--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:30:02 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0281/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -911.20 -914.43
2 -911.28 -916.00
--------------------------------------
TOTAL -911.23 -915.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902984 0.093183 0.377322 1.472407 0.870641 1286.03 1319.25 1.000
r(A<->C){all} 0.170021 0.020927 0.000062 0.465713 0.134141 195.34 211.60 1.002
r(A<->G){all} 0.163324 0.019721 0.000071 0.449213 0.124156 239.43 268.40 1.003
r(A<->T){all} 0.157597 0.017391 0.000083 0.424753 0.121688 258.46 283.24 1.003
r(C<->G){all} 0.176440 0.022759 0.000095 0.492436 0.135039 111.43 144.83 1.000
r(C<->T){all} 0.173828 0.020621 0.000029 0.466342 0.134784 111.46 175.48 1.002
r(G<->T){all} 0.158791 0.018534 0.000020 0.433757 0.125554 147.05 215.97 1.000
pi(A){all} 0.159018 0.000187 0.130953 0.185129 0.158636 915.80 1129.90 1.000
pi(C){all} 0.323201 0.000314 0.287969 0.356461 0.323524 1081.58 1275.35 1.000
pi(G){all} 0.349612 0.000328 0.311799 0.382806 0.349183 1215.05 1291.80 1.001
pi(T){all} 0.168169 0.000205 0.140139 0.195731 0.167742 1251.74 1321.15 1.000
alpha{1,2} 0.438181 0.243597 0.000109 1.481592 0.259960 1188.72 1210.77 1.003
alpha{3} 0.448864 0.227720 0.000256 1.455069 0.293928 1138.68 1282.38 1.000
pinvar{all} 0.997726 0.000007 0.992220 1.000000 0.998601 1088.49 1154.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -888.021535
Model 2: PositiveSelection -888.021533
Model 0: one-ratio -888.021536
Model 7: beta -888.021556
Model 8: beta&w>1 -888.021529
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 5.400000009103678E-5
>C1
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C2
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C3
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C4
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C5
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C6
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=229
C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
**************************************************
C1 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C2 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C3 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C4 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C5 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C6 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
**************************************************
C1 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C2 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C3 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C4 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C5 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C6 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
**************************************************
C1 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C2 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C3 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C4 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C5 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C6 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
**************************************************
C1 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C2 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C3 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C4 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C5 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C6 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
*****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 229 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 229 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6870]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6870]--->[6870]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.488 Mb, Max= 30.778 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C2 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C3 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C4 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C5 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
C6 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
**************************************************
C1 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C2 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C3 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C4 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C5 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
C6 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
**************************************************
C1 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C2 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C3 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C4 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C5 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
C6 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
**************************************************
C1 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C2 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C3 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C4 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C5 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
C6 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
**************************************************
C1 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C2 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C3 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C4 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C5 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
C6 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
*****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
C2 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
C3 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
C4 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
C5 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
C6 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
**************************************************
C1 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
C2 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
C3 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
C4 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
C5 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
C6 CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
**************************************************
C1 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
C2 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
C3 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
C4 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
C5 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
C6 GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
**************************************************
C1 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
C2 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
C3 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
C4 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
C5 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
C6 TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
**************************************************
C1 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
C2 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
C3 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
C4 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
C5 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
C6 GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
**************************************************
C1 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
C2 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
C3 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
C4 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
C5 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
C6 CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
**************************************************
C1 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
C2 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
C3 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
C4 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
C5 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
C6 CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
**************************************************
C1 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
C2 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
C3 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
C4 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
C5 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
C6 CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
**************************************************
C1 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
C2 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
C3 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
C4 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
C5 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
C6 TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
**************************************************
C1 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
C2 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
C3 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
C4 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
C5 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
C6 CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
**************************************************
C1 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
C2 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
C3 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
C4 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
C5 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
C6 GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
**************************************************
C1 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
C2 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
C3 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
C4 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
C5 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
C6 GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
**************************************************
C1 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
C2 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
C3 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
C4 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
C5 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
C6 GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
**************************************************
C1 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
C2 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
C3 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
C4 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
C5 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
C6 GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
*************************************
>C1
TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
>C2
TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
>C3
TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
>C4
TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
>C5
TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
>C6
TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA
CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC
GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG
TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT
GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC
CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC
CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT
CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG
TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG
CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT
GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT
GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC
GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC
GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
>C1
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C2
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C3
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C4
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C5
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
>C6
LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
AVVRDGVPTRRRERRSTFYRNVEGWMLVR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 687 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579796927
Setting output file names to "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 299928934
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0409461546
Seed = 2062896686
Swapseed = 1579796927
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1537.538934 -- -24.965149
Chain 2 -- -1537.538934 -- -24.965149
Chain 3 -- -1537.538934 -- -24.965149
Chain 4 -- -1537.538700 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1537.538934 -- -24.965149
Chain 2 -- -1537.538846 -- -24.965149
Chain 3 -- -1537.538700 -- -24.965149
Chain 4 -- -1537.538846 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1537.539] (-1537.539) (-1537.539) (-1537.539) * [-1537.539] (-1537.539) (-1537.539) (-1537.539)
500 -- (-925.911) (-958.462) (-918.410) [-935.968] * [-942.271] (-934.767) (-937.791) (-942.034) -- 0:00:00
1000 -- [-918.722] (-932.088) (-927.883) (-920.798) * [-928.223] (-924.709) (-942.473) (-916.184) -- 0:00:00
1500 -- (-930.715) (-926.402) [-916.513] (-918.388) * (-916.133) (-926.106) (-936.127) [-921.655] -- 0:00:00
2000 -- (-921.812) (-928.304) (-924.207) [-918.360] * [-920.531] (-924.288) (-918.499) (-916.713) -- 0:00:00
2500 -- (-918.295) [-917.265] (-921.672) (-925.333) * (-924.967) (-919.785) (-919.630) [-916.276] -- 0:00:00
3000 -- (-920.424) (-915.803) (-924.285) [-922.634] * [-921.313] (-918.950) (-920.575) (-922.067) -- 0:00:00
3500 -- (-912.894) (-928.754) (-925.539) [-914.906] * (-918.569) [-920.278] (-916.709) (-920.004) -- 0:00:00
4000 -- (-920.294) (-914.427) (-925.139) [-921.832] * (-923.319) (-919.654) [-916.777] (-922.233) -- 0:00:00
4500 -- (-918.434) (-922.689) [-916.552] (-921.745) * (-918.311) [-920.274] (-918.480) (-922.339) -- 0:00:00
5000 -- (-920.446) (-916.597) [-920.812] (-919.018) * (-924.044) (-922.411) [-921.913] (-924.288) -- 0:00:00
Average standard deviation of split frequencies: 0.091662
5500 -- (-918.858) (-921.761) [-915.882] (-922.467) * (-922.595) (-921.933) [-930.063] (-917.958) -- 0:00:00
6000 -- (-919.751) (-920.952) [-924.037] (-921.619) * [-919.701] (-917.017) (-917.035) (-924.548) -- 0:00:00
6500 -- [-919.436] (-917.091) (-919.369) (-924.101) * [-919.877] (-926.639) (-917.255) (-922.518) -- 0:00:00
7000 -- (-922.438) (-917.120) (-917.629) [-926.528] * (-912.700) (-916.628) (-925.032) [-920.247] -- 0:00:00
7500 -- (-922.252) (-921.799) (-924.406) [-919.993] * (-923.755) (-921.457) (-919.373) [-916.359] -- 0:00:00
8000 -- [-916.687] (-924.243) (-921.831) (-920.736) * [-930.446] (-925.824) (-925.878) (-918.222) -- 0:00:00
8500 -- (-918.218) [-924.772] (-922.967) (-923.005) * (-925.421) (-918.885) (-923.522) [-915.915] -- 0:00:00
9000 -- (-927.881) (-918.947) [-929.824] (-920.858) * (-927.194) (-923.133) [-918.963] (-916.913) -- 0:01:50
9500 -- (-931.498) (-918.926) [-925.188] (-922.174) * (-926.089) (-925.157) (-926.864) [-919.328] -- 0:01:44
10000 -- (-923.730) (-918.946) (-923.021) [-916.154] * (-918.950) (-917.827) (-928.749) [-920.131] -- 0:01:39
Average standard deviation of split frequencies: 0.067344
10500 -- (-925.951) (-918.130) [-914.989] (-916.082) * (-920.135) (-927.799) [-920.793] (-926.571) -- 0:01:34
11000 -- [-927.854] (-923.741) (-923.825) (-924.319) * (-920.739) (-923.536) [-921.243] (-923.150) -- 0:01:29
11500 -- (-919.981) (-922.436) [-916.390] (-917.729) * (-922.802) (-916.165) [-917.666] (-923.941) -- 0:01:25
12000 -- [-924.296] (-923.625) (-913.248) (-923.436) * [-916.590] (-918.065) (-941.776) (-916.431) -- 0:01:22
12500 -- (-924.673) [-918.042] (-910.986) (-921.891) * (-923.312) (-920.463) (-923.069) [-918.927] -- 0:01:19
13000 -- (-914.955) (-919.776) (-911.584) [-924.145] * [-915.713] (-928.002) (-923.152) (-921.936) -- 0:01:15
13500 -- (-919.676) (-920.771) [-914.793] (-918.752) * (-919.555) (-917.134) (-920.323) [-923.155] -- 0:01:13
14000 -- (-918.994) [-917.427] (-911.839) (-930.315) * [-919.161] (-920.565) (-923.439) (-918.637) -- 0:01:10
14500 -- (-921.873) (-919.953) (-913.989) [-923.680] * [-918.574] (-922.795) (-921.072) (-916.752) -- 0:01:07
15000 -- (-924.962) [-919.391] (-912.815) (-922.807) * (-927.563) [-924.419] (-916.450) (-923.617) -- 0:01:05
Average standard deviation of split frequencies: 0.044970
15500 -- (-919.017) (-918.248) (-912.474) [-921.319] * (-921.023) (-918.111) (-918.897) [-923.268] -- 0:01:03
16000 -- (-918.526) (-923.715) [-910.537] (-925.747) * (-921.437) (-919.587) [-920.034] (-924.820) -- 0:01:01
16500 -- (-922.168) (-924.358) [-909.854] (-924.838) * [-925.379] (-924.772) (-927.785) (-924.565) -- 0:00:59
17000 -- (-922.819) (-915.115) (-912.288) [-919.066] * (-912.715) (-920.106) [-916.935] (-923.092) -- 0:00:57
17500 -- (-920.701) (-922.504) [-911.067] (-922.490) * (-911.217) (-923.314) [-920.144] (-918.734) -- 0:00:56
18000 -- (-922.954) [-918.094] (-912.000) (-921.609) * (-911.228) (-919.853) (-920.453) [-919.009] -- 0:00:54
18500 -- (-923.244) (-919.158) [-911.603] (-918.932) * (-910.899) [-916.783] (-920.497) (-918.575) -- 0:00:53
19000 -- [-918.223] (-924.110) (-912.502) (-916.843) * (-912.471) (-920.013) (-933.177) [-927.792] -- 0:00:51
19500 -- (-929.962) (-930.185) [-911.736] (-918.948) * (-911.652) (-916.939) (-920.947) [-916.844] -- 0:00:50
20000 -- (-924.275) [-923.603] (-910.330) (-916.397) * (-912.403) [-924.071] (-923.437) (-922.105) -- 0:00:49
Average standard deviation of split frequencies: 0.056264
20500 -- [-920.276] (-930.687) (-910.610) (-915.188) * (-910.656) [-925.426] (-924.526) (-917.854) -- 0:00:47
21000 -- (-921.249) (-926.391) [-910.275] (-914.501) * (-910.489) (-913.563) [-916.643] (-921.452) -- 0:00:46
21500 -- [-921.111] (-920.514) (-911.982) (-915.011) * (-910.907) (-913.716) [-920.985] (-921.850) -- 0:00:45
22000 -- [-921.748] (-922.641) (-910.736) (-911.665) * (-910.441) [-911.261] (-920.850) (-918.772) -- 0:00:44
22500 -- (-917.149) [-918.762] (-913.896) (-912.289) * (-912.415) [-913.670] (-924.064) (-924.390) -- 0:00:43
23000 -- (-926.731) [-919.815] (-916.530) (-910.967) * (-911.378) [-913.824] (-925.995) (-920.883) -- 0:00:42
23500 -- (-925.918) (-916.429) (-915.189) [-910.762] * (-912.988) (-915.123) [-924.725] (-932.716) -- 0:00:41
24000 -- (-918.398) [-918.524] (-914.447) (-911.331) * (-914.904) [-912.831] (-922.055) (-921.445) -- 0:00:40
24500 -- (-922.446) (-921.311) (-911.969) [-910.546] * [-915.919] (-912.752) (-922.025) (-919.194) -- 0:00:39
25000 -- (-921.335) (-925.764) [-913.198] (-910.882) * (-911.635) (-910.180) [-918.947] (-921.451) -- 0:01:18
Average standard deviation of split frequencies: 0.040039
25500 -- (-932.308) [-916.930] (-911.405) (-913.755) * (-911.274) [-910.538] (-918.978) (-919.425) -- 0:01:16
26000 -- (-923.997) [-921.685] (-910.336) (-912.683) * (-911.575) (-915.854) (-929.032) [-915.880] -- 0:01:14
26500 -- (-927.437) [-918.964] (-913.462) (-914.302) * (-911.127) (-912.390) [-919.111] (-921.743) -- 0:01:13
27000 -- (-918.118) [-915.896] (-912.162) (-916.303) * [-912.814] (-912.723) (-918.353) (-927.374) -- 0:01:12
27500 -- (-916.400) [-917.391] (-911.308) (-918.259) * (-914.916) (-912.782) (-920.920) [-919.097] -- 0:01:10
28000 -- (-930.756) [-918.403] (-911.963) (-914.137) * [-912.712] (-914.569) (-925.034) (-920.695) -- 0:01:09
28500 -- [-919.740] (-917.871) (-913.684) (-913.155) * (-911.133) (-914.191) (-921.096) [-920.723] -- 0:01:08
29000 -- [-919.666] (-927.342) (-912.273) (-915.755) * [-910.842] (-915.216) (-918.321) (-919.880) -- 0:01:06
29500 -- (-928.288) (-926.878) (-914.044) [-913.426] * (-913.028) (-913.312) [-920.442] (-920.044) -- 0:01:05
30000 -- (-922.607) (-925.301) [-911.997] (-911.622) * (-911.654) [-912.830] (-920.863) (-920.144) -- 0:01:04
Average standard deviation of split frequencies: 0.040992
30500 -- (-920.967) [-921.711] (-910.158) (-916.543) * (-913.863) (-911.353) [-917.323] (-922.479) -- 0:01:03
31000 -- (-928.396) [-915.973] (-911.435) (-915.851) * (-914.766) [-910.834] (-921.350) (-921.761) -- 0:01:02
31500 -- (-919.385) (-921.250) [-911.498] (-911.604) * [-912.672] (-911.428) (-913.279) (-919.405) -- 0:01:01
32000 -- (-921.921) (-922.977) (-918.622) [-909.966] * (-913.293) (-916.304) [-915.008] (-916.419) -- 0:01:00
32500 -- (-919.658) [-918.391] (-912.247) (-922.925) * (-914.760) (-913.785) (-911.014) [-919.953] -- 0:00:59
33000 -- (-920.060) (-921.055) (-912.276) [-914.575] * (-912.127) (-910.207) (-911.812) [-914.867] -- 0:00:58
33500 -- [-916.533] (-925.140) (-912.167) (-913.181) * (-912.719) (-911.082) (-910.544) [-914.996] -- 0:00:57
34000 -- (-928.262) [-921.846] (-912.099) (-910.009) * (-911.923) (-912.778) (-911.469) [-925.256] -- 0:00:56
34500 -- [-917.414] (-921.623) (-914.915) (-910.166) * (-910.278) [-913.629] (-910.702) (-919.767) -- 0:00:55
35000 -- (-941.509) (-932.660) (-914.276) [-911.369] * (-912.213) (-911.038) [-912.248] (-927.469) -- 0:00:55
Average standard deviation of split frequencies: 0.041351
35500 -- (-922.888) [-920.232] (-914.859) (-917.042) * [-911.180] (-909.973) (-912.941) (-917.602) -- 0:00:54
36000 -- (-914.767) (-920.588) [-915.435] (-913.391) * (-911.536) [-911.091] (-915.197) (-928.074) -- 0:00:53
36500 -- (-910.984) [-918.551] (-912.291) (-912.972) * (-911.039) (-912.577) (-912.592) [-916.154] -- 0:00:52
37000 -- (-913.091) [-917.376] (-913.215) (-918.186) * [-910.617] (-912.103) (-910.785) (-925.631) -- 0:00:52
37500 -- (-911.953) (-932.922) [-911.048] (-915.906) * [-911.158] (-909.998) (-910.814) (-922.735) -- 0:00:51
38000 -- (-911.880) (-929.277) (-913.154) [-911.648] * [-912.782] (-910.999) (-911.973) (-924.234) -- 0:00:50
38500 -- (-910.914) (-921.783) [-910.083] (-915.087) * (-913.373) (-911.480) (-910.208) [-922.122] -- 0:00:49
39000 -- (-912.013) [-920.759] (-910.584) (-910.798) * (-912.672) (-912.193) [-911.894] (-924.261) -- 0:00:49
39500 -- [-910.300] (-925.561) (-914.726) (-911.118) * (-911.736) [-910.534] (-910.961) (-925.961) -- 0:00:48
40000 -- [-910.583] (-923.378) (-920.970) (-910.963) * (-915.862) [-910.829] (-913.379) (-930.168) -- 0:00:48
Average standard deviation of split frequencies: 0.034132
40500 -- (-912.139) (-920.721) (-916.837) [-911.465] * (-912.123) (-911.088) [-911.710] (-927.358) -- 0:00:47
41000 -- (-914.058) [-925.779] (-910.017) (-911.522) * (-913.655) (-911.325) (-911.158) [-922.072] -- 0:01:10
41500 -- (-912.434) (-916.885) (-911.523) [-914.217] * (-910.897) (-912.830) [-912.613] (-927.814) -- 0:01:09
42000 -- (-912.620) (-925.561) [-910.939] (-915.750) * (-913.048) (-915.928) (-912.527) [-911.797] -- 0:01:08
42500 -- [-914.161] (-922.932) (-911.125) (-914.534) * [-913.807] (-912.983) (-912.253) (-912.398) -- 0:01:07
43000 -- [-911.390] (-922.766) (-914.776) (-914.463) * (-910.773) (-913.270) [-910.393] (-913.922) -- 0:01:06
43500 -- (-911.808) [-916.166] (-911.301) (-911.213) * [-910.936] (-912.305) (-911.590) (-915.155) -- 0:01:05
