- 0:00:36 385000 -- (-910.622) (-913.551) (-910.660) [-910.219] * (-911.952) (-912.740) (-911.950) [-910.594] -- 0:00:36 Average standard deviation of split frequencies: 0.009914 385500 -- (-911.218) (-913.092) (-912.107) [-914.164] * [-911.606] (-914.278) (-911.414) (-910.852) -- 0:00:38 386000 -- [-915.323] (-911.625) (-910.373) (-911.190) * (-912.878) (-911.146) [-913.724] (-915.319) -- 0:00:38 386500 -- (-911.711) (-913.925) (-911.747) [-916.775] * (-914.943) (-911.226) (-910.646) [-915.293] -- 0:00:38 387000 -- (-911.985) (-910.976) (-913.890) [-910.568] * (-917.535) (-911.159) (-910.988) [-912.289] -- 0:00:38 387500 -- (-911.722) (-913.686) [-913.131] (-911.574) * (-912.266) (-912.115) [-910.467] (-909.912) -- 0:00:37 388000 -- (-910.144) (-916.511) [-910.764] (-911.824) * (-912.735) (-913.317) [-911.117] (-912.320) -- 0:00:37 388500 -- (-911.632) (-910.457) [-910.853] (-916.842) * (-918.264) (-916.003) (-912.595) [-911.559] -- 0:00:37 389000 -- [-911.528] (-909.976) (-912.051) (-915.150) * (-912.152) (-916.457) [-913.853] (-912.165) -- 0:00:37 389500 -- (-912.519) (-915.615) [-912.596] (-915.230) * [-914.404] (-909.984) (-914.978) (-912.099) -- 0:00:37 390000 -- [-911.645] (-916.076) (-914.418) (-917.798) * (-911.806) (-911.016) [-911.378] (-916.632) -- 0:00:37 Average standard deviation of split frequencies: 0.009015 390500 -- [-913.526] (-911.200) (-912.396) (-910.960) * (-911.013) (-914.870) (-911.525) [-918.185] -- 0:00:37 391000 -- [-913.314] (-911.148) (-913.576) (-914.619) * [-912.141] (-911.221) (-911.814) (-913.424) -- 0:00:37 391500 -- [-910.302] (-911.973) (-911.485) (-914.700) * [-912.347] (-911.940) (-911.642) (-913.078) -- 0:00:37 392000 -- (-910.673) (-911.416) (-911.078) [-910.924] * (-916.306) [-912.635] (-911.552) (-910.649) -- 0:00:37 392500 -- (-912.973) (-911.169) [-909.894] (-914.421) * (-911.759) (-911.089) [-913.183] (-916.616) -- 0:00:37 393000 -- (-911.290) (-914.284) [-911.080] (-916.864) * (-913.751) (-911.313) (-912.084) [-913.731] -- 0:00:37 393500 -- (-910.575) (-911.610) [-910.559] (-916.079) * (-911.239) (-911.495) (-912.459) [-910.706] -- 0:00:36 394000 -- [-910.552] (-911.389) (-913.744) (-911.097) * [-910.179] (-910.842) (-913.582) (-911.301) -- 0:00:36 394500 -- [-911.002] (-910.694) (-913.326) (-914.812) * [-912.536] (-910.815) (-911.335) (-912.987) -- 0:00:36 395000 -- (-911.693) (-913.285) (-911.337) [-911.846] * (-910.983) [-910.729] (-909.774) (-913.511) -- 0:00:36 Average standard deviation of split frequencies: 0.009243 395500 -- (-914.003) (-910.474) [-911.163] (-914.326) * (-911.580) (-913.946) (-912.214) [-910.475] -- 0:00:36 396000 -- (-915.829) [-912.313] (-912.354) (-910.865) * (-914.521) (-915.277) (-912.468) [-912.732] -- 0:00:36 396500 -- (-911.762) (-914.655) [-910.425] (-912.955) * (-913.671) [-911.216] (-913.671) (-913.313) -- 0:00:36 397000 -- (-910.243) [-911.799] (-911.477) (-912.309) * (-917.131) (-913.609) [-912.845] (-915.838) -- 0:00:36 397500 -- [-910.807] (-912.073) (-911.069) (-910.315) * (-911.712) (-910.984) [-913.144] (-909.738) -- 0:00:36 398000 -- [-911.121] (-916.103) (-912.856) (-911.339) * (-910.468) [-911.294] (-914.252) (-910.072) -- 0:00:36 398500 -- (-910.989) (-912.998) [-910.252] (-910.659) * [-910.976] (-911.573) (-914.106) (-910.379) -- 0:00:36 399000 -- (-909.996) (-910.065) (-909.611) [-910.287] * (-911.408) (-915.557) (-913.012) [-912.239] -- 0:00:36 399500 -- (-913.597) [-911.202] (-909.595) (-910.326) * (-911.056) (-917.012) (-915.000) [-910.849] -- 0:00:36 400000 -- (-916.791) (-911.927) (-910.106) [-910.579] * [-912.964] (-918.140) (-912.020) (-913.006) -- 0:00:36 Average standard deviation of split frequencies: 0.009620 400500 -- (-913.206) (-911.526) [-911.174] (-910.274) * [-910.173] (-915.400) (-913.330) (-912.455) -- 0:00:35 401000 -- (-910.481) (-910.215) [-912.094] (-910.274) * [-912.994] (-910.851) (-925.771) (-911.911) -- 0:00:35 401500 -- (-913.014) (-912.031) [-910.253] (-913.059) * (-912.672) [-912.856] (-913.020) (-911.856) -- 0:00:37 402000 -- (-913.107) (-912.076) [-911.402] (-911.791) * (-917.310) (-912.963) [-912.847] (-913.008) -- 0:00:37 402500 -- [-912.346] (-910.560) (-912.516) (-912.086) * (-919.451) (-917.493) (-910.054) [-911.386] -- 0:00:37 403000 -- (-910.216) [-913.722] (-910.203) (-915.645) * [-911.024] (-912.503) (-911.099) (-911.058) -- 0:00:37 403500 -- (-911.010) (-910.439) [-910.353] (-910.200) * (-913.479) [-913.374] (-912.395) (-911.031) -- 0:00:36 404000 -- (-911.472) [-911.034] (-912.637) (-911.538) * (-913.254) (-911.526) (-914.808) [-910.097] -- 0:00:36 404500 -- [-910.798] (-910.868) (-912.279) (-910.073) * (-911.485) (-910.763) (-915.081) [-911.674] -- 0:00:36 405000 -- (-910.993) (-910.754) (-911.183) [-914.904] * (-912.417) [-914.065] (-916.185) (-911.720) -- 0:00:36 Average standard deviation of split frequencies: 0.009835 405500 -- (-912.151) [-910.611] (-911.666) (-911.730) * (-910.341) [-911.371] (-914.030) (-911.910) -- 0:00:36 406000 -- (-914.628) (-911.179) [-912.325] (-910.873) * [-912.307] (-911.555) (-910.897) (-912.493) -- 0:00:36 406500 -- (-914.849) [-913.078] (-912.341) (-910.970) * (-915.154) (-911.818) (-915.639) [-911.955] -- 0:00:36 407000 -- [-913.448] (-912.732) (-911.311) (-911.728) * (-909.712) [-911.100] (-914.516) (-913.008) -- 0:00:36 407500 -- [-910.320] (-914.368) (-911.136) (-911.540) * (-910.358) (-910.518) (-912.237) [-914.483] -- 0:00:36 408000 -- (-910.290) (-910.796) (-913.656) [-911.111] * (-909.809) [-911.027] (-914.228) (-912.464) -- 0:00:36 408500 -- (-912.338) (-911.097) [-912.773] (-911.087) * (-909.743) (-914.771) (-912.045) [-916.022] -- 0:00:36 409000 -- [-910.909] (-912.504) (-912.059) (-912.901) * [-910.594] (-913.020) (-913.363) (-911.710) -- 0:00:36 409500 -- (-912.635) [-912.270] (-911.239) (-912.415) * (-913.470) [-911.956] (-915.359) (-912.206) -- 0:00:36 410000 -- (-913.004) (-917.444) [-910.875] (-914.026) * [-910.628] (-911.799) (-913.538) (-911.973) -- 0:00:35 Average standard deviation of split frequencies: 0.009723 410500 -- (-910.166) (-913.041) (-912.121) [-912.403] * (-913.386) [-912.233] (-913.597) (-911.894) -- 0:00:35 411000 -- [-912.187] (-910.918) (-910.753) (-912.017) * (-913.022) [-912.232] (-911.537) (-912.301) -- 0:00:35 411500 -- (-911.962) (-911.421) [-910.635] (-913.192) * (-914.718) [-912.266] (-911.822) (-915.759) -- 0:00:35 412000 -- (-912.973) (-913.864) (-911.965) [-910.747] * (-914.669) [-911.677] (-914.515) (-913.429) -- 0:00:35 412500 -- (-911.466) (-914.343) [-914.945] (-913.611) * (-913.672) (-913.459) [-915.768] (-911.824) -- 0:00:35 413000 -- (-911.256) (-915.428) (-913.191) [-915.173] * (-912.442) (-912.461) (-910.567) [-910.612] -- 0:00:35 413500 -- [-910.919] (-915.272) (-911.639) (-914.561) * (-911.071) [-913.953] (-911.543) (-911.877) -- 0:00:35 414000 -- [-911.069] (-910.980) (-911.436) (-914.318) * [-912.070] (-912.632) (-913.908) (-911.387) -- 0:00:35 414500 -- [-912.305] (-910.122) (-911.680) (-911.735) * (-913.265) (-913.564) [-911.909] (-910.991) -- 0:00:35 415000 -- [-912.306] (-911.575) (-911.320) (-910.997) * (-910.587) [-918.604] (-913.151) (-912.178) -- 0:00:35 Average standard deviation of split frequencies: 0.009732 415500 -- (-911.608) [-912.831] (-910.505) (-911.171) * (-911.107) (-918.208) [-911.044] (-910.915) -- 0:00:35 416000 -- (-912.664) (-910.707) (-913.564) [-911.140] * (-913.218) (-913.201) (-913.308) [-910.788] -- 0:00:35 416500 -- (-911.268) [-911.481] (-910.450) (-911.647) * (-911.708) (-911.482) [-910.014] (-912.933) -- 0:00:35 417000 -- (-910.655) (-913.597) (-912.142) [-910.677] * (-912.439) (-914.514) [-909.938] (-914.599) -- 0:00:34 417500 -- (-910.310) (-912.409) (-912.133) [-910.723] * (-911.776) [-912.618] (-910.917) (-913.866) -- 0:00:34 418000 -- [-911.236] (-916.225) (-911.643) (-912.728) * (-911.081) (-912.422) (-910.734) [-910.108] -- 0:00:36 418500 -- (-912.155) (-912.355) (-910.329) [-910.625] * (-913.227) (-912.361) (-913.473) [-911.404] -- 0:00:36 419000 -- (-911.729) (-914.167) [-912.523] (-915.831) * (-912.514) (-913.787) [-912.272] (-912.746) -- 0:00:36 419500 -- (-912.609) (-914.853) [-911.055] (-910.539) * (-912.053) (-909.616) [-912.669] (-912.707) -- 0:00:35 420000 -- (-910.959) [-910.545] (-910.935) (-910.116) * (-917.976) (-910.881) [-913.254] (-912.707) -- 0:00:35 Average standard deviation of split frequencies: 0.010217 420500 -- (-914.496) (-913.319) (-910.284) [-912.317] * (-914.470) (-913.918) [-912.996] (-910.510) -- 0:00:35 421000 -- (-914.251) (-909.680) [-910.380] (-910.618) * (-911.181) (-914.957) [-914.168] (-912.607) -- 0:00:35 421500 -- (-912.289) [-909.933] (-911.758) (-913.224) * (-911.005) (-912.970) (-910.076) [-911.653] -- 0:00:35 422000 -- (-910.721) (-911.770) [-912.799] (-911.995) * (-913.547) [-912.212] (-911.518) (-915.505) -- 0:00:35 422500 -- (-910.552) (-913.816) [-909.915] (-910.394) * (-915.713) (-913.490) (-911.506) [-911.038] -- 0:00:35 423000 -- [-910.469] (-911.211) (-912.718) (-914.701) * [-911.264] (-911.557) (-912.726) (-911.067) -- 0:00:35 423500 -- (-914.567) (-911.805) (-914.250) [-912.349] * (-910.647) (-912.128) [-913.413] (-912.840) -- 0:00:35 424000 -- (-912.420) (-914.518) [-911.245] (-911.906) * (-911.910) (-911.770) [-910.128] (-910.314) -- 0:00:35 424500 -- (-916.299) (-921.102) [-910.545] (-912.180) * [-912.197] (-911.557) (-913.915) (-913.244) -- 