44000 -- [-910.157] (-924.132) (-910.526) (-910.724) * (-917.160) [-911.541] (-911.561) (-917.403) -- 0:01:05
44500 -- (-910.977) [-923.298] (-910.116) (-910.293) * (-913.796) [-912.112] (-910.995) (-918.230) -- 0:01:04
45000 -- [-911.592] (-920.068) (-914.761) (-914.982) * [-911.873] (-913.372) (-910.687) (-915.962) -- 0:01:03
Average standard deviation of split frequencies: 0.031720
45500 -- [-911.479] (-919.418) (-911.078) (-910.621) * (-914.065) (-913.446) [-910.155] (-913.583) -- 0:01:02
46000 -- (-911.344) (-918.056) [-910.672] (-911.355) * (-911.919) (-910.777) [-910.833] (-911.173) -- 0:01:02
46500 -- [-913.926] (-919.790) (-911.350) (-911.854) * [-912.073] (-913.291) (-911.372) (-912.110) -- 0:01:01
47000 -- (-912.808) (-915.252) (-911.491) [-913.456] * (-912.750) (-911.028) [-910.226] (-911.462) -- 0:01:00
47500 -- (-910.347) (-910.123) (-911.104) [-912.337] * (-913.771) (-914.286) [-910.195] (-913.991) -- 0:01:00
48000 -- [-911.685] (-912.529) (-914.807) (-910.621) * (-910.246) (-910.855) (-910.522) [-911.175] -- 0:00:59
48500 -- [-912.291] (-910.652) (-912.049) (-911.470) * (-910.691) (-912.545) [-911.458] (-912.209) -- 0:00:58
49000 -- [-911.908] (-910.021) (-910.244) (-911.538) * [-911.253] (-910.429) (-911.196) (-913.743) -- 0:00:58
49500 -- [-913.854] (-911.647) (-910.833) (-914.613) * (-910.558) [-912.323] (-911.310) (-912.392) -- 0:00:57
50000 -- (-910.672) (-911.543) [-910.458] (-911.129) * [-910.092] (-910.674) (-914.159) (-918.147) -- 0:00:57
Average standard deviation of split frequencies: 0.032809
50500 -- (-911.407) (-910.968) (-910.556) [-910.421] * (-912.356) (-916.932) (-909.646) [-911.675] -- 0:00:56
51000 -- (-910.769) (-911.295) (-911.205) [-910.089] * (-912.356) [-917.726] (-913.448) (-910.703) -- 0:00:55
51500 -- (-914.623) [-914.271] (-910.809) (-910.951) * (-909.663) [-914.481] (-912.725) (-910.681) -- 0:00:55
52000 -- [-912.842] (-911.569) (-910.638) (-910.587) * [-910.526] (-915.991) (-912.793) (-913.420) -- 0:00:54
52500 -- (-912.212) (-910.185) (-910.092) [-911.273] * (-910.056) (-911.994) (-914.310) [-914.127] -- 0:00:54
53000 -- (-911.433) [-911.192] (-914.830) (-911.856) * (-909.779) (-911.988) [-911.510] (-914.552) -- 0:00:53
53500 -- [-912.276] (-911.063) (-912.645) (-911.454) * (-910.648) [-910.745] (-914.663) (-914.061) -- 0:00:53
54000 -- (-914.812) (-910.064) [-912.054] (-912.161) * (-909.951) [-912.080] (-913.575) (-910.921) -- 0:00:52
54500 -- (-915.324) [-910.097] (-914.457) (-911.797) * (-909.951) (-913.535) [-912.372] (-910.864) -- 0:00:52
55000 -- (-910.929) (-910.015) (-914.914) [-911.649] * (-912.328) (-911.722) (-910.704) [-910.452] -- 0:00:51
Average standard deviation of split frequencies: 0.030570
55500 -- [-910.771] (-914.819) (-911.336) (-912.528) * (-911.307) [-910.440] (-912.319) (-912.514) -- 0:00:51
56000 -- [-909.664] (-913.850) (-914.536) (-911.318) * (-912.164) [-912.605] (-912.470) (-912.289) -- 0:00:50
56500 -- (-917.301) (-914.396) [-911.356] (-911.395) * (-910.607) [-911.399] (-912.821) (-911.506) -- 0:00:50
57000 -- [-911.021] (-913.840) (-910.778) (-911.629) * (-910.607) [-910.114] (-912.232) (-913.728) -- 0:00:49
57500 -- (-913.475) (-913.661) [-915.983] (-916.041) * (-913.547) (-910.429) (-910.952) [-915.285] -- 0:00:49
58000 -- [-910.539] (-913.526) (-918.083) (-914.164) * [-922.327] (-910.872) (-911.099) (-911.509) -- 0:01:04
58500 -- [-910.597] (-911.858) (-912.821) (-910.533) * (-914.546) (-912.071) (-910.602) [-911.438] -- 0:01:04
59000 -- (-915.453) [-911.708] (-911.976) (-911.587) * [-912.383] (-911.870) (-912.039) (-912.753) -- 0:01:03
59500 -- (-917.112) (-911.501) [-910.054] (-911.838) * (-914.557) [-911.825] (-911.135) (-912.763) -- 0:01:03
60000 -- (-915.894) [-910.701] (-911.030) (-913.968) * (-910.715) (-913.329) [-912.133] (-912.521) -- 0:01:02
Average standard deviation of split frequencies: 0.033024
60500 -- (-911.196) (-910.924) [-911.603] (-914.957) * (-910.857) (-912.867) [-913.289] (-918.996) -- 0:01:02
61000 -- (-911.468) (-909.979) (-913.350) [-918.375] * (-911.311) (-910.956) [-912.433] (-911.003) -- 0:01:01
61500 -- (-915.642) (-910.506) [-912.520] (-916.619) * [-912.885] (-910.140) (-914.487) (-912.506) -- 0:01:01
62000 -- (-911.222) (-913.188) [-913.243] (-915.456) * (-914.139) (-912.763) (-912.141) [-914.182] -- 0:01:00
62500 -- (-912.418) [-911.828] (-911.318) (-914.331) * (-911.626) (-914.389) (-912.223) [-911.559] -- 0:01:00
63000 -- (-912.281) (-914.021) (-912.929) [-911.256] * (-912.678) (-910.766) [-911.775] (-914.156) -- 0:00:59
63500 -- (-910.966) (-912.829) (-911.883) [-912.787] * (-914.194) (-911.947) [-912.044] (-914.237) -- 0:00:58
64000 -- [-911.794] (-910.266) (-910.123) (-913.080) * (-914.867) (-911.140) [-912.897] (-914.690) -- 0:00:58
64500 -- (-910.218) (-909.913) [-909.547] (-913.333) * (-913.674) (-911.057) (-911.476) [-915.331] -- 0:00:58
65000 -- (-911.022) (-912.132) (-910.677) [-914.265] * (-912.550) (-913.972) [-913.443] (-911.091) -- 0:00:57
Average standard deviation of split frequencies: 0.026784
65500 -- (-914.448) [-911.466] (-911.672) (-912.329) * (-911.652) [-910.710] (-913.746) (-913.261) -- 0:00:57
66000 -- (-917.622) (-913.976) [-910.775] (-911.058) * [-910.262] (-911.333) (-913.503) (-912.275) -- 0:00:56
66500 -- [-913.434] (-915.826) (-910.775) (-913.136) * [-911.150] (-912.405) (-912.317) (-912.455) -- 0:00:56
67000 -- (-913.476) (-911.407) [-910.996] (-913.511) * [-910.761] (-914.751) (-911.281) (-912.942) -- 0:00:55
67500 -- (-910.818) (-915.011) (-911.696) [-914.849] * (-910.795) (-913.548) [-910.985] (-913.588) -- 0:00:55
68000 -- (-913.109) [-910.961] (-910.966) (-912.733) * [-912.806] (-918.150) (-911.108) (-913.510) -- 0:00:54
68500 -- (-912.636) (-912.093) [-913.590] (-914.445) * [-911.920] (-915.163) (-911.222) (-910.933) -- 0:00:54
69000 -- (-911.846) (-911.243) [-912.522] (-911.146) * (-911.047) (-910.679) (-910.769) [-911.959] -- 0:00:53
69500 -- [-910.218] (-912.249) (-911.594) (-912.071) * (-912.944) (-910.432) [-910.164] (-913.208) -- 0:00:53
70000 -- (-909.887) [-911.384] (-913.946) (-913.587) * (-911.175) (-910.634) [-911.476] (-913.550) -- 0:00:53
Average standard deviation of split frequencies: 0.026350
70500 -- (-910.933) [-912.317] (-909.977) (-915.920) * (-911.751) [-914.137] (-910.225) (-918.596) -- 0:00:52
71000 -- [-910.766] (-913.800) (-910.415) (-911.403) * [-911.067] (-913.960) (-914.902) (-915.376) -- 0:00:52
71500 -- (-910.654) [-913.030] (-910.643) (-912.176) * [-911.860] (-911.698) (-911.022) (-911.850) -- 0:00:51
72000 -- (-910.440) (-912.874) (-913.206) [-910.365] * [-912.539] (-914.463) (-915.941) (-910.507) -- 0:00:51
72500 -- (-911.715) (-911.259) (-911.489) [-911.071] * (-913.495) (-911.078) [-910.519] (-911.333) -- 0:00:51
73000 -- (-911.346) (-912.956) (-910.442) [-913.674] * [-911.862] (-911.498) (-911.144) (-910.408) -- 0:00:50
73500 -- (-911.059) [-909.700] (-913.243) (-913.593) * (-912.162) (-911.691) (-910.743) [-910.498] -- 0:00:50
74000 -- (-911.753) [-911.388] (-910.821) (-914.875) * [-911.820] (-910.780) (-912.864) (-913.648) -- 0:00:50
74500 -- (-909.866) (-911.055) [-910.520] (-911.623) * (-912.766) (-912.040) [-910.664] (-912.910) -- 0:01:02
75000 -- (-910.590) (-911.224) [-910.343] (-912.927) * (-914.327) (-912.028) [-911.928] (-914.300) -- 0:01:01
Average standard deviation of split frequencies: 0.026051
75500 -- [-909.767] (-910.977) (-910.077) (-912.721) * (-916.054) (-909.914) (-913.604) [-910.597] -- 0:01:01
76000 -- (-913.426) (-910.255) [-909.865] (-912.769) * (-912.610) (-910.171) [-915.167] (-911.886) -- 0:01:00
76500 -- [-910.751] (-914.203) (-911.141) (-911.743) * [-912.240] (-910.164) (-912.712) (-911.496) -- 0:01:00
77000 -- (-912.623) (-910.980) (-912.346) [-912.671] * (-911.728) (-911.298) [-910.825] (-913.295) -- 0:00:59
77500 -- (-911.219) (-911.447) (-913.428) [-911.775] * (-913.314) (-915.512) (-911.091) [-913.004] -- 0:00:59
78000 -- (-910.259) (-910.213) (-910.785) [-912.154] * (-914.364) (-910.541) [-910.080] (-913.336) -- 0:00:59
78500 -- (-912.266) [-911.281] (-911.502) (-910.124) * (-911.434) [-910.671] (-913.397) (-912.114) -- 0:00:58
79000 -- (-914.113) (-910.899) (-915.395) [-909.937] * (-912.683) [-913.144] (-911.230) (-910.510) -- 0:00:58
79500 -- [-910.015] (-915.500) (-910.516) (-912.830) * (-912.311) (-910.834) (-914.401) [-910.456] -- 0:00:57
80000 -- [-909.731] (-915.042) (-914.255) (-914.833) * [-913.168] (-912.394) (-913.077) (-911.325) -- 0:00:57
Average standard deviation of split frequencies: 0.020746
80500 -- (-910.105) (-918.141) (-913.972) [-915.129] * [-911.898] (-912.524) (-910.425) (-914.930) -- 0:00:57
81000 -- (-911.541) (-913.646) [-912.473] (-913.384) * (-910.630) [-911.756] (-911.106) (-910.514) -- 0:00:56
81500 -- [-911.769] (-910.422) (-913.816) (-914.593) * (-915.790) (-915.748) (-913.668) [-910.755] -- 0:00:56
82000 -- [-909.878] (-909.943) (-911.138) (-911.588) * (-914.452) [-914.464] (-916.104) (-910.361) -- 0:00:55
82500 -- (-910.004) (-914.278) [-913.351] (-911.058) * [-915.325] (-914.614) (-910.501) (-910.547) -- 0:00:55
83000 -- (-912.273) [-911.707] (-910.285) (-913.707) * (-913.108) (-911.892) [-910.003] (-911.630) -- 0:00:55
83500 -- (-911.457) [-909.718] (-910.680) (-911.794) * (-911.434) (-911.968) [-909.781] (-915.529) -- 0:00:54
84000 -- (-911.442) (-911.760) [-910.616] (-912.236) * [-911.909] (-911.864) (-912.577) (-911.852) -- 0:00:54
84500 -- [-911.448] (-912.549) (-913.683) (-916.262) * (-910.804) (-911.277) (-912.403) [-918.418] -- 0:00:54
85000 -- (-913.320) (-913.390) [-915.247] (-913.570) * [-912.109] (-911.978) (-911.793) (-912.875) -- 0:00:53
Average standard deviation of split frequencies: 0.022748
85500 -- (-916.450) (-917.855) (-913.099) [-912.700] * [-912.167] (-912.931) (-912.330) (-911.265) -- 0:00:53
86000 -- [-912.276] (-913.586) (-914.585) (-912.544) * (-909.949) (-916.209) (-913.155) [-911.508] -- 0:00:53
86500 -- [-911.483] (-913.769) (-912.580) (-910.711) * (-910.543) (-917.252) [-912.325] (-916.393) -- 0:00:52
87000 -- [-909.944] (-911.980) (-910.794) (-915.128) * (-910.738) [-909.981] (-913.124) (-920.099) -- 0:00:52
87500 -- (-911.328) (-912.414) (-911.029) [-917.439] * (-910.389) [-910.250] (-913.892) (-915.162) -- 0:00:52
88000 -- (-911.405) (-911.614) (-910.410) [-912.536] * [-910.677] (-911.619) (-912.314) (-916.014) -- 0:00:51
88500 -- (-911.327) (-910.665) (-912.186) [-912.691] * [-909.764] (-910.675) (-913.428) (-910.665) -- 0:00:51
89000 -- [-909.678] (-911.684) (-910.708) (-911.104) * (-909.766) [-910.747] (-912.840) (-914.329) -- 0:00:51
89500 -- (-911.835) [-910.389] (-911.033) (-910.927) * (-912.628) (-910.150) (-915.014) [-913.000] -- 0:00:50
90000 -- (-911.689) (-910.176) [-912.094] (-910.368) * (-912.461) [-909.966] (-917.095) (-909.568) -- 0:00:50
Average standard deviation of split frequencies: 0.022713
90500 -- (-914.529) (-910.355) [-912.818] (-912.201) * (-914.859) (-914.011) (-912.106) [-910.220] -- 0:01:00
91000 -- [-911.474] (-912.492) (-911.680) (-916.116) * (-911.548) (-914.730) (-910.408) [-911.775] -- 0:00:59
91500 -- (-911.493) (-912.161) [-910.356] (-911.102) * (-913.732) [-911.141] (-915.473) (-912.290) -- 0:00:59
92000 -- (-910.202) (-910.629) (-914.512) [-911.666] * (-915.097) [-911.507] (-910.885) (-917.860) -- 0:00:59
92500 -- [-910.851] (-910.469) (-911.252) (-914.755) * (-914.466) (-912.685) [-912.173] (-914.433) -- 0:00:58
93000 -- (-910.841) (-911.054) (-911.054) [-913.259] * (-909.952) [-916.447] (-911.748) (-914.872) -- 0:00:58
93500 -- [-910.257] (-910.441) (-912.118) (-911.542) * (-912.737) (-915.679) [-915.067] (-914.497) -- 0:00:58
94000 -- (-914.175) [-913.184] (-914.133) (-911.233) * (-918.518) (-913.660) [-911.947] (-911.643) -- 0:00:57
94500 -- [-915.846] (-910.587) (-913.479) (-910.166) * [-913.061] (-912.921) (-911.567) (-914.438) -- 0:00:57
95000 -- [-916.261] (-913.900) (-915.515) (-913.009) * [-911.331] (-911.075) (-911.005) (-916.905) -- 0:00:57
Average standard deviation of split frequencies: 0.024841
95500 -- (-910.744) (-912.786) [-910.309] (-911.296) * (-911.250) [-911.267] (-910.922) (-918.262) -- 0:00:56
96000 -- (-912.234) (-910.617) (-920.144) [-910.987] * (-912.069) [-911.742] (-913.383) (-915.433) -- 0:00:56
96500 -- [-910.341] (-911.906) (-923.510) (-913.923) * (-911.956) [-910.219] (-915.054) (-911.924) -- 0:00:56
97000 -- (-911.636) (-912.144) (-914.864) [-912.665] * [-910.288] (-911.638) (-913.122) (-911.130) -- 0:00:55
97500 -- (-913.530) (-912.066) [-912.440] (-919.981) * [-912.328] (-912.838) (-911.298) (-911.075) -- 0:00:55
98000 -- (-911.370) [-911.742] (-915.634) (-916.244) * [-915.982] (-910.122) (-916.720) (-913.077) -- 0:00:55
98500 -- (-915.563) (-910.218) [-911.696] (-918.352) * [-912.965] (-913.014) (-912.790) (-913.620) -- 0:00:54
99000 -- (-914.920) [-910.430] (-913.313) (-910.243) * (-911.168) (-910.439) [-912.660] (-913.087) -- 0:00:54
99500 -- (-913.475) (-913.251) [-911.750] (-911.924) * (-911.306) [-909.916] (-911.465) (-910.914) -- 0:00:54
100000 -- (-910.075) (-910.945) [-911.262] (-913.086) * (-911.362) (-913.189) (-913.597) [-910.786] -- 0:00:54
Average standard deviation of split frequencies: 0.023414
100500 -- (-910.455) [-911.262] (-912.764) (-910.651) * [-911.737] (-910.395) (-911.829) (-910.371) -- 0:00:53
101000 -- (-910.748) (-914.096) [-910.981] (-910.230) * (-912.754) (-914.151) (-912.304) [-911.724] -- 0:00:53
101500 -- (-911.295) [-912.827] (-910.594) (-909.971) * (-911.711) (-915.143) [-913.171] (-913.199) -- 0:00:53
102000 -- (-912.175) (-909.884) [-911.198] (-911.348) * [-913.414] (-913.949) (-912.737) (-912.208) -- 0:00:52
102500 -- (-910.482) (-911.037) [-912.403] (-910.468) * (-910.475) (-911.056) (-912.573) [-910.899] -- 0:00:52
103000 -- [-910.425] (-910.969) (-910.417) (-914.585) * (-911.819) [-911.440] (-913.998) (-912.202) -- 0:00:52
103500 -- (-912.768) (-911.262) [-915.207] (-912.938) * (-909.800) [-910.903] (-915.124) (-913.405) -- 0:00:51
104000 -- (-913.902) [-911.358] (-911.447) (-912.115) * [-914.239] (-911.502) (-913.498) (-913.563) -- 0:00:51
104500 -- (-911.091) [-911.070] (-910.839) (-912.818) * (-911.558) (-912.350) [-915.501] (-911.182) -- 0:00:51
105000 -- (-913.741) (-910.263) (-911.136) [-911.690] * [-910.513] (-911.456) (-912.168) (-915.900) -- 0:00:51
Average standard deviation of split frequencies: 0.023793
105500 -- (-910.483) (-910.770) [-911.830] (-910.619) * (-910.764) (-909.808) [-910.177] (-913.169) -- 0:00:50
106000 -- (-912.119) [-910.052] (-915.488) (-910.500) * (-912.769) (-910.608) [-910.040] (-912.954) -- 0:00:50
106500 -- [-910.339] (-917.464) (-910.452) (-910.455) * (-911.922) (-910.083) (-910.643) [-914.145] -- 0:00:50
107000 -- (-913.395) [-909.876] (-914.259) (-911.990) * (-913.962) (-913.304) [-911.628] (-914.379) -- 0:00:58
107500 -- (-911.498) (-910.656) [-914.861] (-914.559) * (-913.892) (-911.436) [-914.926] (-914.677) -- 0:00:58
108000 -- (-910.460) (-910.528) [-918.978] (-910.916) * (-921.250) (-913.791) (-910.730) [-911.885] -- 0:00:57
108500 -- [-910.442] (-909.945) (-911.702) (-911.201) * (-915.421) (-911.772) [-909.586] (-912.192) -- 0:00:57
109000 -- (-916.075) [-911.202] (-912.573) (-910.747) * [-912.184] (-912.035) (-911.930) (-911.041) -- 0:00:57
109500 -- (-912.370) (-912.823) [-911.565] (-913.635) * [-910.493] (-913.046) (-912.066) (-913.548) -- 0:00:56
110000 -- (-916.022) (-912.979) [-911.555] (-911.328) * (-910.717) (-912.322) (-911.429) [-910.912] -- 0:00:56
Average standard deviation of split frequencies: 0.024138
110500 -- (-912.000) (-912.801) (-916.294) [-912.757] * (-910.432) [-912.078] (-918.167) (-912.375) -- 0:00:56
111000 -- (-914.410) (-910.545) (-912.318) [-911.960] * (-910.443) (-915.373) [-912.913] (-911.869) -- 0:00:56
111500 -- (-910.823) [-910.551] (-914.883) (-912.357) * (-909.991) [-913.936] (-912.442) (-914.538) -- 0:00:55
112000 -- [-912.856] (-909.810) (-915.020) (-912.236) * (-910.413) (-911.150) [-914.708] (-913.426) -- 0:00:55
112500 -- (-911.708) [-909.847] (-918.082) (-910.617) * [-914.900] (-915.663) (-913.043) (-912.789) -- 0:00:55
113000 -- [-912.216] (-912.679) (-915.600) (-910.961) * (-912.984) (-913.164) [-911.902] (-912.424) -- 0:00:54
113500 -- (-912.984) (-911.379) (-915.216) [-911.217] * (-910.442) [-912.380] (-914.795) (-910.248) -- 0:00:54
114000 -- (-914.556) (-911.926) (-911.470) [-910.986] * (-911.118) (-910.636) [-915.309] (-912.234) -- 0:00:54
114500 -- (-913.321) (-918.229) (-912.870) [-915.459] * (-911.419) [-916.066] (-912.951) (-912.284) -- 0:00:54
115000 -- (-910.529) (-912.475) [-911.191] (-915.044) * (-911.684) (-911.360) (-914.547) [-912.940] -- 0:00:53
Average standard deviation of split frequencies: 0.024383
115500 -- (-910.837) [-910.893] (-914.032) (-919.377) * (-914.445) (-914.418) [-913.411] (-915.765) -- 0:00:53
116000 -- (-910.085) (-910.124) (-912.720) [-912.937] * (-909.610) [-910.046] (-913.592) (-910.446) -- 0:00:53
116500 -- [-913.326] (-911.752) (-911.759) (-911.354) * [-914.517] (-911.656) (-915.030) (-909.964) -- 0:00:53
117000 -- (-911.730) (-911.301) [-915.277] (-911.129) * (-915.663) (-911.316) (-914.609) [-912.355] -- 0:00:52
117500 -- [-913.847] (-913.100) (-913.779) (-914.183) * (-910.166) (-911.164) [-913.500] (-910.933) -- 0:00:52
118000 -- [-916.531] (-914.428) (-911.029) (-911.180) * (-909.684) [-910.748] (-910.532) (-910.914) -- 0:00:52
118500 -- (-917.390) (-916.723) [-910.345] (-911.816) * [-911.538] (-911.577) (-912.760) (-913.960) -- 0:00:52
119000 -- (-913.804) (-912.834) (-910.302) [-913.678] * (-912.079) (-911.434) (-913.512) [-911.504] -- 0:00:51
119500 -- [-913.438] (-911.905) (-914.748) (-912.328) * (-913.835) (-910.674) (-910.147) [-911.442] -- 0:00:51
120000 -- (-912.635) (-911.349) (-912.353) [-912.325] * (-909.801) [-910.806] (-910.509) (-914.331) -- 0:00:51
Average standard deviation of split frequencies: 0.024674
120500 -- (-914.204) (-912.672) [-915.147] (-911.695) * (-909.930) (-913.185) (-914.757) [-914.718] -- 0:00:51
121000 -- (-914.131) [-910.055] (-912.646) (-912.909) * [-912.962] (-912.263) (-914.485) (-912.362) -- 0:00:50
121500 -- [-914.250] (-909.972) (-912.321) (-913.049) * [-910.687] (-911.471) (-914.411) (-915.956) -- 0:00:50
122000 -- (-914.888) (-910.386) (-914.001) [-910.749] * (-914.096) (-910.615) (-916.035) [-919.753] -- 0:00:50
122500 -- (-911.697) [-913.965] (-913.241) (-910.416) * (-913.225) (-912.148) [-912.075] (-914.037) -- 0:00:50
123000 -- [-912.896] (-909.875) (-914.216) (-909.977) * (-910.126) (-910.581) [-911.116] (-914.093) -- 0:00:57
123500 -- (-913.946) (-910.699) (-912.736) [-910.375] * (-912.821) [-913.501] (-911.827) (-912.484) -- 0:00:56
124000 -- [-911.319] (-912.680) (-913.361) (-912.268) * (-914.513) (-913.657) (-912.288) [-911.551] -- 0:00:56
124500 -- (-911.672) (-910.963) (-919.248) [-911.783] * (-911.907) (-911.510) [-910.841] (-911.399) -- 0:00:56
125000 -- (-912.143) (-910.153) (-914.680) [-912.715] * (-914.672) [-911.559] (-913.043) (-913.753) -- 0:00:56
Average standard deviation of split frequencies: 0.024417
125500 -- [-911.425] (-912.290) (-916.497) (-911.849) * (-912.403) [-912.198] (-912.159) (-912.584) -- 0:00:55
126000 -- (-910.734) (-911.990) (-911.148) [-911.562] * (-911.508) (-915.526) (-910.473) [-910.611] -- 0:00:55
126500 -- (-909.798) [-911.719] (-910.348) (-918.998) * (-912.640) [-911.109] (-910.100) (-911.223) -- 0:00:55
127000 -- [-911.630] (-912.682) (-910.006) (-912.433) * (-912.187) (-910.871) (-911.690) [-911.704] -- 0:00:54
127500 -- [-910.822] (-912.416) (-911.720) (-913.533) * (-910.550) (-913.877) (-913.147) [-910.344] -- 0:00:54
128000 -- [-910.049] (-916.006) (-909.770) (-912.353) * (-910.766) [-912.917] (-912.403) (-911.078) -- 0:00:54
128500 -- [-910.455] (-916.006) (-911.595) (-911.204) * (-911.188) (-912.076) [-913.385] (-910.319) -- 0:00:54
129000 -- (-909.871) (-910.884) (-914.154) [-912.769] * [-915.778] (-911.176) (-920.116) (-910.387) -- 0:00:54
129500 -- (-909.959) (-912.967) (-913.600) [-911.894] * [-910.342] (-911.940) (-913.996) (-910.294) -- 0:00:53
130000 -- [-910.932] (-914.925) (-913.690) (-911.240) * (-910.840) (-911.654) [-913.521] (-914.489) -- 0:00:53
Average standard deviation of split frequencies: 0.021646
130500 -- (-910.371) (-920.848) (-910.180) [-911.881] * (-911.131) (-914.051) [-910.298] (-914.002) -- 0:00:53
131000 -- (-914.615) [-918.380] (-910.375) (-914.227) * (-910.207) (-914.238) (-914.528) [-913.532] -- 0:00:53
131500 -- (-911.619) (-915.051) [-912.023] (-913.389) * [-909.910] (-913.853) (-913.626) (-912.625) -- 0:00:52
132000 -- (-910.696) (-920.058) [-917.395] (-911.006) * (-910.769) (-911.925) [-913.063] (-910.030) -- 0:00:52
132500 -- [-911.016] (-913.748) (-913.605) (-910.760) * (-911.880) (-914.628) (-914.321) [-910.376] -- 0:00:52
133000 -- (-911.604) (-913.012) (-911.943) [-910.784] * (-910.851) (-910.513) (-913.809) [-910.536] -- 0:00:52
133500 -- (-911.663) [-911.103] (-913.107) (-913.494) * (-910.320) (-911.332) (-914.141) [-910.335] -- 0:00:51
134000 -- (-911.944) (-914.671) (-912.627) [-911.633] * (-915.846) [-911.472] (-910.933) (-912.754) -- 0:00:51
134500 -- (-910.186) (-912.629) [-910.638] (-910.856) * [-913.768] (-912.610) (-911.779) (-911.608) -- 0:00:51
135000 -- (-910.038) (-910.609) (-910.846) [-912.082] * (-916.370) (-912.295) (-911.681) [-911.068] -- 0:00:51
Average standard deviation of split frequencies: 0.019885
135500 -- [-910.715] (-910.087) (-910.819) (-910.726) * (-911.861) [-913.552] (-914.549) (-911.101) -- 0:00:51
136000 -- (-911.545) [-911.695] (-910.986) (-911.843) * (-912.245) (-915.626) [-910.985] (-912.178) -- 0:00:50
136500 -- (-913.740) [-911.157] (-910.986) (-910.441) * (-910.944) (-914.233) (-910.694) [-912.430] -- 0:00:50
137000 -- (-913.206) (-911.623) (-912.197) [-912.134] * [-911.776] (-911.026) (-910.844) (-909.937) -- 0:00:50
137500 -- (-915.522) (-912.181) (-912.633) [-912.671] * (-912.795) (-911.870) [-912.263] (-910.889) -- 0:00:50
138000 -- [-911.076] (-911.353) (-911.891) (-912.802) * (-913.776) (-910.786) (-913.184) [-911.215] -- 0:00:49
138500 -- (-911.605) (-912.395) [-914.138] (-911.039) * [-911.543] (-911.597) (-913.806) (-913.359) -- 0:00:49
139000 -- (-915.518) [-909.802] (-912.224) (-912.318) * (-910.584) [-911.597] (-914.651) (-914.198) -- 0:00:49
139500 -- (-912.465) (-910.619) [-911.464] (-911.115) * [-910.925] (-911.848) (-911.792) (-913.341) -- 0:00:49
140000 -- (-914.774) [-910.483] (-911.355) (-911.211) * (-910.083) (-912.517) [-910.244] (-915.398) -- 0:00:55
Average standard deviation of split frequencies: 0.019755
140500 -- (-912.453) (-911.691) [-912.416] (-919.949) * [-910.742] (-911.462) (-910.003) (-914.781) -- 0:00:55
141000 -- (-911.830) (-911.776) (-916.665) [-913.135] * (-911.383) (-913.707) (-910.005) [-912.493] -- 0:00:54
141500 -- (-911.128) [-910.500] (-911.709) (-913.901) * (-911.873) (-913.273) [-910.909] (-915.427) -- 0:00:54
142000 -- [-910.481] (-913.531) (-910.559) (-913.606) * (-910.626) (-913.636) [-910.551] (-912.213) -- 0:00:54
142500 -- [-912.901] (-912.299) (-911.053) (-911.191) * (-910.673) (-910.166) [-910.961] (-911.220) -- 0:00:54
143000 -- (-911.580) (-911.796) (-913.767) [-911.241] * (-910.673) (-911.655) (-910.470) [-911.942] -- 0:00:53
143500 -- (-913.935) [-913.813] (-914.207) (-912.960) * (-910.645) (-909.812) (-909.953) [-911.451] -- 0:00:53
144000 -- (-911.794) (-911.673) [-910.716] (-911.524) * (-910.474) [-915.405] (-911.472) (-911.703) -- 0:00:53
144500 -- [-917.356] (-914.413) (-911.431) (-912.846) * (-913.276) (-914.411) [-912.603] (-910.129) -- 0:00:53
145000 -- (-911.578) (-911.602) [-909.946] (-912.667) * (-911.702) (-915.125) (-918.580) [-909.643] -- 0:00:53