0:00:35 425000 -- (-911.924) [-910.682] (-912.136) (-911.813) * (-912.785) (-911.506) [-912.801] (-913.174) -- 0:00:35 Average standard deviation of split frequencies: 0.010220 425500 -- [-911.613] (-910.907) (-913.001) (-910.497) * (-911.835) [-910.647] (-910.913) (-911.039) -- 0:00:35 426000 -- [-913.155] (-913.219) (-913.796) (-916.790) * (-912.095) [-910.346] (-915.211) (-910.603) -- 0:00:35 426500 -- (-911.500) (-914.435) [-910.102] (-915.020) * (-912.115) (-913.745) [-912.197] (-911.319) -- 0:00:34 427000 -- (-911.410) [-910.676] (-912.924) (-912.765) * (-914.014) (-911.971) [-911.842] (-912.049) -- 0:00:34 427500 -- [-911.008] (-914.335) (-910.706) (-911.701) * [-913.704] (-913.392) (-911.402) (-911.419) -- 0:00:34 428000 -- (-911.510) [-912.359] (-915.320) (-913.901) * (-912.990) (-914.796) [-911.616] (-912.159) -- 0:00:34 428500 -- [-909.942] (-911.093) (-911.721) (-911.951) * (-910.354) (-913.836) [-910.235] (-911.771) -- 0:00:34 429000 -- (-911.090) (-909.980) [-910.460] (-911.386) * (-913.515) (-916.721) (-911.274) [-914.955] -- 0:00:34 429500 -- (-911.886) (-913.061) (-911.213) [-911.690] * (-911.682) [-911.935] (-914.274) (-912.936) -- 0:00:34 430000 -- (-912.047) (-911.317) [-910.786] (-913.791) * (-912.784) [-912.133] (-912.112) (-911.839) -- 0:00:34 Average standard deviation of split frequencies: 0.010560 430500 -- [-912.508] (-914.092) (-910.900) (-912.342) * [-911.695] (-911.476) (-912.265) (-912.556) -- 0:00:34 431000 -- (-917.132) (-913.466) [-910.093] (-912.429) * (-911.780) (-911.399) (-911.738) [-913.824] -- 0:00:34 431500 -- (-913.585) (-911.039) [-911.133] (-912.075) * (-911.099) [-910.264] (-910.813) (-911.351) -- 0:00:34 432000 -- (-919.044) (-913.035) (-912.534) [-912.005] * (-912.271) (-912.472) (-911.113) [-911.034] -- 0:00:34 432500 -- (-916.923) (-910.941) (-914.907) [-911.119] * [-915.375] (-911.832) (-911.471) (-914.445) -- 0:00:34 433000 -- (-912.999) (-910.700) [-911.075] (-910.806) * (-913.505) (-915.067) [-911.303] (-910.676) -- 0:00:34 433500 -- (-912.474) [-912.662] (-910.837) (-910.872) * (-911.510) [-911.075] (-912.283) (-912.843) -- 0:00:33 434000 -- (-911.990) (-911.837) [-910.972] (-911.105) * [-913.745] (-913.480) (-912.360) (-910.370) -- 0:00:33 434500 -- (-914.823) [-912.652] (-910.320) (-912.904) * (-910.296) [-912.203] (-909.649) (-912.067) -- 0:00:35 435000 -- (-911.015) (-919.323) (-909.988) [-912.933] * (-910.934) [-911.473] (-911.359) (-912.435) -- 0:00:35 Average standard deviation of split frequencies: 0.010407 435500 -- (-910.999) (-913.601) [-910.958] (-911.031) * (-913.381) [-911.728] (-912.404) (-910.889) -- 0:00:34 436000 -- [-910.745] (-912.411) (-910.727) (-911.376) * [-910.154] (-910.002) (-913.056) (-910.838) -- 0:00:34 436500 -- (-910.677) (-912.229) [-911.752] (-910.140) * (-912.224) (-909.859) [-914.279] (-911.617) -- 0:00:34 437000 -- (-912.742) (-912.728) [-911.167] (-910.898) * (-910.834) [-909.843] (-912.935) (-911.519) -- 0:00:34 437500 -- (-914.291) [-910.392] (-911.884) (-915.369) * [-910.301] (-910.591) (-914.036) (-911.411) -- 0:00:34 438000 -- (-916.908) (-912.700) [-913.078] (-910.893) * (-910.856) (-911.331) (-910.590) [-912.706] -- 0:00:34 438500 -- (-911.252) (-910.443) [-912.103] (-914.446) * (-910.608) (-911.533) (-913.662) [-910.585] -- 0:00:34 439000 -- (-916.946) [-913.664] (-911.148) (-912.950) * (-911.181) [-912.641] (-909.660) (-910.523) -- 0:00:34 439500 -- (-911.065) [-914.043] (-912.829) (-911.420) * (-909.864) [-911.329] (-909.658) (-913.369) -- 0:00:34 440000 -- (-910.264) (-911.618) (-911.026) [-913.470] * [-911.887] (-913.453) (-910.945) (-912.284) -- 0:00:34 Average standard deviation of split frequencies: 0.010497 440500 -- [-910.819] (-914.218) (-910.070) (-915.102) * (-914.803) (-917.352) [-912.976] (-912.222) -- 0:00:34 441000 -- [-911.611] (-914.389) (-910.039) (-914.699) * (-912.905) [-916.058] (-913.972) (-916.476) -- 0:00:34 441500 -- [-911.859] (-915.434) (-913.984) (-911.979) * (-911.589) [-910.046] (-911.805) (-912.534) -- 0:00:34 442000 -- (-910.848) [-912.419] (-911.072) (-911.147) * (-910.455) (-910.165) [-910.786] (-910.323) -- 0:00:34 442500 -- (-913.370) [-912.791] (-910.886) (-911.449) * (-916.277) (-912.368) (-910.459) [-910.960] -- 0:00:34 443000 -- [-912.016] (-911.167) (-913.138) (-910.334) * (-911.913) (-911.942) (-911.853) [-912.495] -- 0:00:33 443500 -- [-910.340] (-912.131) (-910.538) (-910.200) * (-911.525) (-911.973) [-911.360] (-913.218) -- 0:00:33 444000 -- [-910.530] (-911.931) (-910.610) (-910.019) * (-914.575) (-912.025) (-911.690) [-913.622] -- 0:00:33 444500 -- [-910.471] (-912.251) (-912.578) (-911.234) * (-915.122) (-911.760) [-911.827] (-911.959) -- 0:00:33 445000 -- (-912.413) (-911.902) [-911.789] (-910.258) * [-912.876] (-922.357) (-911.839) (-911.256) -- 0:00:33 Average standard deviation of split frequencies: 0.010507 445500 -- (-910.939) [-910.855] (-912.496) (-911.646) * [-911.763] (-910.622) (-911.043) (-911.471) -- 0:00:33 446000 -- (-910.661) (-909.904) (-913.129) [-911.468] * (-912.651) [-912.797] (-911.014) (-911.831) -- 0:00:33 446500 -- (-915.101) (-912.124) [-915.854] (-911.537) * (-910.618) [-910.931] (-911.098) (-911.736) -- 0:00:33 447000 -- (-912.937) [-913.422] (-912.784) (-911.425) * [-912.036] (-910.243) (-913.433) (-911.671) -- 0:00:33 447500 -- [-912.995] (-910.022) (-913.528) (-911.854) * (-916.427) [-911.684] (-911.886) (-910.701) -- 0:00:33 448000 -- [-917.368] (-914.034) (-911.175) (-911.487) * (-911.779) [-911.576] (-911.437) (-921.418) -- 0:00:33 448500 -- (-914.884) (-910.029) [-911.043] (-910.801) * (-911.129) [-909.643] (-913.789) (-910.619) -- 0:00:33 449000 -- (-913.807) (-909.602) (-910.253) [-910.097] * (-911.059) (-910.836) [-912.120] (-910.283) -- 0:00:33 449500 -- [-912.146] (-911.139) (-912.583) (-910.129) * (-913.262) [-912.534] (-913.258) (-910.679) -- 0:00:33 450000 -- (-910.992) [-912.828] (-911.338) (-910.130) * [-913.700] (-911.716) (-911.827) (-914.234) -- 0:00:33 Average standard deviation of split frequencies: 0.009906 450500 -- [-911.187] (-911.695) (-910.480) (-909.924) * (-915.767) [-910.987] (-910.649) (-910.575) -- 0:00:32 451000 -- (-910.520) (-912.635) (-911.155) [-910.543] * (-912.481) [-910.902] (-910.618) (-911.047) -- 0:00:34 451500 -- (-913.021) (-912.309) [-911.418] (-910.292) * (-911.782) (-910.957) [-913.508] (-911.447) -- 0:00:34 452000 -- (-911.837) [-914.150] (-917.923) (-910.216) * (-910.596) (-911.159) [-910.702] (-912.365) -- 0:00:33 452500 -- (-910.443) (-910.747) [-911.836] (-912.297) * (-910.209) (-909.931) (-913.582) [-912.590] -- 0:00:33 453000 -- (-910.617) [-910.472] (-913.968) (-915.897) * (-910.610) (-912.990) (-911.313) [-910.523] -- 0:00:33 453500 -- (-909.684) (-913.191) [-911.182] (-912.463) * (-911.127) [-909.646] (-910.978) (-912.533) -- 0:00:33 454000 -- (-911.112) (-910.693) (-909.781) [-910.357] * (-910.914) [-910.233] (-912.809) (-914.191) -- 0:00:33 454500 -- (-910.740) (-910.242) [-912.060] (-914.985) * (-917.758) (-909.754) (-914.035) [-912.789] -- 0:00:33 455000 -- (-914.311) (-911.541) (-910.479) [-910.985] * [-917.886] (-912.852) (-914.101) (-914.672) -- 0:00:33 Average standard deviation of split frequencies: 0.009304 455500 -- [-911.746] (-911.268) (-910.586) (-914.914) * [-910.084] (-909.773) (-912.288) (-913.410) -- 0:00:33 456000 -- (-911.992) (-911.593) [-917.342] (-914.009) * (-911.598) (-910.894) [-912.593] (-913.856) -- 0:00:33 456500 -- (-910.930) [-911.825] (-912.461) (-913.027) * [-910.641] (-911.313) (-911.330) (-913.839) -- 0:00:33 457000 -- (-910.819) (-916.992) (-920.061) [-911.283] * (-912.376) (-910.376) [-911.942] (-919.171) -- 0:00:33 457500 -- (-913.583) [-917.991] (-910.551) (-910.253) * [-910.752] (-911.350) (-913.015) (-914.013) -- 0:00:33 458000 -- (-914.587) (-917.350) [-913.172] (-909.587) * (-912.189) (-910.475) [-910.692] (-911.382) -- 0:00:33 458500 -- (-910.300) (-911.346) [-911.847] (-910.026) * (-910.428) (-911.633) [-910.613] (-910.954) -- 0:00:33 459000 -- [-911.229] (-912.905) (-910.638) (-911.372) * (-911.024) [-910.094] (-913.805) (-910.595) -- 0:00:33 459500 -- (-910.393) (-912.138) (-915.414) [-912.545] * (-915.716) [-913.616] (-911.848) (-911.068) -- 0:00:32 460000 -- [-910.070] (-915.432) (-912.860) (-910.515) * (-911.432) (-913.786) [-911.455] (-913.023) -- 0:00:32 Average standard deviation of split frequencies: 0.009270 460500 -- (-911.446) (-912.842) (-913.824) [-912.126] * [-911.778] (-911.300) (-913.002) (-913.819) -- 0:00:32 461000 -- [-911.095] (-913.635) (-912.207) (-913.061) * (-911.264) [-909.848] (-912.104) (-910.030) -- 0:00:32 461500 -- (-913.233) (-913.353) [-911.220] (-916.185) * (-913.113) (-910.785) [-910.672] (-912.604) -- 0:00:32 462000 -- (-913.922) [-911.641] (-910.492) (-914.592) * [-913.831] (-912.028) (-913.072) (-910.495) -- 0:00:32 462500 -- (-910.515) (-910.510) [-910.561] (-915.496) * [-912.866] (-912.327) (-914.267) (-910.687) -- 0:00:32 463000 -- (-910.091) [-910.473] (-912.100) (-915.306) * (-915.350) (-916.499) (-912.139) [-912.888] -- 0:00:32 463500 -- [-909.908] (-910.823) (-910.021) (-916.194) * [-910.612] (-913.598) (-917.054) (-916.023) -- 0:00:32 464000 -- [-910.102] (-910.362) (-910.702) (-912.025) * [-910.023] (-912.634) (-914.637) (-911.123) -- 0:00:32 464500 -- [-910.226] (-917.889) (-912.393) (-912.427) * (-909.746) (-910.452) (-914.388) [-910.326] -- 0:00:32 465000 -- [-912.170] (-917.282) (-912.512) (-912.146) * (-911.935) (-912.499) [-913.016] (-910.468) -- 0:00:32 Average standard deviation of split frequencies: 0.009461 465500 -- [-911.023] (-911.348) (-911.832) (-911.339) * (-911.720) [-910.237] (-912.238) (-910.223) -- 0:00:32 466000 -- (-910.210) (-910.780) (-914.981) [-911.352] * (-913.214) (-909.911) [-911.595] (-913.182) -- 0:00:32 466500 -- (-912.211) [-913.659] (-913.533) (-912.853) * [-916.605] (-911.418) (-911.598) (-911.606) -- 0:00:32 467000 -- [-910.940] (-915.955) (-915.240) (-911.079) * (-910.030) (-915.606) [-912.280] (-911.543) -- 0:00:31 467500 -- (-910.806) (-913.850) (-914.770) [-910.851] * [-910.282] (-912.866) (-911.008) (-913.259) -- 0:00:33 468000 -- (-918.596) (-912.222) [-910.496] (-912.305) * [-911.080] (-913.638) (-912.919) (-914.536) -- 0:00:32 468500 -- [-916.296] (-913.977) (-915.732) (-916.203) * (-912.570) (-913.085) [-911.514] (-912.236) -- 0:00:32 469000 -- (-912.433) (-912.003) (-911.234) [-912.196] * (-911.864) (-911.035) [-912.298] (-913.297) -- 0:00:32 469500 -- [-910.913] (-919.202) (-912.671) (-910.545) * (-911.866) (-911.933) (-909.994) [-915.897] -- 0:00:32 470000 -- (-911.185) [-910.192] (-913.433) (-911.945) * [-910.743] (-912.045) (-911.903) (-910.795) -- 0:00:32 Average standard deviation of split frequencies: 0.008764 470500 -- (-910.401) [-910.652] (-912.317) (-911.801) * (-910.553) (-911.828) [-912.593] (-911.103) -- 0:00:32 471000 -- (-911.617) (-912.887) [-912.487] (-911.687) * (-912.793) (-911.808) [-910.626] (-910.673) -- 0:00:32 471500 -- (-910.144) (-911.352) [-910.067] (-911.074) * (-911.348) [-913.411] (-911.226) (-910.592) -- 0:00:32 472000 -- (-910.506) (-910.162) [-909.924] (-910.401) * [-910.570] (-910.132) (-913.325) (-911.619) -- 0:00:32 472500 -- (-910.445) [-909.778] (-912.822) (-913.448) * (-913.852) [-910.462] (-910.350) (-913.450) -- 0:00:32 473000 -- [-910.863] (-910.239) (-910.277) (-911.706) * (-912.580) (-910.093) [-910.927] (-912.364) -- 0:00:32 473500 -- (-910.393) (-910.502) [-912.650] (-912.690) * (-912.367) (-911.655) (-910.732) [-910.561] -- 0:00:32 474000 -- [-913.759] (-914.141) (-914.826) (-911.522) * (-915.294) (-910.980) (-913.710) [-913.526] -- 0:00:32 474500 -- (-915.373) [-911.820] (-911.502) (-911.704) * (-912.776) (-911.455) (-912.045) [-913.793] -- 0:00:32 475000 -- (-915.034) [-912.410] (-910.542) (-915.836) * (-910.479) (-913.162) [-912.813] (-911.630) -- 0:00:32 Average standard deviation of split frequencies: 0.008564 475500 -- (-912.792) [-911.167] (-910.553) (-911.137) * (-911.753) (-910.183) [-913.300] (-912.425) -- 0:00:31 476000 -- (-910.764) (-910.307) (-911.606) [-911.600] * [-910.751] (-910.306) (-914.010) (-911.654) -- 0:00:31 476500 -- (-910.504) (-916.702) (-911.933) [-911.116] * [-911.430] (-912.549) (-911.500) (-910.517) -- 0:00:31 477000 -- (-912.080) (-912.586) [-911.838] (-911.600) * (-910.810) [-911.264] (-913.753) (-913.197) -- 0:00:31 477500 -- (-914.593) (-910.186) (-911.271) [-912.105] * [-912.074] (-910.773) (-912.880) (-913.123) -- 0:00:31 478000 -- (-914.253) (-911.035) (-916.731) [-912.169] * (-910.575) (-909.870) [-912.235] (-915.278) -- 0:00:31 478500 -- (-910.898) (-911.983) (-911.229) [-910.066] * (-915.341) [-911.786] (-911.229) (-911.992) -- 0:00:31 479000 -- (-912.339) [-911.779] (-911.438) (-909.763) * (-910.781) (-912.479) (-913.437) [-912.139] -- 0:00:31 479500 -- (-913.026) (-910.599) (-912.177) [-912.678] * (-910.389) [-910.948] (-912.701) (-917.055) -- 0:00:31 480000 -- (-912.010) [-915.709] (-911.807) (-910.883) * (-909.968) (-915.195) (-911.017) [-912.591] -- 0:00:31 Average standard deviation of split frequencies: 0.008459 480500 -- [-915.126] (-912.676) (-911.900) (-912.587) * (-911.471) (-917.269) (-911.763) [-911.273] -- 0:00:31 481000 -- [-912.594] (-911.532) (-915.007) (-910.569) * (-911.248) (-913.968) (-913.387) [-910.307] -- 0:00:31 481500 -- (-914.782) (-912.055) (-913.593) [-910.446] * (-912.263) (-912.867) (-912.946) [-913.125] -- 0:00:31 482000 -- (-911.279) (-913.315) [-912.126] (-910.821) * (-910.180) (-912.948) (-917.077) [-913.444] -- 0:00:31 482500 -- (-911.238) (-913.833) (-910.920) [-910.753] * [-911.220] (-910.271) (-912.262) (-912.150) -- 0:00:31 483000 -- (-912.886) (-916.168) (-910.803) [-910.920] * (-912.940) (-910.351) (-910.581) [-910.848] -- 0:00:31 483500 -- (-911.080) (-913.647) [-910.302] (-914.809) * [-912.157] (-910.701) (-910.185) (-913.169) -- 0:00:30 484000 -- (-912.369) (-913.669) [-912.157] (-912.836) * (-909.730) [-911.604] (-912.754) (-914.480) -- 0:00:31 484500 -- (-911.185) (-912.540) [-911.500] (-915.044) * (-909.888) [-912.176] (-917.853) (-914.384) -- 0:00:31 485000 -- (-910.771) (-911.151) [-912.402] (-913.564) * (-910.113) (-913.839) (-911.911) [-912.632] -- 0:00:31 Average standard deviation of split frequencies: 0.008460 485500 -- (-913.471) (-913.508) [-912.234] (-913.922) * [-910.161] (-913.561) (-911.177) (-912.163) -- 0:00:31 486000 -- [-911.923] (-913.457) (-911.992) (-911.201) * (-914.055) (-912.696) (-911.881) [-914.172] -- 0:00:31 486500 -- (-917.827) (-913.067) (-910.044) [-913.147] * (-909.571) (-913.173) [-912.222] (-913.734) -- 0:00:31 487000 -- (-912.793) (-912.204) [-910.248] (-912.618) * (-912.079) [-911.626] (-913.055) (-916.022) -- 0:00:31 487500 -- (-916.137) (-912.079) (-910.691) [-910.323] * (-915.559) (-910.383) [-914.442] (-910.458) -- 0:00:31 488000 -- (-914.070) (-912.649) [-911.291] (-914.280) * (-916.750) [-913.092] (-910.717) (-910.490) -- 0:00:31 488500 -- (-912.761) (-910.048) [-910.989] (-913.248) * [-912.280] (-910.269) (-915.250) (-917.853) -- 0:00:31 489000 -- (-911.696) [-911.468] (-915.573) (-913.208) * [-914.156] (-909.844) (-911.871) (-920.630) -- 0:00:31 489500 -- (-913.689) [-911.604] (-916.239) (-910.996) * (-911.663) (-915.107) [-910.855] (-915.921) -- 0:00:31 490000 -- (-911.394) (-913.895) [-911.035] (-910.213) * (-911.748) (-914.333) [-911.484] (-914.244) -- 0:00:31 Average standard deviation of split frequencies: 0.008967 490500 -- (-912.143) (-916.384) [-910.794] (-912.762) * (-912.702) (-911.774) (-912.159) [-911.951] -- 0:00:31 491000 -- [-911.230] (-916.814) (-910.383) (-916.556) * (-911.579) (-912.685) [-912.895] (-913.163) -- 0:00:31 491500 -- [-911.481] (-911.074) (-911.224) (-910.316) * (-911.927) [-912.503] (-912.526) (-913.036) -- 0:00:31 492000 -- (-912.556) (-913.101) (-911.825) [-910.879] * (-912.202) (-912.115) (-910.470) [-912.944] -- 0:00:30 492500 -- [-912.217] (-913.163) (-911.842) (-910.709) * (-915.801) [-911.657] (-912.624) (-912.050) -- 0:00:30 493000 -- (-910.397) [-912.405] (-911.835) (-911.089) * (-913.774) (-911.902) (-911.574) [-910.957] -- 0:00:30 493500 -- (-912.008) (-911.243) [-909.930] (-911.840) * (-911.876) (-914.484) [-912.032] (-913.754) -- 0:00:30 494000 -- (-913.870) (-911.780) (-911.028) [-911.040] * (-911.711) [-911.029] (-914.880) (-911.246) -- 0:00:30 494500 -- (-912.839) (-912.648) [-910.607] (-912.920) * (-911.571) (-910.479) (-916.615) [-910.645] -- 0:00:30 495000 -- [-914.643] (-915.132) (-909.892) (-910.930) * (-911.321) (-909.729) (-911.071) [-911.246] -- 0:00:30 Average standard deviation of split frequencies: 0.008554 495500 -- [-909.991] (-914.619) (-910.805) (-910.753) * [-912.416] (-913.373) (-914.684) (-917.671) -- 0:00:30 496000 -- (-910.027) (-912.626) [-909.974] (-911.799) * (-914.723) (-911.676) (-911.184) [-913.655] -- 0:00:30 496500 -- [-911.216] (-915.243) (-913.525) (-912.716) * (-914.963) [-909.619] (-915.039) (-909.781) -- 0:00:30 497000 -- (-910.928) [-911.643] (-912.392) (-913.054) * [-913.156] (-909.619) (-911.378) (-909.896) -- 0:00:30 497500 -- (-911.648) (-911.056) (-913.499) [-912.275] * (-910.300) (-911.097) (-911.634) [-912.193] -- 0:00:30 498000 -- (-913.943) (-910.631) (-910.423) [-911.345] * (-912.326) (-910.018) [-912.436] (-912.440) -- 0:00:30 498500 -- [-910.338] (-912.163) (-912.886) (-920.740) * (-911.095) (-910.495) (-914.484) [-913.296] -- 0:00:30 499000 -- (-910.103) [-910.835] (-911.505) (-913.817) * [-911.136] (-913.619) (-914.996) (-913.811) -- 0:00:30 499500 -- (-912.728) [-910.377] (-911.812) (-910.472) * [-911.067] (-913.349) (-914.277) (-911.856) -- 0:00:30 500000 -- [-911.489] (-916.023) (-910.071) (-910.790) * (-911.737) (-914.349) (-911.924) [-911.470] -- 0:00:30 Average standard deviation of split frequencies: 0.008197 500500 -- (-912.941) [-913.317] (-909.740) (-913.303) * [-911.224] (-913.409) (-913.497) (-910.005) -- 0:00:30 501000 -- (-911.709) [-912.913] (-910.462) (-910.890) * [-913.416] (-914.662) (-910.620) (-910.605) -- 0:00:30 501500 -- [-912.395] (-914.740) (-911.784) (-911.216) * (-910.338) (-910.797) (-913.624) [-909.829] -- 0:00:30 502000 -- (-910.828) [-912.428] (-912.027) (-913.268) * (-910.920) (-914.291) [-913.423] (-910.433) -- 0:00:30 502500 -- [-912.641] (-912.173) (-910.882) (-911.137) * [-911.355] (-911.320) (-911.784) (-910.767) -- 0:00:30 503000 -- [-912.089] (-917.893) (-911.463) (-912.968) * (-910.455) (-912.162) (-910.226) [-912.638] -- 0:00:30 503500 -- (-911.134) (-912.567) (-911.746) [-912.667] * (-911.284) (-912.664) [-911.580] (-910.342) -- 0:00:30 504000 -- (-913.566) (-911.544) [-911.320] (-910.538) * [-910.743] (-918.292) (-915.139) (-912.272) -- 0:00:30 504500 -- (-913.806) (-913.755) [-911.143] (-910.815) * (-915.839) (-919.820) [-911.828] (-911.129) -- 0:00:30 505000 -- (-912.577) (-913.580) [-914.123] (-911.352) * [-910.949] (-915.241) (-917.796) (-913.425) -- 0:00:30 Average standard deviation of split frequencies: 0.008604 505500 -- [-915.161] (-910.880) (-909.921) (-910.416) * (-913.846) (-912.072) (-920.176) [-914.950] -- 0:00:30 506000 -- (-912.484) [-911.351] (-912.256) (-910.135) * (-914.951) (-912.381) [-914.143] (-910.971) -- 0:00:30 506500 -- [-913.648] (-914.104) (-918.527) (-912.659) * (-911.554) [-914.446] (-911.997) (-912.987) -- 0:00:30 507000 -- (-911.100) [-910.336] (-915.344) (-913.293) * (-912.759) (-911.475) [-912.654] (-912.288) -- 0:00:30 507500 -- [-912.232] (-911.564) (-915.026) (-912.036) * (-915.866) (-911.613) [-911.147] (-910.862) -- 0:00:30 508000 -- (-911.619) [-911.593] (-914.294) (-910.839) * (-913.897) (-911.204) [-912.732] (-913.247) -- 0:00:30 508500 -- (-911.439) [-912.931] (-915.398) (-912.206) * (-912.146) (-912.244) [-910.509] (-910.888) -- 0:00:29 509000 -- (-912.425) (-911.111) (-913.328) [-910.953] * [-911.983] (-910.166) (-917.324) (-912.374) -- 0:00:29 509500 -- (-910.372) (-911.317) (-913.491) [-911.081] * (-910.218) (-909.762) [-912.320] (-913.157) -- 0:00:29 510000 -- (-910.372) [-912.389] (-913.272) (-911.324) * (-912.449) (-914.725) (-915.311) [-912.129] -- 0:00:29 Average standard deviation of split frequencies: 0.008634 510500 -- (-911.041) (-911.170) (-911.260) [-911.029] * (-913.210) (-920.642) (-914.578) [-910.769] -- 0:00:29 511000 -- (-911.687) (-911.282) (-911.595) [-910.354] * (-915.204) [-912.056] (-914.095) (-911.171) -- 0:00:29 511500 -- (-912.467) (-910.618) [-910.453] (-910.848) * (-917.862) (-910.659) [-913.978] (-913.324) -- 0:00:29 512000 -- [-912.871] (-911.865) (-910.587) (-911.512) * [-915.273] (-911.932) (-911.433) (-910.217) -- 0:00:29 512500 -- (-910.562) [-910.343] (-910.155) (-912.945) * (-913.129) (-911.424) (-914.165) [-911.831] -- 0:00:29 513000 -- [-913.373] (-909.547) (-909.919) (-912.614) * (-910.966) (-911.979) (-913.630) [-911.910] -- 0:00:29 513500 -- (-910.293) (-909.823) (-910.454) [-912.664] * (-910.069) (-912.201) (-911.729) [-912.388] -- 0:00:29 514000 -- [-910.085] (-910.478) (-910.697) (-909.896) * (-910.281) [-911.726] (-911.975) (-909.830) -- 0:00:29 514500 -- [-912.010] (-912.942) (-909.990) (-910.696) * (-913.968) (-913.034) [-910.787] (-910.966) -- 0:00:29 515000 -- (-913.986) [-911.464] (-910.365) (-912.486) * (-914.302) (-912.592) (-911.780) [-911.392] -- 0:00:29 Average standard deviation of split frequencies: 0.008222 515500 -- [-911.804] (-912.141) (-913.656) (-912.740) * [-911.668] (-911.434) (-911.129) (-913.104) -- 0:00:29 516000 -- (-911.432) [-910.384] (-914.087) (-911.107) * (-918.552) (-911.521) (-911.327) [-911.944] -- 0:00:29 516500 -- (-910.589) [-910.425] (-913.493) (-912.574) * (-912.134) [-912.386] (-913.946) (-913.765) -- 0:00:29 517000 -- (-911.525) [-911.823] (-912.251) (-916.838) * (-911.224) (-915.674) (-912.860) [-914.155] -- 0:00:29 517500 -- (-913.548) (-912.494) (-911.585) [-915.266] * (-910.492) [-915.124] (-910.725) (-912.451) -- 0:00:29 518000 -- (-911.765) (-911.360) [-913.542] (-916.138) * (-912.922) (-911.462) (-911.160) [-911.378] -- 0:00:29 518500 -- [-912.612] (-911.800) (-912.135) (-912.043) * (-912.065) (-910.272) (-919.077) [-910.094] -- 0:00:29 519000 -- (-910.372) (-913.590) [-912.909] (-911.779) * (-910.792) (-915.038) (-914.022) [-912.860] -- 0:00:29 519500 -- (-915.644) (-911.843) [-913.217] (-912.121) * (-911.190) (-916.427) (-910.953) [-912.254] -- 0:00:29 520000 -- (-914.664) [-913.208] (-915.207) (-913.926) * (-913.894) (-913.442) [-912.861] (-915.006) -- 0:00:29 Average standard deviation of split frequencies: 0.008828 520500 -- (-910.349) (-912.057) [-914.924] (-913.190) * (-913.913) [-912.576] (-910.686) (-912.991) -- 0:00:29 521000 -- (-910.172) [-914.291] (-911.585) (-912.705) * (-912.041) [-910.256] (-916.763) (-910.728) -- 0:00:29 521500 -- (-912.469) (-910.725) [-912.193] (-911.506) * [-912.268] (-909.713) (-915.922) (-912.771) -- 0:00:29 522000 -- (-913.129) (-910.583) (-912.123) [-910.529] * (-913.397) (-913.609) [-910.084] (-910.224) -- 0:00:29 522500 -- [-912.085] (-911.045) (-911.866) (-911.831) * (-913.926) (-912.535) [-912.093] (-913.705) -- 0:00:29 523000 -- (-910.917) (-912.242) [-912.534] (-912.401) * [-911.732] (-913.433) (-910.629) (-911.201) -- 0:00:29 523500 -- (-915.612) [-914.568] (-913.983) (-916.541) * (-910.967) (-918.288) [-911.687] (-910.715) -- 0:00:29 524000 -- (-911.780) (-910.309) [-911.260] (-912.278) * [-913.070] (-913.017) (-911.329) (-909.967) -- 0:00:29 524500 -- (-912.595) [-910.002] (-911.797) (-911.171) * (-912.485) (-912.442) [-911.157] (-910.034) -- 0:00:29 525000 -- (-910.602) [-911.091] (-913.962) (-910.248) * [-911.500] (-911.775) (-912.673) (-910.164) -- 0:00:28 Average standard deviation of split frequencies: 0.008698 525500 -- [-910.445] (-912.188) (-914.400) (-911.087) * (-911.830) [-910.826] (-911.872) (-910.856) -- 0:00:28 526000 -- (-911.685) (-912.185) (-911.502) [-910.982] * (-912.935) [-910.807] (-910.353) (-909.499) -- 0:00:28 526500 -- (-914.228) (-911.642) (-913.388) [-910.267] * [-911.321] (-911.404) (-910.382) (-912.455) -- 0:00:28 527000 -- (-914.695) (-915.886) [-913.312] (-910.520) * (-911.378) [-912.740] (-915.742) (-910.180) -- 0:00:28 527500 -- (-911.598) (-912.340) [-910.454] (-914.327) * [-911.143] (-912.651) (-912.351) (-912.935) -- 0:00:28 528000 -- (-913.378) [-910.933] (-911.714) (-911.539) * [-912.308] (-912.784) (-913.848) (-911.773) -- 0:00:28 528500 -- [-912.512] (-911.077) (-910.520) (-910.986) * [-910.672] (-913.750) (-913.195) (-910.433) -- 0:00:28 529000 -- (-912.843) (-911.553) (-917.647) [-911.240] * (-913.529) (-914.749) [-914.929] (-911.987) -- 0:00:28 529500 -- (-915.805) (-913.929) (-914.223) [-912.618] * (-912.997) [-913.120] (-916.085) (-914.554) -- 0:00:28 530000 -- [-913.280] (-911.602) (-910.345) (-910.261) * (-913.531) [-911.736] (-913.449) (-912.056) -- 0:00:28 Average standard deviation of split frequencies: 0.008828 530500 -- (-911.731) [-912.270] (-911.810) (-911.333) * (-913.453) (-911.813) [-912.410] (-913.795) -- 0:00:28 531000 -- (-910.907) [-912.270] (-910.905) (-911.268) * (-910.888) (-913.125) (-911.781) [-913.984] -- 0:00:28 531500 -- (-910.904) (-910.458) [-910.845] (-913.422) * (-913.396) (-911.829) [-917.864] (-912.995) -- 0:00:28 532000 -- [-913.925] (-910.149) (-910.336) (-910.530) * (-911.504) (-913.121) (-913.278) [-910.709] -- 0:00:28 532500 -- [-911.229] (-917.215) (-909.905) (-910.530) * (-911.976) (-911.554) (-911.372) [-913.141] -- 0:00:28 533000 -- [-912.145] (-912.212) (-911.037) (-913.118) * (-911.966) (-913.687) (-910.712) [-912.072] -- 0:00:28 533500 -- (-910.461) (-919.264) [-911.079] (-911.458) * [-911.546] (-912.938) (-911.832) (-913.945) -- 0:00:28 534000 -- (-911.482) (-913.032) [-913.681] (-912.770) * (-910.225) (-912.223) (-910.736) [-911.496] -- 0:00:28 534500 -- (-910.353) (-912.734) (-910.695) [-910.922] * (-912.073) (-910.188) (-912.553) [-909.871] -- 0:00:28 535000 -- (-911.614) (-912.860) [-911.554] (-914.331) * (-911.932) (-911.125) (-911.980) [-909.729] -- 0:00:28 Average standard deviation of split frequencies: 0.008740 535500 -- (-911.435) (-911.829) [-911.528] (-916.016) * (-914.305) [-911.788] (-911.901) (-913.089) -- 0:00:28 536000 -- (-912.016) [-910.977] (-911.457) (-916.527) * (-912.029) (-913.967) [-910.160] (-913.606) -- 0:00:28 536500 -- (-914.129) [-910.957] (-911.525) (-911.210) * [-914.753] (-915.485) (-910.285) (-910.518) -- 0:00:28 537000 -- [-911.403] (-910.317) (-913.248) (-913.414) * (-910.942) (-910.519) (-914.762) [-910.689] -- 0:00:28 537500 -- (-911.099) [-913.831] (-910.440) (-911.751) * (-910.454) [-911.514] (-910.073) (-910.145) -- 0:00:28 538000 -- [-911.989] (-915.714) (-909.894) (-911.172) * (-912.440) (-911.846) [-910.777] (-910.352) -- 0:00:28 538500 -- (-915.249) (-912.368) [-910.000] (-910.893) * [-915.391] (-911.400) (-914.696) (-910.278) -- 0:00:28 539000 -- (-913.266) (-911.103) (-910.246) [-909.707] * (-912.471) [-912.269] (-912.644) (-911.309) -- 0:00:28 539500 -- (-911.937) (-909.876) (-909.700) [-912.621] * (-912.401) (-914.182) [-910.999] (-911.604) -- 0:00:28 540000 -- (-913.076) [-909.813] (-910.530) (-912.186) * (-912.830) (-911.896) [-910.247] (-911.905) -- 0:00:28 Average standard deviation of split frequencies: 0.009155 540500 -- [-912.805] (-911.305) (-910.353) (-911.708) * (-909.816) (-912.378) [-911.411] (-913.716) -- 0:00:28 541000 -- (-911.127) [-909.916] (-917.745) (-910.667) * (-910.459) [-912.835] (-911.749) (-915.225) -- 0:00:27 541500 -- [-910.767] (-910.598) (-910.713) (-910.315) * [-909.925] (-916.887) (-914.018) (-911.670) -- 0:00:27 542000 -- (-911.802) (-912.000) [-911.356] (-914.385) * (-910.072) [-911.825] (-912.723) (-909.566) -- 0:00:27 542500 -- [-912.554] (-911.496) (-912.053) (-913.324) * [-911.518] (-912.345) (-913.329) (-909.668) -- 0:00:27 543000 -- (-911.791) [-916.856] (-910.718) (-914.230) * (-913.951) [-911.288] (-913.325) (-911.301) -- 0:00:27 543500 -- (-910.373) (-916.998) (-912.547) [-913.248] * (-910.312) (-910.883) [-911.428] (-910.419) -- 0:00:27 544000 -- (-911.297) [-911.444] (-917.146) (-915.699) * [-910.602] (-911.344) (-912.201) (-910.109) -- 0:00:27 544500 -- (-913.813) (-911.935) [-915.537] (-913.019) * (-911.847) (-910.367) (-914.458) [-913.108] -- 0:00:27 545000 -- (-912.068) [-912.172] (-914.340) (-913.462) * (-910.986) (-909.852) [-914.278] (-912.417) -- 0:00:27 Average standard deviation of split frequencies: 0.008735 545500 -- [-912.565] (-910.595) (-916.821) (-915.346) * (-910.086) (-910.632) (-910.869) [-910.628] -- 0:00:27 546000 -- [-911.690] (-911.660) (-912.346) (-912.269) * (-910.477) (-912.755) (-913.014) [-910.575] -- 0:00:27 546500 -- (-913.370) [-911.471] (-910.625) (-910.828) * [-910.562] (-909.876) (-913.117) (-915.552) -- 0:00:27 547000 -- (-912.453) (-911.367) (-910.510) [-912.676] * [-911.967] (-913.577) (-912.741) (-911.184) -- 0:00:27 547500 -- (-914.622) (-911.634) [-912.521] (-915.506) * (-913.223) (-913.473) (-916.548) [-911.628] -- 0:00:27 548000 -- (-910.779) [-913.860] (-913.682) (-911.678) * (-910.565) (-910.283) [-912.528] (-912.705) -- 0:00:27 548500 -- [-912.038] (-912.919) (-912.878) (-913.745) * (-911.204) (-910.813) (-911.996) [-913.753] -- 0:00:27 549000 -- (-912.175) (-917.437) [-913.164] (-912.600) * (-912.059) (-911.718) [-912.864] (-914.703) -- 0:00:27 549500 -- [-911.949] (-918.672) (-921.799) (-912.019) * (-910.343) [-911.138] (-910.437) (-912.095) -- 0:00:27 550000 -- [-912.343] (-914.590) (-915.835) (-911.277) * (-910.576) (-910.618) (-915.219) [-912.556] -- 0:00:27 Average standard deviation of split frequencies: 0.009115 550500 -- (-912.356) (-916.571) [-910.724] (-911.879) * (-915.817) (-910.792) (-917.278) [-912.018] -- 0:00:27 551000 -- (-913.010) (-911.490) (-911.793) [-913.543] * [-910.956] (-912.711) (-915.494) (-915.734) -- 0:00:27 551500 -- (-912.807) [-910.299] (-912.314) (-911.164) * [-911.806] (-912.832) (-916.657) (-912.471) -- 0:00:27 552000 -- (-913.191) (-911.312) [-914.402] (-913.019) * (-912.198) (-914.485) [-916.003] (-913.164) -- 0:00:27 552500 -- (-912.214) (-910.530) (-910.678) [-912.568] * (-918.335) [-911.144] (-911.435) (-911.950) -- 0:00:27 553000 -- (-912.970) (-911.442) [-913.832] (-916.455) * [-915.415] (-910.581) (-913.239) (-911.337) -- 0:00:27 553500 -- (-909.912) (-915.726) [-917.734] (-915.027) * (-912.237) (-910.676) (-910.947) [-912.549] -- 0:00:27 554000 -- (-913.166) (-911.899) (-914.550) [-911.137] * (-911.201) [-911.513] (-912.124) (-912.547) -- 0:00:27 554500 -- (-910.303) [-911.554] (-913.963) (-913.986) * (-911.912) [-910.343] (-913.031) (-911.740) -- 0:00:27 555000 -- (-910.907) (-911.638) (-911.517) [-911.230] * (-910.389) (-913.544) [-912.528] (-912.625) -- 0:00:27 Average standard deviation of split frequencies: 0.009379 555500 -- (-912.834) (-911.251) [-911.232] (-917.036) * [-912.724] (-911.477) (-914.196) (-916.362) -- 0:00:27 556000 -- (-911.967) (-913.716) (-913.591) [-915.678] * (-911.812) [-911.883] (-911.268) (-909.961) -- 0:00:27 556500 -- (-910.534) [-912.019] (-913.987) (-910.997) * (-918.589) (-911.097) (-914.183) [-909.885] -- 0:00:27 557000 -- (-915.419) [-910.920] (-910.843) (-911.485) * (-915.259) (-911.195) [-910.999] (-910.497) -- 0:00:27 557500 -- (-914.818) (-911.488) [-911.008] (-914.458) * (-914.662) (-910.859) [-910.712] (-911.448) -- 0:00:26 558000 -- (-914.473) (-913.191) [-912.913] (-912.033) * (-913.478) [-911.540] (-915.172) (-913.726) -- 0:00:26 558500 -- (-911.634) (-910.766) [-910.263] (-912.298) * (-911.925) (-910.892) [-911.413] (-912.124) -- 0:00:26 559000 -- [-911.017] (-912.107) (-915.234) (-915.065) * (-913.368) (-910.619) (-912.790) [-911.271] -- 0:00:26 559500 -- [-911.222] (-912.048) (-917.291) (-911.821) * (-916.216) (-910.613) [-911.514] (-910.570) -- 0:00:26 560000 -- (-911.000) (-914.822) (-911.554) [-914.855] * (-912.473) (-911.088) [-912.518] (-911.498) -- 0:00:26 Average standard deviation of split frequencies: 0.009039 560500 -- (-911.081) (-912.016) [-910.627] (-912.008) * [-912.825] (-911.029) (-912.638) (-911.047) -- 0:00:26 561000 -- (-910.810) (-915.421) (-913.321) [-911.517] * (-911.525) (-911.032) (-912.767) [-911.134] -- 0:00:26 561500 -- (-915.121) (-916.740) (-912.206) [-913.675] * (-911.995) (-915.490) (-914.003) [-911.325] -- 0:00:26 562000 -- (-912.410) (-914.822) [-911.716] (-922.176) * (-914.029) (-912.967) (-912.559) [-912.761] -- 0:00:26 562500 -- (-914.466) [-911.668] (-911.120) (-913.648) * [-913.173] (-912.428) (-914.197) (-912.177) -- 0:00:26 563000 -- [-911.722] (-913.307) (-913.537) (-914.352) * (-915.007) [-912.817] (-910.823) (-910.776) -- 0:00:26 563500 -- [-910.989] (-910.335) (-910.945) (-912.850) * (-915.846) (-912.775) [-915.083] (-915.212) -- 0:00:26 564000 -- (-910.774) (-911.922) (-911.890) [-912.529] * (-911.567) [-910.986] (-913.392) (-914.128) -- 0:00:26 564500 -- (-910.427) (-911.284) (-910.691) [-915.380] * [-912.782] (-910.395) (-911.802) (-912.039) -- 0:00:26 565000 -- [-911.023] (-912.138) (-914.620) (-915.684) * (-913.218) (-913.428) (-911.573) [-912.700] -- 0:00:26 Average standard deviation of split frequencies: 0.008797 565500 -- (-911.036) (-912.950) [-910.468] (-911.789) * (-913.059) (-911.819) (-910.346) [-913.741] -- 0:00:26 566000 -- (-912.064) [-910.690] (-911.381) (-912.303) * (-914.641) (-911.946) (-910.274) [-912.318] -- 0:00:26 566500 -- (-912.681) (-913.658) [-911.310] (-915.589) * (-911.631) (-912.684) [-910.398] (-911.966) -- 0:00:26 567000 -- [-914.370] (-912.164) (-911.563) (-910.509) * (-910.070) (-916.650) (-910.117) [-911.874] -- 0:00:26 567500 -- [-912.693] (-910.802) (-910.713) (-912.266) * (-909.711) (-916.292) (-910.542) [-910.677] -- 0:00:26 568000 -- [-914.636] (-911.475) (-910.731) (-913.235) * (-909.938) [-912.641] (-911.405) (-910.617) -- 0:00:26 568500 -- (-910.830) [-911.996] (-912.908) (-912.884) * (-912.303) (-911.888) (-911.448) [-910.234] -- 0:00:26 569000 -- (-911.784) (-912.390) (-912.178) [-910.053] * (-911.934) (-910.923) [-913.249] (-912.419) -- 0:00:26 569500 -- [-910.730] (-912.352) (-910.681) (-910.000) * (-912.530) (-913.370) [-911.403] (-910.858) -- 0:00:26 570000 -- [-910.374] (-911.215) (-910.622) (-911.454) * [-915.259] (-912.868) (-913.648) (-911.658) -- 0:00:26 Average standard deviation of split frequencies: 0.008519 570500 -- (-910.819) (-911.849) (-911.877) [-910.456] * (-914.041) (-913.004) (-909.698) [-913.428] -- 0:00:26 571000 -- (-911.051) [-911.213] (-910.831) (-911.875) * (-916.255) (-913.359) (-913.788) [-911.856] -- 0:00:26 571500 -- (-910.542) [-911.966] (-913.596) (-913.829) * (-911.114) (-911.774) (-918.276) [-911.039] -- 0:00:26 572000 -- (-910.118) (-911.189) [-912.343] (-910.168) * (-912.763) (-911.024) [-912.349] (-912.067) -- 0:00:26 572500 -- (-912.297) [-910.234] (-915.657) (-910.723) * (-911.993) (-911.766) (-912.905) [-911.895] -- 0:00:26 573000 -- [-910.833] (-910.723) (-911.665) (-913.547) * (-911.873) [-911.202] (-912.404) (-912.812) -- 0:00:26 573500 -- [-910.128] (-912.314) (-911.696) (-912.541) * (-911.950) [-911.984] (-913.282) (-911.860) -- 0:00:26 574000 -- (-910.326) (-910.224) [-911.048] (-910.159) * (-913.916) (-912.509) [-911.023] (-910.835) -- 0:00:25 574500 -- [-912.240] (-912.356) (-911.226) (-913.421) * (-912.898) (-912.664) (-913.252) [-911.999] -- 0:00:25 575000 -- [-913.607] (-912.196) (-916.255) (-912.045) * (-912.987) (-914.758) [-912.334] (-910.166) -- 0:00:25 Average standard deviation of split frequencies: 0.008521 575500 -- (-911.735) [-911.941] (-913.948) (-914.401) * (-910.833) [-910.989] (-914.099) (-910.938) -- 0:00:25 576000 -- (-912.543) [-911.245] (-911.404) (-910.846) * (-910.737) (-913.043) [-911.094] (-913.008) -- 0:00:25 576500 -- [-910.481] (-913.009) (-915.286) (-910.696) * (-912.909) [-911.476] (-912.807) (-910.410) -- 0:00:25 577000 -- (-914.248) (-912.686) (-911.177) [-912.000] * (-912.742) (-911.357) [-912.872] (-911.451) -- 0:00:25 577500 -- (-912.753) (-913.090) (-911.104) [-912.067] * (-916.478) [-911.185] (-912.427) (-912.354) -- 0:00:25 578000 -- (-910.474) (-911.432) [-912.037] (-911.540) * (-914.457) (-911.611) [-913.999] (-911.595) -- 0:00:25 578500 -- (-915.435) (-913.581) (-912.464) [-911.656] * (-914.030) (-913.469) [-912.211] (-911.304) -- 0:00:25 579000 -- (-910.332) [-911.649] (-915.832) (-911.730) * (-915.036) (-910.386) [-913.633] (-911.954) -- 0:00:25 579500 -- (-912.411) (-913.735) (-913.044) [-912.913] * (-912.100) (-910.083) [-910.639] (-911.317) -- 0:00:25 580000 -- [-910.581] (-910.331) (-912.267) (-911.879) * (-915.690) (-912.137) [-910.112] (-911.319) -- 0:00:25 Average standard deviation of split frequencies: 0.008691 580500 -- [-911.124] (-910.726) (-912.444) (-912.022) * (-912.805) (-911.205) (-911.318) [-910.073] -- 0:00:25 581000 -- (-915.657) (-917.035) [-912.897] (-912.810) * [-912.171] (-912.393) (-910.340) (-911.013) -- 0:00:25 581500 -- (-911.953) (-916.072) [-910.832] (-913.758) * [-911.699] (-911.041) (-910.849) (-910.450) -- 0:00:25 582000 -- [-912.372] (-913.343) (-911.596) (-912.921) * (-913.544) (-911.044) [-911.628] (-911.152) -- 0:00:25 582500 -- (-912.436) [-910.287] (-919.653) (-913.312) * [-911.657] (-910.816) (-912.012) (-911.340) -- 0:00:25 583000 -- [-910.677] (-910.742) (-913.833) (-911.092) * (-911.074) (-914.044) [-913.689] (-912.115) -- 0:00:25 583500 -- [-910.768] (-911.702) (-913.187) (-909.994) * (-910.743) (-910.067) [-910.132] (-912.031) -- 0:00:25 584000 -- (-911.122) (-910.432) [-913.008] (-912.634) * (-914.275) (-913.560) [-910.636] (-911.299) -- 