Average standard deviation of split frequencies: 0.019883
145500 -- (-911.789) (-912.131) (-909.766) [-911.633] * (-913.582) [-912.966] (-914.224) (-910.486) -- 0:00:52
146000 -- (-912.758) (-910.912) (-909.891) [-910.952] * (-911.693) (-910.858) (-914.989) [-912.920] -- 0:00:52
146500 -- (-912.796) (-911.789) (-909.897) [-910.059] * [-911.192] (-912.782) (-914.362) (-922.037) -- 0:00:52
147000 -- (-912.793) (-911.476) [-909.897] (-911.838) * (-915.438) (-915.714) (-911.699) [-914.408] -- 0:00:52
147500 -- (-910.600) [-913.471] (-913.039) (-913.810) * (-917.553) [-911.310] (-912.005) (-915.417) -- 0:00:52
148000 -- [-911.227] (-913.655) (-910.520) (-913.134) * (-913.298) [-910.398] (-912.201) (-911.845) -- 0:00:51
148500 -- [-912.097] (-910.569) (-911.693) (-914.445) * [-911.493] (-912.811) (-909.976) (-911.478) -- 0:00:51
149000 -- [-911.951] (-910.508) (-910.913) (-914.210) * (-911.236) [-910.486] (-910.081) (-912.436) -- 0:00:51
149500 -- (-914.624) (-913.513) [-912.685] (-917.426) * (-911.377) [-911.611] (-912.410) (-913.907) -- 0:00:51
150000 -- [-909.740] (-914.630) (-912.754) (-913.369) * (-912.030) [-912.179] (-911.084) (-912.513) -- 0:00:51
Average standard deviation of split frequencies: 0.020749
150500 -- (-915.503) (-913.095) [-913.230] (-910.781) * (-913.232) (-912.002) (-911.882) [-910.768] -- 0:00:50
151000 -- [-910.996] (-911.792) (-917.479) (-910.987) * [-912.579] (-913.863) (-914.235) (-910.488) -- 0:00:50
151500 -- (-911.518) [-910.892] (-915.335) (-916.293) * (-915.265) (-914.381) [-911.666] (-910.436) -- 0:00:50
152000 -- (-911.890) (-911.855) (-911.713) [-911.421] * [-912.308] (-915.865) (-910.233) (-912.471) -- 0:00:50
152500 -- (-913.225) (-913.899) [-911.792] (-913.421) * (-910.976) (-913.022) (-910.819) [-910.128] -- 0:00:50
153000 -- (-910.192) (-913.249) (-911.849) [-910.904] * (-909.698) (-911.908) (-914.601) [-913.185] -- 0:00:49
153500 -- (-910.176) [-911.006] (-910.886) (-915.322) * (-917.599) (-916.628) (-911.608) [-910.650] -- 0:00:49
154000 -- (-910.577) [-910.424] (-911.759) (-912.296) * [-911.484] (-912.328) (-917.894) (-909.839) -- 0:00:49
154500 -- (-914.549) (-910.459) [-911.111] (-910.580) * (-913.380) (-911.027) (-915.036) [-911.079] -- 0:00:49
155000 -- (-912.841) (-911.770) [-909.847] (-910.216) * [-913.402] (-911.839) (-911.277) (-915.242) -- 0:00:49
Average standard deviation of split frequencies: 0.023872
155500 -- (-915.882) [-912.597] (-914.031) (-910.632) * (-913.288) (-912.205) (-914.509) [-914.548] -- 0:00:48
156000 -- (-912.492) (-912.094) (-913.393) [-910.300] * [-913.789] (-911.961) (-914.045) (-912.917) -- 0:00:54
156500 -- [-913.530] (-912.449) (-914.159) (-912.831) * (-911.900) (-909.675) (-912.694) [-916.626] -- 0:00:53
157000 -- (-914.401) (-911.108) [-915.747] (-912.244) * [-912.118] (-910.055) (-912.698) (-911.943) -- 0:00:53
157500 -- [-916.487] (-912.804) (-917.028) (-911.906) * [-913.349] (-911.881) (-910.263) (-910.675) -- 0:00:53
158000 -- (-913.399) (-911.344) [-911.634] (-912.075) * [-915.302] (-910.819) (-914.116) (-912.943) -- 0:00:53
158500 -- [-913.812] (-912.052) (-913.255) (-913.712) * [-914.454] (-913.665) (-914.019) (-913.662) -- 0:00:53
159000 -- [-912.786] (-912.935) (-917.618) (-910.916) * (-912.967) [-913.764] (-912.696) (-911.104) -- 0:00:52
159500 -- [-913.965] (-910.504) (-916.339) (-910.314) * (-913.357) (-913.974) [-915.661] (-912.671) -- 0:00:52
160000 -- (-913.968) [-911.548] (-912.837) (-910.304) * (-914.603) (-912.491) [-916.284] (-910.876) -- 0:00:52
Average standard deviation of split frequencies: 0.022592
160500 -- (-913.104) (-914.241) (-910.950) [-910.594] * (-913.275) (-912.124) (-909.918) [-910.009] -- 0:00:52
161000 -- (-913.326) (-912.602) (-910.479) [-914.779] * (-914.667) (-911.643) [-913.650] (-912.031) -- 0:00:52
161500 -- [-912.182] (-912.012) (-913.094) (-910.295) * (-914.496) (-909.865) (-910.548) [-912.062] -- 0:00:51
162000 -- (-912.334) (-915.189) [-911.189] (-911.679) * (-911.729) (-909.835) (-914.623) [-912.171] -- 0:00:51
162500 -- (-914.436) (-912.305) [-912.362] (-910.357) * (-911.483) (-912.370) [-910.623] (-910.932) -- 0:00:51
163000 -- (-911.284) [-910.423] (-910.811) (-910.152) * (-911.649) [-914.640] (-910.553) (-912.881) -- 0:00:51
163500 -- (-910.959) (-914.199) [-911.970] (-910.090) * (-911.018) (-911.434) [-911.689] (-912.477) -- 0:00:51
164000 -- (-911.846) (-914.642) [-909.974] (-910.478) * [-915.178] (-909.768) (-913.385) (-913.160) -- 0:00:50
164500 -- (-910.806) (-914.588) [-910.474] (-910.041) * (-913.340) [-909.823] (-915.165) (-916.739) -- 0:00:50
165000 -- [-911.756] (-913.591) (-910.709) (-911.213) * (-916.118) [-911.496] (-911.210) (-918.188) -- 0:00:50
Average standard deviation of split frequencies: 0.020446
165500 -- (-912.296) (-912.838) [-910.717] (-913.633) * (-911.692) [-911.555] (-914.334) (-912.395) -- 0:00:50
166000 -- (-911.291) (-911.963) [-914.158] (-910.370) * (-915.334) [-913.224] (-918.679) (-910.798) -- 0:00:50
166500 -- (-914.592) [-910.646] (-913.177) (-915.207) * (-914.787) (-913.763) [-912.460] (-912.462) -- 0:00:50
167000 -- (-910.499) [-909.974] (-910.062) (-913.670) * (-914.017) (-913.626) (-913.735) [-911.640] -- 0:00:49
167500 -- [-912.875] (-910.713) (-912.977) (-913.074) * (-912.727) (-912.258) (-912.999) [-911.390] -- 0:00:49
168000 -- (-910.808) (-912.614) [-914.763] (-915.010) * [-914.238] (-915.443) (-910.864) (-911.037) -- 0:00:49
168500 -- (-910.993) (-914.423) (-921.444) [-911.527] * (-911.175) (-912.447) (-911.568) [-910.255] -- 0:00:49
169000 -- (-910.545) (-918.011) [-913.199] (-911.992) * [-911.761] (-911.517) (-912.780) (-917.048) -- 0:00:49
169500 -- (-912.742) (-922.857) [-910.895] (-912.336) * (-911.762) (-913.924) (-911.647) [-916.052] -- 0:00:48
170000 -- (-913.321) [-914.324] (-910.879) (-910.668) * (-912.331) [-914.366] (-912.355) (-914.600) -- 0:00:48
Average standard deviation of split frequencies: 0.019887
170500 -- [-912.196] (-911.898) (-909.914) (-913.205) * (-912.363) (-911.723) [-912.077] (-910.497) -- 0:00:48
171000 -- (-912.174) (-911.923) [-911.395] (-914.193) * [-916.304] (-910.536) (-911.296) (-911.664) -- 0:00:48
171500 -- (-912.418) (-910.423) (-913.477) [-914.888] * (-914.680) (-910.958) (-915.990) [-912.026] -- 0:00:48
172000 -- (-910.638) (-910.928) (-910.401) [-911.327] * (-912.783) [-914.421] (-914.002) (-911.561) -- 0:00:48
172500 -- (-910.892) (-915.359) [-911.170] (-913.083) * (-912.122) (-914.653) (-914.087) [-910.679] -- 0:00:52
173000 -- (-911.180) (-912.617) (-912.302) [-913.291] * (-911.729) (-912.071) (-915.036) [-913.365] -- 0:00:52
173500 -- (-912.867) [-913.946] (-910.632) (-913.420) * (-911.658) (-910.820) (-911.783) [-912.185] -- 0:00:52
174000 -- [-911.024] (-915.779) (-914.365) (-911.507) * (-910.670) (-911.432) (-913.129) [-912.487] -- 0:00:52
174500 -- [-911.266] (-910.205) (-910.820) (-915.339) * (-909.760) (-913.014) (-912.761) [-913.451] -- 0:00:52
175000 -- (-912.247) (-910.149) (-911.860) [-910.068] * (-911.475) (-911.210) [-912.162] (-910.239) -- 0:00:51
Average standard deviation of split frequencies: 0.018326
175500 -- (-915.150) [-910.183] (-912.352) (-911.096) * (-915.862) (-910.631) (-913.229) [-912.332] -- 0:00:51
176000 -- [-915.245] (-911.677) (-915.254) (-910.981) * (-914.692) [-910.217] (-912.094) (-911.384) -- 0:00:51
176500 -- (-914.367) (-911.672) [-913.341] (-910.733) * (-910.288) (-910.220) [-911.201] (-913.890) -- 0:00:51
177000 -- [-911.909] (-910.825) (-915.452) (-911.405) * (-910.971) (-910.135) (-913.611) [-914.125] -- 0:00:51
177500 -- (-912.058) (-912.582) (-913.009) [-911.734] * (-910.761) (-910.202) [-911.609] (-910.290) -- 0:00:50
178000 -- (-913.662) (-911.519) (-912.241) [-910.528] * [-914.822] (-912.135) (-911.141) (-912.681) -- 0:00:50
178500 -- (-913.056) [-912.739] (-912.864) (-911.596) * (-912.949) (-917.434) [-911.197] (-913.807) -- 0:00:50
179000 -- [-911.737] (-912.868) (-913.830) (-911.716) * (-922.982) [-914.024] (-913.130) (-915.055) -- 0:00:50
179500 -- (-911.603) (-913.838) (-913.969) [-915.403] * (-911.824) (-913.626) (-913.631) [-912.075] -- 0:00:50
180000 -- (-910.027) (-915.692) (-913.434) [-912.197] * (-911.137) (-913.131) (-912.854) [-911.057] -- 0:00:50
Average standard deviation of split frequencies: 0.017303
180500 -- [-912.733] (-911.801) (-912.845) (-911.052) * [-912.409] (-917.976) (-913.431) (-910.426) -- 0:00:49
181000 -- [-910.259] (-915.356) (-913.202) (-911.816) * (-912.643) (-910.943) [-910.480] (-913.237) -- 0:00:49
181500 -- (-912.862) [-913.478] (-910.329) (-910.727) * (-912.584) (-913.770) (-910.629) [-914.521] -- 0:00:49
182000 -- [-917.409] (-913.837) (-911.034) (-911.648) * (-912.507) (-912.950) [-910.793] (-914.416) -- 0:00:49
182500 -- (-912.365) (-913.841) (-911.349) [-912.131] * (-914.305) (-917.754) (-911.885) [-914.329] -- 0:00:49
183000 -- (-911.239) (-914.017) (-911.867) [-910.314] * (-911.947) (-918.141) [-912.406] (-914.739) -- 0:00:49
183500 -- (-910.656) (-912.064) (-911.732) [-910.065] * [-912.018] (-914.604) (-912.536) (-912.356) -- 0:00:48
184000 -- (-914.188) [-912.361] (-911.338) (-910.846) * (-912.081) [-914.180] (-913.699) (-911.594) -- 0:00:48
184500 -- (-913.911) (-913.548) [-914.705] (-915.222) * [-913.376] (-912.098) (-912.082) (-915.803) -- 0:00:48
185000 -- [-911.292] (-916.058) (-911.994) (-910.847) * [-911.299] (-917.579) (-911.481) (-918.333) -- 0:00:48
Average standard deviation of split frequencies: 0.019135
185500 -- (-910.558) [-910.690] (-913.658) (-909.677) * (-914.636) (-910.165) (-915.505) [-912.214] -- 0:00:48
186000 -- (-915.807) [-909.943] (-913.198) (-911.443) * (-914.459) (-909.765) [-913.800] (-909.987) -- 0:00:48
186500 -- (-910.576) (-910.234) (-913.513) [-910.054] * [-910.070] (-911.585) (-912.026) (-918.787) -- 0:00:47
187000 -- (-919.283) (-910.492) [-911.187] (-911.145) * [-910.048] (-910.787) (-912.867) (-914.560) -- 0:00:47
187500 -- (-910.851) (-911.287) [-911.829] (-909.621) * (-914.393) [-909.913] (-911.703) (-910.385) -- 0:00:47
188000 -- (-911.076) (-911.377) (-912.327) [-911.450] * [-910.535] (-916.116) (-910.687) (-910.090) -- 0:00:47
188500 -- (-915.027) [-910.947] (-914.250) (-920.086) * (-916.365) (-915.385) [-914.779] (-911.451) -- 0:00:47
189000 -- (-911.704) [-912.447] (-917.568) (-912.364) * (-914.019) (-911.148) [-911.439] (-913.083) -- 0:00:51
189500 -- (-911.643) (-911.414) [-912.841] (-917.993) * (-909.714) [-911.891] (-912.422) (-913.883) -- 0:00:51
190000 -- [-911.519] (-914.549) (-914.963) (-911.926) * (-910.917) (-911.350) (-912.677) [-912.795] -- 0:00:51
Average standard deviation of split frequencies: 0.020768
190500 -- [-910.687] (-913.927) (-910.585) (-914.300) * (-911.354) (-911.827) [-913.739] (-911.641) -- 0:00:50
191000 -- (-910.000) (-916.646) (-909.685) [-914.259] * (-911.738) [-910.617] (-911.038) (-913.471) -- 0:00:50
191500 -- (-911.318) [-916.585] (-912.180) (-914.644) * (-911.947) (-910.105) (-910.476) [-913.213] -- 0:00:50
192000 -- (-911.320) (-914.483) [-912.388] (-911.322) * (-910.480) (-912.026) [-914.862] (-911.351) -- 0:00:50
192500 -- (-910.246) (-915.040) [-913.816] (-910.255) * (-910.591) (-911.291) (-914.287) [-912.172] -- 0:00:50
193000 -- (-910.050) (-910.404) (-911.366) [-910.327] * (-914.257) [-912.087] (-912.827) (-913.974) -- 0:00:50
193500 -- [-911.129] (-912.738) (-911.149) (-912.659) * (-918.618) (-911.230) [-910.531] (-912.094) -- 0:00:50
194000 -- (-912.440) [-911.173] (-914.293) (-913.212) * (-912.215) [-910.467] (-913.055) (-911.401) -- 0:00:49
194500 -- (-911.928) (-913.874) (-913.852) [-910.706] * (-914.862) (-910.467) (-914.358) [-914.098] -- 0:00:49
195000 -- (-911.081) [-912.722] (-910.478) (-914.528) * (-916.230) [-911.188] (-913.252) (-913.117) -- 0:00:49
Average standard deviation of split frequencies: 0.019963