0:00:25 584500 -- (-913.052) (-912.097) [-911.757] (-911.234) * (-911.870) (-918.448) (-914.248) [-911.051] -- 0:00:25 585000 -- (-910.726) (-911.485) (-913.097) [-909.963] * (-910.488) [-911.141] (-913.708) (-910.931) -- 0:00:25 Average standard deviation of split frequencies: 0.008754 585500 -- (-910.112) (-912.189) (-911.544) [-910.123] * (-910.787) (-910.367) (-914.182) [-910.672] -- 0:00:25 586000 -- (-910.064) (-912.285) (-911.758) [-911.097] * (-911.741) (-910.818) (-912.998) [-910.395] -- 0:00:25 586500 -- (-912.300) [-912.919] (-911.829) (-911.348) * (-911.501) (-910.729) [-910.922] (-914.152) -- 0:00:25 587000 -- (-910.315) [-911.249] (-912.342) (-910.700) * (-910.303) (-910.087) [-911.723] (-911.735) -- 0:00:25 587500 -- [-914.473] (-913.269) (-911.641) (-912.128) * (-912.494) [-909.984] (-918.256) (-916.993) -- 0:00:25 588000 -- (-913.364) (-910.373) [-913.316] (-915.639) * [-911.372] (-910.873) (-910.627) (-910.736) -- 0:00:25 588500 -- (-913.391) (-911.306) [-914.774] (-913.544) * (-911.275) (-912.866) [-911.382] (-911.545) -- 0:00:25 589000 -- (-912.360) (-916.878) [-910.357] (-911.185) * [-912.827] (-911.426) (-913.578) (-910.797) -- 0:00:25 589500 -- (-911.274) (-911.806) [-910.924] (-914.639) * [-912.798] (-911.672) (-913.148) (-910.098) -- 0:00:25 590000 -- (-911.084) (-911.921) [-912.316] (-917.596) * (-912.396) [-913.220] (-914.149) (-912.703) -- 0:00:25 Average standard deviation of split frequencies: 0.008779 590500 -- [-911.581] (-910.531) (-910.261) (-918.635) * (-909.947) (-912.330) (-911.812) [-914.047] -- 0:00:24 591000 -- (-913.072) [-911.543] (-911.007) (-912.460) * (-910.959) (-912.123) (-912.115) [-911.101] -- 0:00:24 591500 -- (-914.487) (-914.856) [-910.088] (-912.741) * (-911.766) [-912.151] (-910.857) (-911.116) -- 0:00:24 592000 -- [-913.769] (-912.990) (-912.687) (-913.317) * (-911.931) [-909.963] (-910.177) (-911.815) -- 0:00:24 592500 -- (-915.933) (-912.730) [-910.996] (-910.714) * [-910.074] (-910.406) (-911.664) (-911.866) -- 0:00:24 593000 -- (-911.655) [-912.191] (-911.482) (-915.855) * (-912.039) [-910.684] (-911.617) (-912.128) -- 0:00:24 593500 -- (-917.854) (-912.484) [-913.991] (-914.308) * (-910.622) (-913.106) (-912.364) [-910.608] -- 0:00:24 594000 -- (-916.239) (-911.282) [-912.302] (-910.881) * [-911.994] (-913.329) (-911.197) (-911.081) -- 0:00:24 594500 -- (-911.227) (-911.348) (-910.338) [-910.805] * (-910.803) [-912.280] (-910.702) (-912.876) -- 0:00:24 595000 -- (-913.030) (-912.033) [-911.799] (-914.897) * (-910.799) (-912.314) (-910.156) [-911.067] -- 0:00:24 Average standard deviation of split frequencies: 0.009046 595500 -- [-912.129] (-912.456) (-911.796) (-913.219) * (-910.145) (-909.843) (-910.782) [-912.000] -- 0:00:24 596000 -- (-918.143) (-912.480) (-913.139) [-912.122] * (-910.738) (-909.843) [-910.063] (-912.730) -- 0:00:24 596500 -- (-916.222) [-914.844] (-910.912) (-911.243) * [-911.392] (-910.223) (-910.529) (-912.760) -- 0:00:24 597000 -- (-910.240) [-915.292] (-912.219) (-912.136) * (-911.397) (-911.783) [-911.190] (-916.928) -- 0:00:24 597500 -- [-915.450] (-912.911) (-910.470) (-910.564) * (-911.856) (-911.663) (-912.024) [-911.597] -- 0:00:24 598000 -- (-911.059) (-917.160) [-910.219] (-910.602) * [-912.485] (-910.918) (-911.302) (-914.978) -- 0:00:24 598500 -- (-911.419) [-911.296] (-910.850) (-911.132) * (-912.899) (-910.315) [-910.692] (-912.183) -- 0:00:24 599000 -- [-912.426] (-911.036) (-910.532) (-915.539) * (-911.212) (-913.450) [-911.391] (-911.144) -- 0:00:24 599500 -- (-910.073) [-911.822] (-911.682) (-914.688) * (-912.135) (-911.691) (-911.902) [-912.851] -- 0:00:24 600000 -- (-910.503) [-912.984] (-911.752) (-916.685) * [-911.708] (-918.072) (-912.198) (-911.694) -- 0:00:24 Average standard deviation of split frequencies: 0.009320 600500 -- (-910.846) (-914.230) [-910.275] (-914.416) * (-911.213) [-918.447] (-911.924) (-910.506) -- 0:00:24 601000 -- (-915.140) [-910.463] (-912.423) (-915.519) * (-913.140) [-917.149] (-911.111) (-910.506) -- 0:00:24 601500 -- (-912.080) (-910.158) (-911.834) [-909.983] * [-912.433] (-912.292) (-910.975) (-911.939) -- 0:00:24 602000 -- (-911.171) (-911.806) (-913.673) [-910.397] * [-912.634] (-910.604) (-911.081) (-911.558) -- 0:00:24 602500 -- (-913.881) (-911.647) [-912.582] (-913.833) * (-911.639) (-911.396) (-911.183) [-910.378] -- 0:00:24 603000 -- (-910.610) [-910.150] (-912.828) (-913.344) * (-910.450) [-910.271] (-911.953) (-910.535) -- 0:00:24 603500 -- (-913.835) (-915.786) [-911.260] (-913.628) * (-913.819) [-910.406] (-911.117) (-913.044) -- 0:00:24 604000 -- (-913.535) (-911.864) (-912.591) [-911.320] * (-914.049) (-909.836) [-913.359] (-911.050) -- 0:00:24 604500 -- (-910.813) [-912.598] (-909.904) (-910.056) * (-909.660) (-915.096) [-912.362] (-910.942) -- 0:00:24 605000 -- (-911.144) (-916.421) (-909.769) [-910.616] * (-911.780) (-911.499) (-913.437) [-911.045] -- 0:00:24 Average standard deviation of split frequencies: 0.008969 605500 -- (-912.525) (-917.792) [-910.127] (-909.931) * (-911.057) [-911.455] (-912.831) (-909.812) -- 0:00:24 606000 -- [-912.166] (-919.100) (-911.949) (-910.435) * (-911.724) (-913.787) [-913.176] (-910.577) -- 0:00:24 606500 -- (-909.969) (-917.203) (-911.770) [-911.265] * [-911.985] (-912.874) (-910.563) (-911.664) -- 0:00:24 607000 -- (-910.151) (-909.950) (-914.487) [-910.531] * (-911.750) (-911.113) (-909.979) [-912.756] -- 0:00:23 607500 -- (-910.965) [-910.767] (-910.276) (-910.657) * (-912.982) (-910.963) (-913.832) [-910.860] -- 0:00:23 608000 -- (-910.095) [-910.798] (-911.972) (-910.600) * (-911.509) (-911.031) [-912.276] (-911.702) -- 0:00:23 608500 -- (-915.734) [-910.374] (-913.485) (-913.333) * (-911.547) (-911.222) (-915.857) [-909.693] -- 0:00:23 609000 -- (-912.111) [-910.338] (-912.510) (-911.910) * (-910.599) (-912.829) (-910.856) [-910.508] -- 0:00:23 609500 -- (-911.219) (-918.261) (-911.894) [-911.706] * (-909.959) (-910.860) [-911.820] (-912.019) -- 0:00:23 610000 -- (-910.959) (-916.376) (-915.519) [-914.186] * (-911.622) (-918.439) [-913.216] (-912.492) -- 0:00:23 Average standard deviation of split frequencies: 0.009490 610500 -- (-913.825) (-911.746) [-912.183] (-914.039) * [-911.818] (-915.540) (-913.970) (-913.611) -- 0:00:23 611000 -- (-913.538) (-915.282) [-912.552] (-914.050) * (-910.856) (-911.230) [-911.068] (-913.147) -- 0:00:23 611500 -- (-910.796) (-913.760) [-911.526] (-918.817) * (-912.000) [-910.953] (-912.435) (-911.396) -- 0:00:23 612000 -- (-910.283) (-913.157) (-910.826) [-911.796] * (-910.949) (-910.278) [-913.393] (-913.758) -- 0:00:23 612500 -- [-910.494] (-913.935) (-912.735) (-911.489) * (-911.158) (-910.919) [-912.095] (-910.247) -- 0:00:23 613000 -- [-914.861] (-914.355) (-914.090) (-912.278) * (-917.516) [-910.546] (-916.757) (-910.095) -- 0:00:23 613500 -- (-914.891) (-913.352) (-914.000) [-916.832] * (-910.515) (-910.693) (-912.263) [-912.471] -- 0:00:23 614000 -- (-911.212) (-912.782) (-912.865) [-911.850] * (-912.150) (-918.161) [-911.875] (-911.010) -- 0:00:23 614500 -- [-910.000] (-912.266) (-910.599) (-913.957) * [-910.851] (-915.440) (-909.887) (-914.773) -- 0:00:23 615000 -- (-911.291) (-912.729) [-910.643] (-912.514) * [-911.674] (-912.251) (-912.593) (-910.477) -- 0:00:23 Average standard deviation of split frequencies: 0.009318 615500 -- (-911.994) (-911.777) [-912.185] (-913.288) * (-911.519) [-910.958] (-911.592) (-910.714) -- 0:00:23 616000 -- [-916.295] (-910.692) (-910.879) (-914.504) * [-911.279] (-916.108) (-912.437) (-915.947) -- 0:00:23 616500 -- (-917.496) (-910.074) [-912.064] (-913.848) * (-910.526) (-910.135) [-914.110] (-912.096) -- 0:00:23 617000 -- (-912.202) (-910.489) [-911.726] (-910.724) * (-914.535) (-912.860) (-915.179) [-910.469] -- 0:00:23 617500 -- (-910.011) [-917.319] (-912.092) (-910.550) * (-910.461) (-912.064) [-912.465] (-911.194) -- 0:00:23 618000 -- [-910.170] (-914.367) (-910.303) (-910.175) * [-910.888] (-909.881) (-912.421) (-912.195) -- 0:00:23 618500 -- (-911.370) [-912.918] (-910.324) (-914.761) * (-919.088) [-911.618] (-911.049) (-914.964) -- 0:00:23 619000 -- [-911.238] (-913.353) (-912.751) (-911.968) * [-911.358] (-912.616) (-910.598) (-911.628) -- 0:00:23 619500 -- (-911.464) [-911.418] (-913.111) (-911.302) * (-915.785) [-913.082] (-913.126) (-910.278) -- 0:00:23 620000 -- (-913.971) [-910.525] (-913.965) (-911.620) * [-914.989] (-909.999) (-913.783) (-911.263) -- 0:00:23 Average standard deviation of split frequencies: 0.009293 620500 -- [-914.250] (-910.404) (-910.844) (-912.585) * (-911.344) (-911.457) (-911.357) [-912.228] -- 0:00:23 621000 -- (-912.703) [-911.049] (-910.949) (-914.004) * [-912.072] (-910.129) (-912.222) (-912.606) -- 0:00:23 621500 -- (-912.094) (-912.904) (-910.458) [-913.270] * (-912.988) (-912.902) [-913.834] (-913.639) -- 0:00:23 622000 -- (-911.481) [-910.565] (-913.017) (-912.091) * [-912.021] (-911.124) (-914.658) (-911.909) -- 0:00:23 622500 -- (-917.009) (-913.409) (-912.843) [-914.201] * [-910.619] (-911.640) (-913.670) (-912.660) -- 0:00:23 623000 -- [-914.221] (-910.441) (-914.043) (-913.766) * (-910.913) (-912.923) (-913.052) [-910.398] -- 0:00:22 623500 -- (-911.564) (-910.466) (-911.954) [-912.644] * [-913.955] (-911.710) (-913.707) (-910.894) -- 0:00:22 624000 -- (-911.061) (-912.603) (-912.028) [-912.647] * (-913.117) [-911.422] (-913.018) (-914.397) -- 