195500 -- (-911.293) [-912.371] (-910.809) (-912.343) * (-915.142) (-912.797) (-911.971) [-911.334] -- 0:00:49
196000 -- (-913.445) (-909.615) (-911.697) [-912.321] * (-912.686) [-909.808] (-911.667) (-911.626) -- 0:00:49
196500 -- (-911.234) [-909.925] (-912.958) (-914.506) * (-918.293) (-911.741) [-910.636] (-912.562) -- 0:00:49
197000 -- (-914.430) (-912.333) [-910.465] (-911.833) * (-923.685) (-911.741) (-910.985) [-912.675] -- 0:00:48
197500 -- (-913.267) (-913.220) [-911.074] (-912.419) * [-912.060] (-912.673) (-911.421) (-910.190) -- 0:00:48
198000 -- (-917.623) (-911.057) [-913.613] (-913.473) * (-911.017) [-911.274] (-910.823) (-912.349) -- 0:00:48
198500 -- (-915.998) (-914.258) (-913.101) [-910.595] * (-910.877) (-910.636) (-911.462) [-912.356] -- 0:00:48
199000 -- (-915.407) (-913.383) (-910.918) [-911.546] * (-912.321) [-910.748] (-911.678) (-911.908) -- 0:00:48
199500 -- (-909.597) (-911.921) (-910.875) [-911.893] * [-911.137] (-913.187) (-915.332) (-911.414) -- 0:00:48
200000 -- (-909.575) [-915.920] (-911.674) (-913.455) * (-913.524) (-912.605) [-913.519] (-911.929) -- 0:00:48
Average standard deviation of split frequencies: 0.018676
200500 -- (-912.786) (-911.185) (-913.320) [-913.835] * (-917.911) (-911.204) (-915.339) [-911.940] -- 0:00:47
201000 -- (-912.622) [-911.362] (-911.575) (-912.325) * [-912.828] (-912.303) (-913.837) (-913.221) -- 0:00:47
201500 -- [-911.537] (-912.469) (-914.312) (-911.626) * (-910.512) [-912.323] (-914.152) (-918.479) -- 0:00:47
202000 -- (-910.714) (-912.198) (-916.196) [-911.272] * (-916.647) (-914.626) [-911.941] (-916.473) -- 0:00:47
202500 -- (-911.259) (-912.236) (-913.987) [-912.972] * (-914.051) (-917.142) [-912.525] (-915.484) -- 0:00:47
203000 -- [-910.251] (-912.871) (-911.947) (-910.684) * (-918.859) (-915.008) (-913.080) [-912.853] -- 0:00:47
203500 -- (-910.186) (-915.431) (-916.052) [-912.934] * (-910.241) (-914.813) (-919.388) [-910.584] -- 0:00:46
204000 -- (-910.929) (-913.912) [-912.891] (-912.217) * (-911.932) [-912.222] (-915.519) (-911.672) -- 0:00:46
204500 -- [-910.252] (-913.261) (-913.726) (-914.063) * [-913.427] (-912.900) (-912.130) (-915.011) -- 0:00:46
205000 -- (-911.750) (-911.617) [-912.028] (-912.352) * [-911.520] (-916.493) (-911.816) (-917.051) -- 0:00:50
Average standard deviation of split frequencies: 0.018421
205500 -- (-915.149) (-911.887) [-910.052] (-910.851) * (-913.776) (-912.653) [-912.895] (-913.069) -- 0:00:50
206000 -- (-911.707) [-912.579] (-911.623) (-913.756) * (-914.858) [-910.749] (-911.483) (-913.598) -- 0:00:50
206500 -- (-914.770) (-913.657) [-909.971] (-912.741) * [-912.931] (-911.432) (-914.237) (-910.882) -- 0:00:49
207000 -- (-913.411) [-911.162] (-909.876) (-910.981) * (-910.632) (-912.727) (-912.408) [-910.197] -- 0:00:49
207500 -- (-912.860) [-910.813] (-910.762) (-911.696) * (-911.623) (-910.405) [-910.170] (-912.010) -- 0:00:49
208000 -- (-912.698) (-910.898) [-911.634] (-913.712) * (-910.179) (-910.968) [-914.617] (-914.584) -- 0:00:49
208500 -- (-912.470) (-911.877) (-911.906) [-911.234] * [-911.677] (-909.674) (-914.725) (-914.063) -- 0:00:49
209000 -- (-917.864) (-911.384) (-910.253) [-914.121] * (-911.574) [-911.126] (-911.536) (-913.777) -- 0:00:49
209500 -- (-914.761) (-911.832) [-910.208] (-913.232) * (-917.812) (-911.079) [-910.272] (-911.775) -- 0:00:49
210000 -- (-913.542) (-910.691) (-910.767) [-912.106] * (-920.196) [-911.962] (-913.622) (-910.311) -- 0:00:48
Average standard deviation of split frequencies: 0.018844
210500 -- [-914.630] (-909.687) (-912.124) (-911.871) * (-910.021) (-912.946) (-911.692) [-914.623] -- 0:00:48
211000 -- (-912.582) [-909.781] (-911.615) (-913.051) * (-910.401) [-911.208] (-914.338) (-916.243) -- 0:00:48
211500 -- [-912.135] (-910.857) (-911.725) (-914.060) * (-912.778) (-912.821) (-914.722) [-910.831] -- 0:00:48
212000 -- (-911.861) (-914.780) (-911.392) [-911.608] * (-913.269) [-914.845] (-916.488) (-911.375) -- 0:00:48
212500 -- [-911.349] (-913.953) (-910.970) (-913.453) * (-912.546) (-911.730) (-912.749) [-910.971] -- 0:00:48
213000 -- (-912.306) (-913.133) [-910.550] (-911.012) * (-910.946) [-911.154] (-917.474) (-909.970) -- 0:00:48
213500 -- [-913.288] (-910.678) (-912.239) (-912.495) * (-911.041) [-911.817] (-915.411) (-913.690) -- 0:00:47
214000 -- (-913.721) [-911.035] (-917.002) (-913.440) * [-912.560] (-913.525) (-913.712) (-911.152) -- 0:00:47
214500 -- (-914.472) (-911.051) (-911.253) [-911.149] * [-912.518] (-909.805) (-912.324) (-910.249) -- 0:00:47
215000 -- [-912.344] (-912.458) (-912.409) (-912.924) * (-911.153) (-910.192) (-913.781) [-909.951] -- 0:00:47
Average standard deviation of split frequencies: 0.016974
215500 -- (-913.114) (-911.467) (-913.095) [-914.603] * (-914.309) (-912.774) (-911.492) [-915.717] -- 0:00:47
216000 -- (-914.158) (-911.456) [-911.322] (-910.940) * (-913.898) [-913.748] (-910.630) (-914.872) -- 0:00:47
216500 -- (-913.511) [-914.392] (-911.966) (-912.312) * [-912.903] (-913.974) (-910.034) (-915.390) -- 0:00:47
217000 -- (-917.932) [-911.874] (-913.012) (-912.646) * [-915.709] (-911.703) (-911.399) (-913.586) -- 0:00:46
217500 -- (-914.699) (-910.757) (-912.703) [-910.273] * [-916.513] (-910.185) (-910.598) (-918.035) -- 0:00:46
218000 -- (-914.408) [-911.954] (-911.543) (-911.155) * (-912.730) [-910.134] (-913.694) (-912.626) -- 0:00:46
218500 -- [-915.141] (-910.561) (-913.032) (-912.872) * (-909.987) [-909.984] (-912.422) (-913.985) -- 0:00:46
219000 -- [-914.173] (-912.798) (-911.556) (-914.610) * [-914.210] (-913.572) (-912.963) (-913.477) -- 0:00:46
219500 -- [-913.689] (-911.128) (-912.943) (-913.008) * (-911.929) (-910.241) [-911.343] (-911.279) -- 0:00:46
220000 -- (-912.085) (-913.157) (-919.302) [-911.784] * (-914.303) (-911.242) [-909.916] (-912.162) -- 0:00:46
Average standard deviation of split frequencies: 0.016022
220500 -- (-912.189) [-912.998] (-913.886) (-911.312) * (-912.464) [-911.840] (-910.695) (-912.676) -- 0:00:45
221000 -- (-913.369) (-910.140) [-911.418] (-915.006) * [-913.001] (-911.412) (-911.021) (-910.723) -- 0:00:45
221500 -- (-916.028) [-910.144] (-911.603) (-916.396) * (-911.584) (-916.099) (-912.392) [-910.555] -- 0:00:49
222000 -- (-913.266) (-912.063) [-910.307] (-912.427) * (-912.624) (-911.864) [-910.992] (-914.469) -- 0:00:49
222500 -- (-912.490) (-911.765) [-910.242] (-910.003) * (-911.423) (-913.444) (-913.975) [-911.059] -- 0:00:48
223000 -- (-915.236) [-911.673] (-914.282) (-913.215) * [-910.049] (-912.491) (-913.776) (-913.540) -- 0:00:48
223500 -- [-911.983] (-912.643) (-911.619) (-913.810) * (-912.947) (-914.312) [-912.323] (-911.050) -- 0:00:48
224000 -- (-910.964) (-912.957) (-911.920) [-913.488] * (-911.170) (-910.482) [-912.650] (-910.842) -- 0:00:48
224500 -- (-913.829) (-910.126) [-913.316] (-910.935) * (-913.032) [-910.099] (-912.751) (-913.221) -- 0:00:48
225000 -- (-913.358) (-912.429) (-912.539) [-914.135] * (-911.284) (-910.956) (-912.269) [-910.265] -- 0:00:48
Average standard deviation of split frequencies: 0.016223
225500 -- [-912.111] (-912.905) (-912.057) (-916.705) * (-911.950) (-910.503) [-912.039] (-909.820) -- 0:00:48
226000 -- [-911.903] (-914.052) (-911.193) (-918.212) * (-916.280) [-916.203] (-910.495) (-911.884) -- 0:00:47
226500 -- (-913.717) [-911.773] (-911.566) (-913.261) * [-917.182] (-913.584) (-912.587) (-909.863) -- 0:00:47
227000 -- (-914.532) (-911.760) [-910.727] (-912.578) * [-915.583] (-910.506) (-912.951) (-913.151) -- 0:00:47
227500 -- [-910.836] (-913.114) (-910.541) (-911.883) * [-910.676] (-910.360) (-912.581) (-910.409) -- 0:00:47
228000 -- (-912.196) [-911.370] (-911.951) (-911.802) * (-913.006) (-910.200) [-910.965] (-911.879) -- 0:00:47
228500 -- (-912.158) (-913.834) (-912.144) [-910.787] * (-911.508) (-911.697) [-909.837] (-913.007) -- 0:00:47
229000 -- (-911.581) (-912.986) (-912.035) [-911.883] * (-912.214) (-912.668) (-911.679) [-911.663] -- 0:00:47
229500 -- (-914.721) (-910.674) (-913.915) [-911.816] * (-912.983) (-915.567) (-911.793) [-910.934] -- 0:00:47
230000 -- (-918.644) (-911.081) (-913.418) [-911.012] * (-911.559) [-911.688] (-914.032) (-913.434) -- 0:00:46
Average standard deviation of split frequencies: 0.016690
230500 -- [-910.810] (-911.034) (-914.275) (-910.938) * [-911.777] (-910.228) (-913.231) (-916.614) -- 0:00:46
231000 -- [-910.094] (-912.068) (-913.475) (-910.285) * (-912.306) (-911.346) (-910.338) [-913.926] -- 0:00:46
231500 -- (-913.270) [-911.829] (-913.631) (-912.882) * (-910.905) (-913.924) (-910.358) [-912.472] -- 0:00:46
232000 -- (-911.602) [-910.680] (-912.384) (-910.120) * (-915.480) (-911.977) (-911.068) [-910.169] -- 0:00:46
232500 -- (-912.333) (-909.975) [-910.366] (-911.535) * (-911.351) (-911.081) [-909.830] (-909.809) -- 0:00:46
233000 -- (-912.071) [-910.584] (-914.432) (-914.181) * (-914.098) (-910.521) (-912.529) [-913.301] -- 0:00:46
233500 -- (-911.188) [-910.695] (-916.133) (-911.967) * [-913.860] (-910.932) (-912.066) (-912.249) -- 0:00:45
234000 -- (-913.607) [-912.541] (-914.007) (-914.231) * (-910.820) [-909.990] (-912.117) (-917.643) -- 0:00:45
234500 -- (-913.187) (-911.926) (-913.179) [-912.580] * (-910.839) (-909.671) (-913.596) [-912.631] -- 0:00:45
235000 -- [-909.984] (-912.745) (-910.437) (-910.315) * (-914.108) [-913.582] (-912.446) (-914.907) -- 0:00:45
Average standard deviation of split frequencies: 0.016091
235500 -- (-910.941) (-913.237) (-910.604) [-910.968] * (-910.815) (-912.884) (-914.305) [-912.142] -- 0:00:45
236000 -- (-910.645) (-913.814) (-909.530) [-910.194] * (-912.107) (-915.600) [-914.641] (-911.749) -- 0:00:45
236500 -- (-911.838) (-911.323) (-909.920) [-910.466] * [-911.615] (-917.019) (-914.797) (-913.322) -- 0:00:45
237000 -- (-910.809) [-911.187] (-909.646) (-912.757) * [-912.398] (-916.330) (-911.742) (-912.332) -- 0:00:45
237500 -- (-910.206) (-911.319) [-910.030] (-911.789) * (-913.213) [-910.933] (-912.553) (-910.945) -- 0:00:44
238000 -- [-911.621] (-912.268) (-911.006) (-913.643) * (-910.768) (-915.469) [-911.153] (-914.079) -- 0:00:48
238500 -- (-913.184) [-909.969] (-911.801) (-914.463) * (-911.845) (-913.189) (-912.881) [-913.439] -- 0:00:47
239000 -- (-911.521) (-909.858) [-912.694] (-912.692) * [-912.243] (-911.551) (-912.154) (-913.391) -- 0:00:47
239500 -- (-913.442) (-909.842) (-913.844) [-911.901] * (-911.124) (-913.838) (-910.043) [-911.556] -- 0:00:47
240000 -- (-911.286) [-911.586] (-911.096) (-912.875) * (-910.457) [-911.735] (-910.043) (-914.461) -- 0:00:47
Average standard deviation of split frequencies: 0.015670
240500 -- [-910.276] (-912.271) (-911.157) (-914.796) * (-912.734) [-911.905] (-909.995) (-912.480) -- 0:00:47
241000 -- (-914.127) (-912.370) (-911.036) [-912.699] * [-911.476] (-910.449) (-909.995) (-911.899) -- 0:00:47
241500 -- [-914.449] (-912.226) (-911.466) (-912.069) * (-911.807) (-913.524) [-909.992] (-913.351) -- 0:00:47
242000 -- [-912.142] (-912.214) (-911.332) (-912.429) * [-912.088] (-911.839) (-913.958) (-912.313) -- 0:00:46
242500 -- (-911.961) [-910.454] (-913.329) (-914.743) * (-910.950) (-913.709) [-914.245] (-915.279) -- 0:00:46
243000 -- (-917.328) (-910.454) [-910.846] (-914.788) * (-913.597) [-911.877] (-910.627) (-916.812) -- 0:00:46
243500 -- (-913.888) [-909.827] (-914.961) (-910.102) * (-915.536) (-914.440) [-910.620] (-916.455) -- 0:00:46
244000 -- (-915.498) (-911.273) [-913.096] (-910.127) * (-913.007) [-914.051] (-912.337) (-912.266) -- 0:00:46
244500 -- [-911.146] (-912.151) (-911.176) (-911.251) * (-910.242) (-916.407) [-913.151] (-910.759) -- 0:00:46
245000 -- (-912.850) [-910.170] (-911.616) (-911.017) * (-910.874) [-911.385] (-914.421) (-910.774) -- 0:00:46
Average standard deviation of split frequencies: 0.015028
245500 -- [-914.113] (-914.163) (-912.672) (-911.813) * [-916.954] (-914.626) (-913.465) (-910.528) -- 0:00:46
246000 -- [-912.994] (-913.508) (-910.349) (-910.977) * [-911.797] (-912.107) (-912.505) (-911.317) -- 0:00:45
246500 -- [-913.640] (-911.894) (-910.510) (-914.417) * (-910.342) (-911.885) [-914.824] (-911.504) -- 0:00:45
247000 -- (-915.327) (-911.748) [-911.283] (-911.385) * (-911.184) (-910.675) (-916.246) [-911.767] -- 0:00:45
247500 -- (-911.158) (-913.154) (-911.040) [-911.416] * [-916.912] (-914.120) (-919.658) (-911.067) -- 0:00:45
248000 -- (-911.695) (-914.776) [-914.856] (-912.180) * (-911.485) [-912.988] (-916.829) (-911.568) -- 0:00:45
248500 -- (-914.455) (-911.759) [-914.280] (-913.355) * (-911.296) (-910.813) [-915.850] (-916.287) -- 0:00:45
249000 -- (-914.115) [-912.221] (-911.300) (-911.848) * (-910.141) [-912.646] (-911.018) (-912.573) -- 0:00:45
249500 -- (-916.050) (-911.886) (-915.217) [-912.577] * (-913.380) [-911.199] (-916.841) (-914.469) -- 0:00:45
250000 -- (-913.377) [-911.155] (-913.491) (-913.090) * (-912.780) (-910.782) [-910.242] (-913.579) -- 0:00:45
Average standard deviation of split frequencies: 0.014313
250500 -- (-913.956) [-910.659] (-913.780) (-910.414) * (-915.265) (-910.732) (-912.032) [-912.606] -- 0:00:44
251000 -- (-913.785) [-911.416] (-911.364) (-912.122) * (-910.131) (-911.105) [-912.432] (-913.487) -- 0:00:44
251500 -- (-912.782) (-910.899) [-911.429] (-914.299) * (-910.642) (-911.533) [-912.447] (-912.017) -- 0:00:44
252000 -- [-911.222] (-911.011) (-910.527) (-912.101) * (-912.095) [-911.284] (-911.752) (-911.340) -- 0:00:44
252500 -- (-912.567) [-912.320] (-911.664) (-912.967) * (-911.483) (-913.211) (-910.282) [-910.469] -- 0:00:44
253000 -- (-910.371) [-911.447] (-912.433) (-911.632) * [-913.802] (-911.633) (-912.711) (-913.491) -- 0:00:44
253500 -- (-911.930) (-911.939) (-912.968) [-911.062] * (-911.936) (-911.547) (-912.393) [-913.110] -- 0:00:44
254000 -- (-910.981) [-913.914] (-911.981) (-911.008) * [-915.079] (-912.919) (-911.327) (-912.060) -- 0:00:44
254500 -- (-911.810) (-911.163) (-911.082) [-913.940] * (-915.029) (-910.879) [-911.969] (-911.496) -- 0:00:46
255000 -- (-911.229) [-911.533] (-910.740) (-919.338) * (-911.851) (-912.118) (-909.973) [-911.903] -- 0:00:46
Average standard deviation of split frequencies: 0.013811
255500 -- (-911.277) (-912.610) [-911.919] (-914.821) * [-911.086] (-912.127) (-912.371) (-911.019) -- 0:00:46
256000 -- (-914.746) [-912.252] (-910.347) (-919.043) * (-910.907) (-912.099) (-912.749) [-910.080] -- 0:00:46
256500 -- (-912.438) [-912.960] (-910.494) (-912.620) * (-910.518) (-910.150) (-913.949) [-912.848] -- 0:00:46
257000 -- (-911.278) (-910.513) [-911.160] (-915.377) * (-911.015) (-913.885) (-914.769) [-910.048] -- 0:00:46
257500 -- (-912.197) [-910.393] (-910.809) (-912.728) * (-910.974) (-910.510) (-914.315) [-912.130] -- 0:00:46
258000 -- [-910.759] (-911.215) (-917.321) (-911.498) * (-914.160) (-910.666) (-913.181) [-911.062] -- 0:00:46
258500 -- (-910.943) (-914.569) (-910.115) [-911.957] * (-911.094) (-912.175) [-912.585] (-911.473) -- 0:00:45
259000 -- (-910.213) (-914.768) [-910.282] (-911.197) * (-911.027) (-911.512) [-912.598] (-914.933) -- 0:00:45
259500 -- (-911.104) (-911.873) (-911.497) [-912.762] * (-911.278) (-910.967) (-911.702) [-911.209] -- 0:00:45
260000 -- [-910.744] (-910.184) (-911.517) (-912.087) * (-912.007) (-912.318) (-910.723) [-911.609] -- 0:00:45
Average standard deviation of split frequencies: 0.013897
260500 -- (-911.458) (-910.477) (-910.586) [-910.445] * (-912.823) [-911.477] (-910.225) (-914.373) -- 0:00:45
261000 -- (-913.164) [-910.379] (-911.401) (-911.311) * (-913.003) (-914.863) [-912.548] (-914.221) -- 0:00:45
261500 -- (-910.189) [-910.307] (-911.497) (-911.334) * (-911.677) (-910.530) (-910.109) [-916.590] -- 0:00:45
262000 -- (-913.650) (-911.694) (-910.824) [-909.949] * (-912.533) (-911.998) [-909.965] (-912.298) -- 0:00:45
262500 -- (-911.075) (-912.109) (-911.272) [-910.029] * [-913.783] (-909.980) (-910.853) (-910.994) -- 0:00:44
263000 -- [-909.998] (-910.957) (-912.022) (-910.064) * (-912.204) [-910.490] (-909.799) (-910.958) -- 0:00:44
263500 -- (-910.687) (-913.496) (-910.727) [-909.847] * [-912.515] (-910.644) (-913.022) (-914.571) -- 0:00:44
264000 -- [-911.619] (-912.904) (-910.757) (-910.897) * [-910.483] (-913.914) (-913.114) (-912.758) -- 0:00:44
264500 -- (-911.054) (-910.406) [-911.638] (-913.413) * (-911.243) (-911.388) [-915.830] (-916.984) -- 0:00:44
265000 -- (-913.352) (-911.538) [-911.548] (-913.264) * [-909.854] (-911.698) (-910.263) (-915.334) -- 0:00:44
Average standard deviation of split frequencies: 0.013618
265500 -- [-912.729] (-912.576) (-910.177) (-913.274) * (-911.788) (-913.343) (-911.978) [-916.653] -- 0:00:44
266000 -- (-916.550) (-912.944) (-913.894) [-912.018] * (-910.823) [-910.570] (-911.936) (-912.927) -- 0:00:44
266500 -- (-910.764) (-913.864) [-914.861] (-915.296) * (-912.014) [-910.348] (-911.210) (-913.328) -- 0:00:44
267000 -- (-911.568) (-913.375) [-913.768] (-910.774) * (-913.820) [-911.275] (-910.611) (-913.500) -- 0:00:43
267500 -- (-910.863) (-911.741) [-910.382] (-910.389) * (-912.001) (-913.750) [-911.590] (-912.486) -- 0:00:43
268000 -- (-911.082) (-910.491) [-911.871] (-911.991) * [-911.495] (-915.025) (-914.582) (-910.193) -- 0:00:43
268500 -- (-910.900) (-910.454) [-915.861] (-912.089) * (-909.986) (-924.448) (-911.389) [-911.144] -- 0:00:43
269000 -- (-910.392) (-912.187) (-914.038) [-914.561] * [-910.490] (-914.732) (-913.752) (-911.746) -- 0:00:43
269500 -- [-913.007] (-912.258) (-912.729) (-912.871) * (-916.208) (-909.963) (-911.462) [-912.855] -- 0:00:43
270000 -- (-912.392) (-911.273) (-913.981) [-910.753] * (-914.068) (-914.062) [-910.242] (-911.838) -- 0:00:43
Average standard deviation of split frequencies: 0.011372
270500 -- (-910.682) (-912.003) [-911.204] (-911.681) * (-912.003) [-911.145] (-912.630) (-912.649) -- 0:00:43
271000 -- (-911.207) (-915.402) [-911.621] (-912.050) * (-911.318) (-913.613) [-913.304] (-916.303) -- 0:00:45
271500 -- (-912.600) (-911.149) (-911.382) [-914.236] * (-911.163) [-911.726] (-913.122) (-912.557) -- 0:00:45
272000 -- [-917.464] (-911.368) (-913.908) (-914.350) * (-914.926) (-913.307) [-913.302] (-910.516) -- 0:00:45
272500 -- (-912.488) [-911.348] (-914.819) (-910.806) * (-919.859) [-910.284] (-910.913) (-910.178) -- 0:00:45
273000 -- (-916.371) (-911.311) (-911.718) [-912.193] * (-916.225) (-910.940) (-911.271) [-911.165] -- 0:00:45
273500 -- (-912.575) (-914.550) [-911.442] (-913.465) * (-913.469) (-910.880) [-911.522] (-912.271) -- 0:00:45
274000 -- (-913.427) (-913.726) [-910.939] (-910.352) * (-914.507) [-910.339] (-910.285) (-911.858) -- 0:00:45
274500 -- (-912.071) (-910.466) (-911.354) [-910.503] * (-921.011) [-909.880] (-910.836) (-912.193) -- 0:00:44
275000 -- (-911.655) [-911.875] (-911.974) (-912.135) * [-911.838] (-913.945) (-913.699) (-915.598) -- 0:00:44
Average standard deviation of split frequencies: 0.011253
275500 -- (-915.800) (-909.827) (-910.395) [-910.148] * (-912.345) (-912.416) [-909.759] (-910.683) -- 0:00:44
276000 -- (-915.551) (-912.394) [-910.138] (-910.819) * (-919.419) (-912.158) (-910.580) [-910.986] -- 0:00:44
276500 -- (-920.057) (-911.747) (-911.408) [-911.714] * (-912.627) [-912.739] (-913.175) (-912.201) -- 0:00:44
277000 -- (-917.618) (-910.021) (-912.621) [-910.023] * (-912.962) (-911.229) [-913.235] (-909.904) -- 0:00:44
277500 -- (-915.168) (-911.555) (-913.966) [-909.660] * (-913.937) [-911.804] (-912.926) (-911.193) -- 0:00:44
278000 -- (-911.434) (-910.354) (-912.069) [-911.657] * (-914.331) (-913.853) [-914.808] (-910.769) -- 0:00:44
278500 -- [-912.945] (-910.494) (-913.542) (-912.047) * (-913.362) [-912.302] (-912.247) (-912.923) -- 0:00:44
279000 -- (-914.368) [-911.192] (-916.044) (-912.247) * (-911.498) [-910.127] (-914.014) (-909.883) -- 0:00:43
279500 -- [-912.802] (-912.541) (-915.877) (-913.131) * (-911.159) [-910.810] (-913.000) (-910.368) -- 0:00:43
280000 -- (-910.961) [-911.257] (-911.801) (-911.785) * [-910.172] (-912.692) (-913.666) (-911.292) -- 0:00:43
Average standard deviation of split frequencies: 0.009781
280500 -- [-911.232] (-910.296) (-911.725) (-918.941) * [-912.746] (-912.986) (-917.449) (-910.677) -- 0:00:43
281000 -- (-911.219) [-912.444] (-910.144) (-915.424) * (-914.615) (-911.967) (-913.994) [-913.409] -- 0:00:43
281500 -- [-915.171] (-916.733) (-911.564) (-910.600) * (-911.131) (-910.761) (-910.808) [-911.744] -- 0:00:43
282000 -- (-911.580) [-915.155] (-913.427) (-912.670) * (-913.246) [-911.361] (-910.335) (-916.063) -- 0:00:43
282500 -- (-914.857) (-912.058) [-912.406] (-912.694) * (-911.573) [-911.364] (-913.054) (-914.714) -- 0:00:43
283000 -- (-914.746) (-913.494) [-913.018] (-913.274) * [-911.926] (-912.940) (-910.361) (-910.486) -- 0:00:43
283500 -- (-912.575) (-913.089) (-912.718) [-910.349] * (-912.718) [-911.713] (-910.386) (-910.189) -- 0:00:42
284000 -- (-914.378) [-912.575] (-913.173) (-910.154) * (-910.317) (-911.689) (-910.244) [-912.568] -- 0:00:42
284500 -- (-914.909) (-916.567) (-913.906) [-911.935] * (-911.731) (-910.054) (-911.248) [-913.936] -- 0:00:42
285000 -- (-915.288) [-913.253] (-914.965) (-911.306) * (-912.422) (-911.985) [-910.376] (-911.635) -- 0:00:42
Average standard deviation of split frequencies: 0.009017
285500 -- [-910.684] (-912.807) (-911.091) (-912.367) * (-912.447) (-910.313) (-910.380) [-910.785] -- 0:00:42
286000 -- (-912.197) [-910.483] (-913.298) (-911.505) * (-912.353) (-911.914) (-911.728) [-913.885] -- 0:00:42
286500 -- (-911.049) (-910.466) (-911.120) [-912.414] * (-914.452) [-912.816] (-913.973) (-913.945) -- 0:00:42
287000 -- (-911.204) [-910.650] (-910.526) (-911.759) * [-910.844] (-911.413) (-914.468) (-912.142) -- 0:00:42
287500 -- (-911.298) [-912.399] (-912.541) (-910.978) * (-910.135) (-910.573) [-910.956] (-910.885) -- 0:00:44
288000 -- (-911.140) (-912.853) (-910.921) [-911.243] * (-909.936) (-910.479) [-913.632] (-910.536) -- 0:00:44
288500 -- [-911.587] (-911.180) (-912.201) (-911.945) * [-911.223] (-913.101) (-913.269) (-910.588) -- 0:00:44
289000 -- [-912.369] (-916.681) (-911.879) (-910.171) * (-911.057) (-913.653) (-915.307) [-910.322] -- 0:00:44
289500 -- (-912.977) (-920.961) (-911.216) [-913.431] * (-912.277) (-913.207) [-911.815] (-910.464) -- 0:00:44
290000 -- (-914.145) [-911.970] (-912.684) (-914.368) * [-912.717] (-912.553) (-910.941) (-915.137) -- 0:00:44
Average standard deviation of split frequencies: 0.008586
290500 -- (-916.239) (-911.003) (-911.350) [-914.170] * [-910.810] (-912.789) (-911.346) (-911.950) -- 0:00:43
291000 -- (-911.464) (-911.893) [-913.123] (-912.337) * [-911.243] (-912.465) (-917.327) (-911.475) -- 0:00:43
291500 -- (-912.071) (-911.775) [-911.329] (-914.791) * [-912.541] (-918.462) (-916.688) (-912.848) -- 0:00:43
292000 -- (-912.764) [-915.333] (-909.756) (-911.467) * (-911.421) (-919.383) [-911.977] (-911.049) -- 0:00:43
292500 -- (-911.834) (-912.175) [-909.887] (-911.560) * (-913.773) [-914.097] (-910.512) (-912.014) -- 0:00:43
293000 -- (-914.116) (-913.988) [-910.061] (-911.606) * (-911.361) (-911.125) [-910.933] (-910.820) -- 0:00:43
293500 -- (-919.420) [-912.081] (-912.533) (-913.083) * [-912.239] (-911.415) (-912.378) (-913.982) -- 0:00:43
294000 -- [-913.456] (-910.928) (-917.776) (-911.974) * (-912.726) [-910.840] (-914.700) (-911.901) -- 0:00:43
294500 -- (-910.599) [-912.037] (-911.218) (-911.789) * (-912.652) (-910.925) [-911.358] (-909.762) -- 0:00:43
295000 -- (-910.211) (-913.311) (-911.212) [-911.395] * [-910.275] (-910.661) (-910.841) (-914.475) -- 0:00:43
Average standard deviation of split frequencies: 0.008806
295500 -- (-912.317) (-912.070) (-911.154) [-910.621] * (-912.103) (-914.130) [-911.002] (-912.067) -- 0:00:42
296000 -- [-912.832] (-912.488) (-912.516) (-912.485) * (-913.760) (-913.163) (-912.374) [-913.319] -- 0:00:42