0:00:22 624500 -- (-911.778) (-914.391) (-910.560) [-913.431] * [-912.558] (-911.931) (-913.368) (-919.958) -- 0:00:22 625000 -- (-914.121) (-912.474) [-910.896] (-913.092) * (-912.739) (-913.598) (-911.138) [-915.317] -- 0:00:22 Average standard deviation of split frequencies: 0.009435 625500 -- (-910.560) [-914.892] (-910.450) (-913.593) * (-911.986) [-910.500] (-915.025) (-915.316) -- 0:00:22 626000 -- [-913.263] (-914.012) (-915.307) (-910.950) * (-910.326) (-911.258) (-911.219) [-911.402] -- 0:00:22 626500 -- (-916.048) (-914.012) (-911.990) [-912.616] * [-910.326] (-911.666) (-911.325) (-913.057) -- 0:00:22 627000 -- (-910.846) [-911.412] (-911.913) (-911.963) * (-910.847) [-911.893] (-913.440) (-913.863) -- 0:00:22 627500 -- [-910.282] (-913.015) (-912.309) (-910.928) * [-911.968] (-910.856) (-911.998) (-911.255) -- 0:00:22 628000 -- (-918.109) (-910.435) (-911.575) [-910.524] * (-911.402) [-912.236] (-913.742) (-911.081) -- 0:00:22 628500 -- (-915.073) (-911.987) [-918.585] (-910.531) * [-912.676] (-912.222) (-912.557) (-911.665) -- 0:00:22 629000 -- (-915.927) [-913.416] (-911.290) (-912.425) * (-912.681) (-911.924) (-910.390) [-914.266] -- 0:00:22 629500 -- (-918.514) [-911.148] (-913.001) (-913.374) * (-912.252) (-910.849) [-912.066] (-911.756) -- 0:00:22 630000 -- (-910.657) (-914.345) [-911.582] (-917.127) * (-915.211) (-912.584) (-914.958) [-912.757] -- 0:00:22 Average standard deviation of split frequencies: 0.009146 630500 -- [-913.511] (-911.691) (-911.192) (-912.583) * (-910.575) [-911.494] (-912.086) (-911.074) -- 0:00:22 631000 -- (-913.343) (-912.177) [-910.663] (-913.230) * [-910.174] (-911.750) (-911.136) (-910.964) -- 0:00:22 631500 -- [-910.427] (-913.368) (-910.992) (-913.958) * [-911.101] (-911.265) (-910.524) (-910.604) -- 0:00:22 632000 -- [-910.107] (-913.752) (-910.562) (-911.603) * (-910.404) [-913.964] (-916.231) (-910.589) -- 0:00:22 632500 -- (-910.349) (-910.820) [-916.776] (-912.233) * [-912.095] (-912.766) (-911.259) (-913.285) -- 0:00:22 633000 -- (-912.420) (-910.851) [-911.694] (-911.982) * [-913.084] (-911.145) (-910.458) (-912.665) -- 0:00:22 633500 -- (-910.887) [-911.536] (-913.796) (-915.013) * [-913.420] (-911.075) (-911.038) (-910.404) -- 0:00:22 634000 -- (-915.061) [-910.426] (-913.000) (-911.828) * (-913.936) (-910.972) (-910.493) [-913.564] -- 0:00:22 634500 -- (-912.175) (-910.572) [-914.224] (-910.733) * [-911.279] (-911.503) (-909.771) (-911.210) -- 0:00:22 635000 -- (-910.524) (-911.982) [-912.506] (-913.999) * [-912.163] (-909.638) (-914.230) (-916.981) -- 0:00:22 Average standard deviation of split frequencies: 0.009461 635500 -- (-912.166) (-910.855) [-914.224] (-911.235) * [-911.724] (-910.795) (-911.993) (-916.772) -- 0:00:22 636000 -- (-912.559) (-913.912) [-913.061] (-914.473) * [-912.373] (-910.781) (-914.615) (-909.723) -- 0:00:22 636500 -- (-913.918) [-910.031] (-912.741) (-912.704) * (-910.330) (-910.107) (-913.083) [-910.313] -- 0:00:22 637000 -- (-910.388) (-912.869) (-914.562) [-910.248] * [-914.497] (-910.655) (-916.606) (-911.264) -- 0:00:22 637500 -- (-911.219) [-909.759] (-913.204) (-910.929) * [-910.897] (-914.387) (-914.695) (-913.810) -- 0:00:22 638000 -- (-916.664) [-909.967] (-918.953) (-910.614) * [-911.640] (-912.135) (-912.818) (-914.042) -- 0:00:22 638500 -- (-911.444) (-910.432) (-919.778) [-910.274] * [-912.027] (-911.258) (-914.758) (-910.163) -- 0:00:22 639000 -- (-911.804) (-912.820) [-910.369] (-914.520) * (-910.185) (-910.811) (-910.037) [-910.341] -- 0:00:22 639500 -- (-914.570) (-911.895) [-912.554] (-913.559) * (-910.723) [-910.884] (-911.456) (-910.218) -- 0:00:21 640000 -- [-915.757] (-913.397) (-910.530) (-912.251) * (-913.717) (-913.309) [-912.240] (-910.278) -- 0:00:21 Average standard deviation of split frequencies: 0.008916 640500 -- (-911.014) [-912.407] (-911.259) (-911.137) * [-910.129] (-911.495) (-911.672) (-910.950) -- 0:00:21 641000 -- (-912.175) [-912.107] (-910.470) (-911.288) * [-909.942] (-916.615) (-910.301) (-913.089) -- 0:00:21 641500 -- (-911.299) (-913.657) (-915.202) [-910.737] * (-911.442) (-914.733) (-912.273) [-913.433] -- 0:00:21 642000 -- (-912.502) [-912.792] (-914.066) (-912.597) * (-910.092) [-918.277] (-910.757) (-911.872) -- 0:00:21 642500 -- (-913.604) [-910.593] (-914.726) (-914.843) * [-912.914] (-917.226) (-912.200) (-911.147) -- 0:00:21 643000 -- (-915.346) (-910.406) (-915.534) [-913.172] * (-917.092) (-918.135) [-911.464] (-912.833) -- 0:00:21 643500 -- [-912.082] (-910.958) (-917.683) (-911.769) * [-910.155] (-918.712) (-911.138) (-915.759) -- 0:00:21 644000 -- [-910.518] (-911.304) (-914.908) (-910.466) * (-912.295) (-910.303) [-911.040] (-913.082) -- 0:00:21 644500 -- [-910.221] (-912.937) (-913.711) (-911.590) * (-912.029) [-911.117] (-910.105) (-909.848) -- 0:00:21 645000 -- (-912.125) (-912.841) [-909.958] (-911.807) * (-910.694) (-913.128) (-911.122) [-910.148] -- 0:00:21 Average standard deviation of split frequencies: 0.009143 645500 -- (-911.744) (-913.961) (-911.276) [-909.862] * (-911.059) (-911.893) (-913.929) [-910.985] -- 0:00:21 646000 -- (-913.078) [-910.944] (-912.602) (-912.055) * (-911.056) [-912.404] (-914.557) (-913.211) -- 0:00:21 646500 -- (-910.056) [-911.842] (-912.352) (-909.853) * [-912.931] (-912.760) (-911.863) (-916.353) -- 0:00:21 647000 -- (-910.826) (-912.838) [-910.114] (-910.131) * (-913.046) (-911.714) [-912.975] (-911.169) -- 0:00:21 647500 -- (-913.537) [-912.581] (-917.008) (-912.231) * (-911.910) (-912.348) [-912.302] (-911.598) -- 0:00:21 648000 -- [-913.161] (-912.556) (-912.894) (-914.487) * [-915.222] (-911.460) (-912.258) (-911.308) -- 0:00:21 648500 -- [-912.699] (-911.213) (-909.984) (-910.815) * [-911.722] (-910.687) (-913.736) (-910.626) -- 0:00:21 649000 -- (-910.663) [-913.955] (-914.950) (-914.100) * [-911.330] (-913.902) (-914.114) (-910.192) -- 0:00:21 649500 -- (-910.663) [-913.656] (-911.852) (-912.304) * (-910.699) (-913.798) (-913.934) [-911.366] -- 0:00:21 650000 -- [-912.434] (-912.799) (-911.739) (-912.257) * (-911.162) (-910.616) (-912.340) [-911.996] -- 0:00:21 Average standard deviation of split frequencies: 0.009418 650500 -- [-910.979] (-913.912) (-910.805) (-911.012) * (-912.189) [-913.008] (-911.660) (-916.794) -- 0:00:21 651000 -- (-910.087) [-911.239] (-916.986) (-910.435) * (-910.965) (-913.639) [-911.271] (-912.828) -- 0:00:21 651500 -- (-911.137) (-909.805) (-910.245) [-909.863] * (-911.579) (-917.355) [-911.413] (-910.701) -- 0:00:21 652000 -- (-913.059) (-910.548) [-910.374] (-911.410) * (-912.581) (-912.696) [-914.140] (-910.456) -- 0:00:21 652500 -- (-912.550) (-910.752) [-912.024] (-917.690) * (-913.298) (-917.464) [-913.536] (-911.699) -- 0:00:21 653000 -- [-910.345] (-914.812) (-912.266) (-912.026) * (-911.161) (-911.067) [-912.800] (-910.867) -- 0:00:21 653500 -- [-910.044] (-910.350) (-911.937) (-910.665) * (-911.495) (-913.359) (-910.682) [-912.860] -- 0:00:21 654000 -- [-910.660] (-910.821) (-911.254) (-913.642) * (-910.895) [-917.011] (-910.996) (-913.584) -- 0:00:21 654500 -- (-912.808) [-910.399] (-909.970) (-911.677) * (-911.509) [-910.894] (-909.933) (-912.588) -- 0:00:21 655000 -- (-911.514) (-910.931) (-912.709) [-911.223] * [-910.552] (-913.278) (-911.351) (-910.683) -- 0:00:21 Average standard deviation of split frequencies: 0.009046 655500 -- (-911.485) [-911.111] (-917.369) (-912.097) * (-911.544) [-916.917] (-914.997) (-910.652) -- 0:00:21 656000 -- [-911.569] (-912.087) (-911.813) (-911.102) * (-911.403) [-914.394] (-913.640) (-911.575) -- 0:00:20 656500 -- (-912.320) (-912.359) (-912.862) [-910.902] * (-912.689) [-913.692] (-915.117) (-911.549) -- 0:00:20 657000 -- (-918.652) (-910.390) (-912.500) [-913.179] * (-909.669) (-912.605) (-912.812) [-911.697] -- 0:00:20 657500 -- (-917.800) (-912.550) [-911.058] (-913.972) * (-912.070) [-912.085] (-913.442) (-911.668) -- 0:00:20 658000 -- (-914.206) (-913.776) (-911.693) [-912.737] * [-911.542] (-911.316) (-911.664) (-910.784) -- 0:00:20 658500 -- [-915.784] (-916.874) (-914.799) (-912.067) * [-912.711] (-911.254) (-910.762) (-910.261) -- 0:00:20 659000 -- [-911.514] (-916.607) (-913.762) (-911.203) * [-912.840] (-912.364) (-910.614) (-918.595) -- 0:00:20 659500 -- [-912.313] (-913.722) (-911.469) (-911.610) * (-915.444) (-911.793) (-912.641) [-911.622] -- 0:00:20 660000 -- [-911.244] (-912.423) (-910.146) (-910.995) * (-913.196) (-913.095) [-911.429] (-911.092) -- 0:00:20 Average standard deviation of split frequencies: 0.009150 660500 -- (-913.840) (-912.123) (-911.439) [-910.963] * (-915.677) (-911.134) (-912.704) [-910.963] -- 0:00:20 661000 -- (-913.283) (-911.296) (-910.453) [-911.819] * (-913.083) [-910.752] (-911.881) (-911.978) -- 0:00:20 661500 -- (-913.976) (-919.026) [-909.974] (-916.268) * (-914.841) [-910.167] (-913.329) (-911.660) -- 0:00:20 662000 -- (-912.975) (-912.344) [-910.678] (-914.212) * (-913.068) (-911.327) [-910.808] (-912.225) -- 0:00:20 662500 -- [-912.478] (-912.706) (-912.105) (-910.691) * [-911.134] (-910.952) (-911.034) (-910.581) -- 0:00:20 663000 -- (-911.123) (-910.548) [-910.982] (-910.741) * (-911.911) (-911.798) [-911.591] (-910.870) -- 0:00:20 663500 -- (-909.807) [-911.488] (-911.496) (-913.542) * [-912.105] (-914.874) (-915.146) (-914.824) -- 0:00:20 664000 -- (-910.876) (-912.244) (-912.274) [-913.013] * (-915.117) (-911.296) [-914.224] (-912.513) -- 0:00:20 664500 -- (-910.291) (-910.645) [-911.737] (-912.058) * (-912.118) [-910.661] (-913.158) (-910.236) -- 0:00:20 665000 -- (-917.580) (-911.123) (-911.854) [-910.235] * (-911.699) (-909.676) (-911.313) [-911.330] -- 0:00:20 Average standard deviation of split frequencies: 0.008993 665500 -- (-910.966) (-912.908) [-912.283] (-909.966) * [-910.935] (-912.263) (-912.275) (-912.829) -- 0:00:20 666000 -- (-909.987) [-911.312] (-913.425) (-912.306) * [-911.226] (-915.044) (-916.037) (-912.817) -- 0:00:20 666500 -- (-911.276) [-911.477] (-910.976) (-913.256) * (-913.824) (-914.271) (-912.280) [-911.159] -- 0:00:20 667000 -- (-913.917) (-911.545) (-913.011) [-910.675] * (-911.724) (-919.817) [-910.799] (-913.577) -- 0:00:20 667500 -- (-913.638) [-912.007] (-910.793) (-910.952) * (-911.085) (-914.697) [-911.899] (-910.404) -- 0:00:20 668000 -- (-912.270) (-912.518) [-910.650] (-913.029) * (-915.630) (-911.358) [-910.559] (-910.829) -- 0:00:20 668500 -- (-914.836) (-912.646) (-910.649) [-911.087] * [-915.388] (-911.725) (-911.430) (-912.098) -- 0:00:20 669000 -- [-913.427] (-910.988) (-911.445) (-912.020) * [-913.554] (-910.511) (-913.310) (-910.366) -- 0:00:20 669500 -- (-916.075) (-910.993) [-914.384] (-914.669) * (-911.537) [-911.004] (-914.283) (-913.500) -- 0:00:20 670000 -- (-912.813) (-911.696) [-911.141] (-910.383) * [-910.434] (-911.427) (-910.691) (-912.449) -- 0:00:20 Average standard deviation of split frequencies: 0.009386 670500 -- [-912.651] (-917.090) (-911.619) (-912.218) * (-917.145) (-911.985) [-911.979] (-913.237) -- 0:00:20 671000 -- (-912.062) [-913.768] (-912.171) (-914.539) * (-912.029) [-910.010] (-914.009) (-913.183) -- 0:00:20 671500 -- (-910.445) (-917.344) (-911.128) [-910.292] * (-910.116) [-914.321] (-912.305) (-918.048) -- 0:00:20 672000 -- [-911.857] (-915.086) (-911.583) (-911.604) * (-909.804) (-912.798) [-913.835] (-912.379) -- 0:00:20 672500 -- [-912.890] (-912.165) (-912.108) (-912.615) * (-909.599) (-913.133) [-910.460] (-913.663) -- 0:00:19 673000 -- [-911.991] (-913.529) (-911.487) (-915.118) * (-914.483) [-913.911] (-910.654) (-912.847) -- 0:00:19 673500 -- (-914.279) [-911.592] (-915.540) (-913.386) * [-912.771] (-916.956) (-914.806) (-914.349) -- 0:00:19 674000 -- [-912.999] (-911.182) (-912.721) (-913.732) * (-910.926) (-911.177) (-912.948) [-918.032] -- 0:00:19 674500 -- (-912.381) (-910.771) (-910.508) [-914.719] * (-915.986) (-912.874) (-911.996) [-913.718] -- 0:00:19 675000 -- (-917.206) (-920.275) [-910.447] (-913.458) * [-912.168] (-911.555) (-912.454) (-912.494) -- 0:00:19 Average standard deviation of split frequencies: 0.008819 675500 -- (-911.816) [-915.042] (-910.891) (-913.580) * (-910.768) [-910.933] (-913.821) (-912.939) -- 0:00:19 676000 -- [-912.964] (-916.333) (-918.081) (-911.240) * (-912.072) [-911.941] (-914.017) (-911.563) -- 0:00:19 676500 -- (-914.534) (-912.203) (-915.908) [-913.538] * (-915.214) (-912.333) [-912.553] (-910.299) -- 0:00:19 677000 -- (-914.914) (-912.529) (-911.346) [-911.371] * (-916.004) (-910.713) [-910.469] (-912.787) -- 0:00:19 677500 -- (-911.041) (-912.702) (-911.712) [-910.364] * (-916.173) [-911.729] (-912.814) (-913.293) -- 0:00:19 678000 -- [-916.877] (-910.248) (-913.748) (-910.895) * (-910.995) (-913.902) [-912.202] (-912.140) -- 0:00:19 678500 -- (-916.654) (-910.708) (-913.350) [-913.179] * (-914.012) (-911.151) (-912.670) [-918.012] -- 0:00:19 679000 -- (-911.835) [-912.037] (-914.649) (-912.437) * [-913.301] (-910.431) (-910.839) (-920.030) -- 0:00:19 679500 -- [-910.944] (-913.300) (-910.861) (-910.556) * (-916.171) [-911.692] (-912.145) (-913.882) -- 0:00:19 680000 -- (-911.590) (-910.902) [-914.710] (-914.638) * (-911.721) (-910.100) (-914.312) [-910.616] -- 0:00:19 Average standard deviation of split frequencies: 0.008311 680500 -- (-911.508) (-911.250) (-912.523) [-911.192] * [-913.508] (-911.102) (-911.631) (-909.921) -- 0:00:19 681000 -- (-910.030) [-910.556] (-912.952) (-909.861) * [-912.893] (-916.472) (-912.237) (-911.966) -- 0:00:19 681500 -- (-915.017) (-918.196) (-913.473) [-910.270] * (-910.881) [-913.585] (-911.091) (-914.045) -- 0:00:19 682000 -- [-912.331] (-910.371) (-910.214) (-913.171) * (-914.539) [-910.915] (-915.281) (-910.239) -- 0:00:19 682500 -- (-913.461) [-915.412] (-910.856) (-913.462) * (-912.970) (-911.303) [-912.539] (-910.666) -- 0:00:19 683000 -- (-915.120) (-911.006) [-911.496] (-916.084) * (-909.658) (-912.909) (-913.066) [-912.033] -- 0:00:19 683500 -- (-914.953) (-909.771) [-912.147] (-915.801) * (-912.473) (-910.664) (-912.757) [-910.972] -- 0:00:19 684000 -- [-911.924] (-909.571) (-912.037) (-911.662) * (-910.404) (-910.427) (-915.196) [-909.949] -- 0:00:19 684500 -- (-912.938) (-911.672) (-910.255) [-914.113] * [-911.409] (-914.365) (-914.729) (-909.978) -- 0:00:19 685000 -- [-910.202] (-911.083) (-913.799) (-912.597) * (-909.934) (-910.581) [-911.875] (-910.862) -- 0:00:19 Average standard deviation of split frequencies: 0.008547 685500 -- (-909.963) (-912.306) [-912.651] (-910.309) * (-910.299) [-910.585] (-910.892) (-916.090) -- 0:00:19 686000 -- (-912.061) [-911.746] (-912.259) (-912.898) * (-910.299) (-917.072) (-921.220) [-912.894] -- 0:00:19 686500 -- [-912.600] (-911.175) (-912.641) (-912.238) * [-911.934] (-914.162) (-915.989) (-911.128) -- 0:00:19 687000 -- [-910.100] (-911.911) (-912.342) (-912.617) * [-910.920] (-911.609) (-914.670) (-911.826) -- 0:00:19 687500 -- (-913.708) (-911.915) (-912.165) [-911.166] * (-911.616) [-912.899] (-911.848) (-911.062) -- 0:00:19 688000 -- (-913.551) (-911.822) [-916.026] (-913.643) * [-912.652] (-911.566) (-911.261) (-912.235) -- 0:00:19 688500 -- [-912.309] (-910.457) (-912.149) (-913.258) * (-910.232) (-912.346) [-911.810] (-914.692) -- 0:00:19 689000 -- (-912.474) [-912.499] (-911.837) (-911.413) * (-910.462) [-915.765] (-913.962) (-911.125) -- 0:00:18 689500 -- (-911.982) (-918.512) [-911.796] (-910.839) * [-910.523] (-912.914) (-912.987) (-911.979) -- 0:00:18 690000 -- [-911.577] (-917.971) (-911.783) (-911.713) * (-913.030) [-910.601] (-913.902) (-914.301) -- 0:00:18 Average standard deviation of split frequencies: 0.009034 690500 -- (-913.087) (-913.691) [-911.811] (-910.829) * (-914.018) [-911.149] (-913.472) (-914.064) -- 0:00:18 691000 -- (-910.215) [-912.119] (-912.286) (-910.563) * (-915.481) [-912.035] (-913.215) (-915.041) -- 0:00:18 691500 -- [-911.811] (-912.127) (-912.008) (-910.237) * (-911.562) (-911.201) [-912.896] (-911.314) -- 0:00:18 692000 -- [-913.232] (-916.398) (-911.149) (-918.759) * (-910.297) [-917.440] (-913.046) (-912.863) -- 0:00:18 692500 -- [-911.938] (-912.295) (-910.526) (-911.362) * (-911.787) (-914.184) (-913.484) [-911.399] -- 0:00:18 693000 -- (-912.045) (-910.810) [-911.050] (-914.813) * (-913.029) (-912.820) (-910.031) [-911.087] -- 0:00:18 693500 -- [-911.551] (-911.114) (-910.533) (-911.315) * (-914.675) (-913.454) [-913.205] (-914.202) -- 0:00:18 694000 -- (-911.258) (-910.511) (-913.224) [-913.714] * [-912.314] (-913.713) (-911.193) (-912.612) -- 0:00:18 694500 -- (-911.388) [-910.129] (-910.360) (-912.965) * (-912.378) (-911.757) (-910.427) [-910.758] -- 0:00:18 695000 -- (-911.635) (-911.052) (-913.817) [-910.784] * (-911.017) [-910.395] (-910.391) (-911.337) -- 0:00:18 Average standard deviation of split frequencies: 0.009323 695500 -- (-914.425) (-911.705) (-914.937) [-910.757] * [-912.557] (-910.239) (-911.711) (-912.426) -- 0:00:18 696000 -- [-910.633] (-912.786) (-911.010) (-911.375) * (-914.034) (-911.528) (-911.640) [-914.910] -- 0:00:18 696500 -- (-914.313) [-911.861] (-912.393) (-914.776) * (-912.831) (-910.621) [-912.553] (-910.328) -- 0:00:18 697000 -- [-914.806] (-911.801) (-913.903) (-916.326) * (-911.120) (-910.675) [-912.043] (-911.394) -- 0:00:18 697500 -- (-911.683) (-912.930) (-910.720) [-913.661] * (-913.332) [-910.238] (-910.916) (-912.175) -- 0:00:18 698000 -- [-914.224] (-918.772) (-916.312) (-914.297) * (-916.046) (-914.486) (-909.776) [-912.547] -- 0:00:18 698500 -- (-913.656) [-917.577] (-910.857) (-913.420) * (-919.889) (-911.373) [-910.004] (-914.292) -- 0:00:18 699000 -- (-912.373) [-913.062] (-911.007) (-912.001) * (-915.181) [-912.266] (-912.489) (-913.881) -- 0:00:18 699500 -- [-911.920] (-910.101) (-909.762) (-911.019) * (-916.268) [-910.386] (-912.032) (-910.491) -- 0:00:18 700000 -- (-911.068) (-911.214) (-913.678) [-911.124] * (-913.830) [-910.388] (-913.517) (-911.300) -- 0:00:18 Average standard deviation of split frequencies: 0.009419 700500 -- (-912.151) (-912.572) (-910.843) [-910.730] * (-911.032) (-909.672) (-913.842) [-909.623] -- 0:00:18 701000 -- (-911.715) (-911.312) (-909.883) [-912.994] * (-911.289) (-911.695) [-912.662] (-911.764) -- 0:00:18 701500 -- [-911.893] (-910.941) (-911.006) (-911.733) * [-910.984] (-913.093) (-910.551) (-912.095) -- 0:00:18 702000 -- (-915.068) (-914.915) (-912.844) [-910.421] * (-913.885) [-916.508] (-913.198) (-911.330) -- 0:00:18 702500 -- (-913.725) (-912.391) [-913.421] (-910.592) * (-912.821) (-916.747) (-911.731) [-910.587] -- 0:00:18 703000 -- [-910.768] (-912.358) (-912.572) (-921.077) * (-914.777) (-910.645) (-911.976) [-912.509] -- 0:00:18 703500 -- (-911.351) (-910.004) [-909.700] (-920.879) * (-914.961) (-915.424) (-911.855) [-911.313] -- 0:00:18 704000 -- (-910.811)