296500 -- (-916.091) (-913.175) [-913.514] (-914.256) * (-914.536) (-911.621) (-912.728) [-911.785] -- 0:00:42
297000 -- (-910.482) (-913.058) [-910.131] (-913.570) * (-911.638) (-913.921) [-910.307] (-914.110) -- 0:00:42
297500 -- (-910.323) (-910.490) [-911.082] (-911.408) * (-911.205) [-910.968] (-913.493) (-911.016) -- 0:00:42
298000 -- (-915.804) (-911.881) [-913.846] (-911.754) * (-911.466) [-910.410] (-910.794) (-910.820) -- 0:00:42
298500 -- (-914.064) (-911.769) (-916.176) [-910.263] * (-916.798) (-911.828) (-911.060) [-913.923] -- 0:00:42
299000 -- [-912.495] (-910.454) (-912.206) (-914.199) * [-911.620] (-910.961) (-910.636) (-912.823) -- 0:00:42
299500 -- (-911.877) (-910.396) (-913.867) [-911.463] * (-915.218) [-910.668] (-916.231) (-913.170) -- 0:00:42
300000 -- (-911.454) (-910.147) (-911.409) [-911.556] * [-911.119] (-911.041) (-912.768) (-913.705) -- 0:00:42
Average standard deviation of split frequencies: 0.008035
300500 -- [-909.792] (-912.345) (-914.809) (-911.793) * (-911.090) (-910.857) [-911.246] (-914.486) -- 0:00:41
301000 -- (-910.483) (-910.275) (-912.744) [-911.791] * (-911.754) (-911.790) (-911.335) [-911.634] -- 0:00:41
301500 -- (-912.605) [-912.011] (-910.573) (-912.422) * (-913.286) [-911.584] (-910.863) (-911.809) -- 0:00:41
302000 -- [-911.596] (-914.992) (-910.992) (-913.727) * (-911.411) [-910.848] (-912.470) (-913.371) -- 0:00:41
302500 -- [-911.121] (-911.448) (-910.506) (-914.538) * (-910.565) (-914.743) (-912.035) [-911.914] -- 0:00:41
303000 -- [-910.381] (-911.346) (-913.529) (-912.372) * (-910.392) (-911.360) (-914.941) [-910.669] -- 0:00:41
303500 -- (-913.433) [-911.307] (-913.506) (-915.119) * (-911.243) (-911.812) (-918.370) [-910.504] -- 0:00:43
304000 -- (-910.865) (-913.538) [-909.646] (-914.161) * (-910.496) [-911.508] (-912.347) (-912.276) -- 0:00:43
304500 -- (-910.876) (-911.715) [-911.086] (-913.764) * (-910.597) [-912.531] (-913.627) (-910.947) -- 0:00:43
305000 -- [-910.852] (-911.786) (-910.939) (-914.586) * (-910.821) [-914.316] (-910.849) (-916.593) -- 0:00:43
Average standard deviation of split frequencies: 0.010013
305500 -- (-916.649) (-910.363) [-913.629] (-913.817) * (-911.221) [-912.441] (-914.214) (-912.436) -- 0:00:43
306000 -- (-911.852) (-914.190) [-911.375] (-914.133) * [-910.977] (-912.450) (-913.573) (-910.529) -- 0:00:43
306500 -- (-912.714) (-915.086) (-917.230) [-912.501] * [-912.913] (-912.024) (-914.336) (-911.827) -- 0:00:42
307000 -- (-916.169) (-915.306) (-916.367) [-911.885] * (-911.943) (-913.712) (-914.267) [-910.562] -- 0:00:42
307500 -- (-912.726) [-912.857] (-912.133) (-911.568) * (-912.046) [-911.651] (-913.385) (-913.318) -- 0:00:42
308000 -- (-911.168) (-914.054) [-912.018] (-915.654) * (-911.890) (-913.402) [-911.396] (-913.057) -- 0:00:42
308500 -- (-910.701) [-913.212] (-912.498) (-914.835) * (-912.055) (-910.823) [-911.356] (-910.980) -- 0:00:42
309000 -- (-910.530) (-911.496) [-910.232] (-911.719) * [-914.215] (-910.848) (-915.283) (-914.986) -- 0:00:42
309500 -- (-912.347) [-911.296] (-910.118) (-912.859) * (-915.402) [-910.682] (-913.994) (-910.913) -- 0:00:42
310000 -- (-911.152) [-915.839] (-910.287) (-913.329) * (-911.891) (-910.693) [-912.955] (-914.284) -- 0:00:42
Average standard deviation of split frequencies: 0.010453
310500 -- (-913.564) (-913.422) [-912.715] (-912.787) * [-912.635] (-910.570) (-912.651) (-911.637) -- 0:00:42
311000 -- (-909.987) (-913.468) (-913.897) [-911.733] * [-910.910] (-913.528) (-910.046) (-912.179) -- 0:00:42
311500 -- (-911.825) [-912.398] (-914.579) (-912.163) * (-915.771) (-913.611) [-910.500] (-911.965) -- 0:00:41
312000 -- (-911.510) (-912.667) (-910.120) [-911.867] * [-912.340] (-913.427) (-911.507) (-911.584) -- 0:00:41
312500 -- (-911.503) (-913.816) [-910.352] (-910.939) * (-912.674) (-913.226) (-912.446) [-910.821] -- 0:00:41
313000 -- [-912.482] (-912.394) (-909.881) (-911.136) * (-912.163) (-912.413) (-911.468) [-911.339] -- 0:00:41
313500 -- (-913.748) (-914.971) [-911.198] (-915.848) * (-911.100) (-912.235) [-911.003] (-911.456) -- 0:00:41
314000 -- (-911.498) [-915.812] (-911.068) (-912.756) * (-910.465) (-914.286) [-911.061] (-916.234) -- 0:00:41
314500 -- (-910.648) (-913.760) [-911.488] (-914.512) * [-914.015] (-915.325) (-913.734) (-912.379) -- 0:00:41
315000 -- (-912.883) [-910.622] (-913.229) (-911.997) * (-913.813) (-910.927) (-911.446) [-910.597] -- 0:00:41
Average standard deviation of split frequencies: 0.011520
315500 -- (-912.213) (-910.700) [-913.975] (-911.057) * [-911.218] (-916.490) (-911.716) (-910.844) -- 0:00:41
316000 -- (-910.369) [-910.666] (-914.253) (-912.146) * (-910.886) (-912.304) [-911.509] (-910.633) -- 0:00:41
316500 -- (-910.352) [-910.224] (-913.661) (-914.604) * (-912.035) (-913.629) (-914.657) [-910.714] -- 0:00:41
317000 -- [-911.428] (-909.658) (-911.851) (-911.683) * [-910.364] (-910.070) (-915.564) (-910.241) -- 0:00:40
317500 -- (-913.130) [-911.199] (-910.959) (-913.794) * (-910.772) (-910.740) [-911.115] (-912.633) -- 0:00:40
318000 -- (-913.301) [-910.828] (-910.440) (-914.825) * (-912.546) (-910.788) [-909.840] (-911.440) -- 0:00:40
318500 -- (-911.608) [-912.770] (-911.750) (-914.333) * (-915.834) [-910.267] (-912.693) (-914.525) -- 0:00:40
319000 -- (-913.480) [-912.745] (-915.720) (-911.387) * (-911.263) (-911.681) [-909.834] (-911.717) -- 0:00:40
319500 -- (-911.785) [-913.010] (-911.304) (-911.751) * [-911.264] (-911.824) (-910.947) (-912.484) -- 0:00:40
320000 -- (-914.434) (-910.056) (-913.517) [-911.517] * (-910.647) [-911.910] (-910.753) (-911.310) -- 0:00:42
Average standard deviation of split frequencies: 0.009719
320500 -- (-910.994) (-910.112) (-911.559) [-910.433] * [-911.476] (-914.144) (-910.443) (-910.812) -- 0:00:42
321000 -- (-911.662) [-909.758] (-913.358) (-910.443) * (-911.845) (-913.085) [-913.566] (-911.308) -- 0:00:42
321500 -- (-912.785) [-909.899] (-911.422) (-913.385) * (-914.532) (-910.960) (-912.248) [-911.834] -- 0:00:42
322000 -- [-913.730] (-910.239) (-911.583) (-912.799) * (-912.611) (-912.096) (-913.195) [-911.434] -- 0:00:42
322500 -- (-912.007) [-911.303] (-911.455) (-912.703) * (-909.908) [-912.501] (-910.673) (-911.538) -- 0:00:42
323000 -- (-913.376) [-910.413] (-915.473) (-912.015) * (-910.470) [-910.813] (-913.491) (-914.336) -- 0:00:41
323500 -- (-909.986) (-911.724) [-914.772] (-913.379) * [-910.471] (-914.118) (-913.015) (-918.649) -- 0:00:41
324000 -- (-911.185) [-911.979] (-916.477) (-911.067) * [-910.938] (-912.237) (-913.453) (-913.115) -- 0:00:41
324500 -- [-910.031] (-910.319) (-913.238) (-912.684) * (-912.593) (-911.967) (-911.411) [-910.530] -- 0:00:41
325000 -- (-911.334) (-911.654) [-915.189] (-911.611) * [-915.445] (-914.330) (-912.112) (-913.793) -- 0:00:41
Average standard deviation of split frequencies: 0.009640
325500 -- [-911.409] (-912.198) (-917.237) (-911.617) * (-911.400) [-911.505] (-912.525) (-912.032) -- 0:00:41
326000 -- (-912.711) (-913.014) (-913.765) [-911.594] * [-912.824] (-912.331) (-911.516) (-912.119) -- 0:00:41
326500 -- (-909.596) (-913.373) [-912.693] (-914.556) * [-913.200] (-913.355) (-920.081) (-915.730) -- 0:00:41
327000 -- (-910.355) (-910.819) (-911.576) [-919.943] * (-912.373) [-912.969] (-916.541) (-910.923) -- 0:00:41
327500 -- (-916.066) (-910.485) (-913.330) [-911.832] * (-912.006) (-912.338) (-913.299) [-911.715] -- 0:00:41
328000 -- [-913.234] (-909.872) (-917.687) (-912.010) * [-913.631] (-910.255) (-912.372) (-911.293) -- 0:00:40
328500 -- [-912.093] (-911.009) (-912.507) (-910.869) * (-913.085) (-911.148) (-913.436) [-911.720] -- 0:00:40
329000 -- (-913.780) (-912.731) [-909.942] (-911.918) * (-910.632) (-910.235) [-911.850] (-911.774) -- 0:00:40
329500 -- [-911.687] (-910.846) (-913.365) (-913.393) * (-912.623) (-911.370) [-913.954] (-914.288) -- 0:00:40
330000 -- (-911.290) (-910.877) [-911.638] (-910.205) * (-914.054) [-911.521] (-911.215) (-912.638) -- 0:00:40
Average standard deviation of split frequencies: 0.010217
330500 -- (-909.962) (-910.113) (-916.455) [-910.191] * (-911.596) (-912.620) [-912.708] (-911.200) -- 0:00:40
331000 -- (-909.870) [-914.320] (-915.983) (-911.218) * (-911.188) (-912.985) [-914.469] (-915.574) -- 0:00:40
331500 -- [-911.672] (-914.106) (-912.423) (-911.769) * (-912.690) [-913.623] (-912.680) (-911.743) -- 0:00:40
332000 -- (-911.291) (-910.962) [-911.445] (-911.407) * (-910.557) [-910.536] (-911.554) (-910.367) -- 0:00:40
332500 -- (-911.959) (-914.037) [-917.837] (-914.686) * (-911.016) (-911.267) [-910.153] (-912.184) -- 0:00:40
333000 -- [-910.030] (-911.251) (-912.730) (-911.770) * (-911.217) [-910.974] (-915.931) (-911.621) -- 0:00:40
333500 -- [-911.661] (-915.057) (-912.486) (-912.218) * (-911.035) [-910.365] (-912.496) (-911.140) -- 0:00:39
334000 -- [-910.696] (-912.588) (-915.348) (-912.592) * (-910.187) (-910.906) [-910.881] (-910.928) -- 0:00:39
334500 -- (-910.844) (-912.024) (-913.227) [-912.175] * [-911.282] (-911.314) (-913.129) (-910.033) -- 0:00:39
335000 -- [-913.261] (-915.504) (-913.697) (-915.082) * [-915.581] (-913.972) (-910.030) (-911.434) -- 0:00:39
Average standard deviation of split frequencies: 0.009587
335500 -- [-912.240] (-914.106) (-912.234) (-915.029) * (-914.494) (-910.916) [-912.285] (-910.516) -- 0:00:39
336000 -- (-911.568) (-912.214) [-912.865] (-913.415) * (-911.036) [-911.956] (-910.050) (-909.970) -- 0:00:39
336500 -- (-911.012) [-911.198] (-913.433) (-910.582) * (-911.879) (-914.431) [-910.770] (-911.422) -- 0:00:41
337000 -- (-912.328) [-911.452] (-914.900) (-913.649) * (-914.482) [-910.452] (-911.429) (-911.080) -- 0:00:41
337500 -- (-910.465) (-913.145) (-912.475) [-917.716] * (-916.053) [-912.396] (-911.156) (-914.272) -- 0:00:41
338000 -- (-921.753) (-911.159) (-912.654) [-918.091] * (-911.647) [-912.069] (-910.807) (-911.952) -- 0:00:41
338500 -- (-915.865) (-910.332) (-909.847) [-913.549] * (-911.445) (-913.912) [-913.289] (-913.805) -- 0:00:41
339000 -- (-911.696) (-911.078) (-910.238) [-911.788] * [-913.953] (-915.308) (-913.103) (-910.613) -- 0:00:40
339500 -- (-910.658) [-910.287] (-912.940) (-911.603) * [-911.290] (-912.332) (-912.537) (-910.656) -- 0:00:40
340000 -- [-909.800] (-910.641) (-912.612) (-912.230) * [-912.071] (-913.862) (-912.765) (-912.179) -- 0:00:40
Average standard deviation of split frequencies: 0.010093
340500 -- (-912.318) (-909.960) [-913.241] (-910.276) * [-910.923] (-913.288) (-914.263) (-909.905) -- 0:00:40
341000 -- [-910.069] (-911.096) (-910.375) (-911.365) * (-911.678) (-911.648) [-910.598] (-913.699) -- 0:00:40
341500 -- (-911.888) (-910.764) [-912.677] (-911.343) * (-910.611) (-910.168) [-912.560] (-913.854) -- 0:00:40
342000 -- (-911.605) (-914.283) (-912.229) [-911.023] * (-911.144) (-910.629) (-912.243) [-912.378] -- 0:00:40
342500 -- [-911.552] (-911.909) (-912.528) (-910.371) * (-912.185) (-912.351) [-913.720] (-910.773) -- 0:00:40
343000 -- (-910.589) [-911.346] (-913.493) (-911.075) * (-911.768) (-910.020) [-912.088] (-910.409) -- 0:00:40
343500 -- (-912.639) [-913.763] (-911.900) (-910.763) * (-911.808) (-910.668) (-912.006) [-911.519] -- 0:00:40
344000 -- (-911.155) (-913.291) (-911.812) [-911.033] * [-911.886] (-915.865) (-910.552) (-911.325) -- 0:00:40
344500 -- (-909.614) (-914.425) (-913.659) [-912.222] * (-914.577) (-913.779) (-910.933) [-911.104] -- 0:00:39
345000 -- (-909.614) (-914.386) (-916.736) [-909.793] * [-911.045] (-913.832) (-912.562) (-922.315) -- 0:00:39
Average standard deviation of split frequencies: 0.009938
345500 -- (-912.580) [-913.312] (-910.909) (-910.014) * [-911.626] (-915.757) (-920.422) (-913.318) -- 0:00:39
346000 -- [-913.360] (-915.287) (-913.298) (-909.780) * [-911.859] (-911.792) (-912.949) (-910.758) -- 0:00:39
346500 -- (-910.614) [-913.407] (-913.880) (-912.544) * (-913.700) [-911.718] (-914.127) (-913.418) -- 0:00:39
347000 -- [-911.342] (-917.712) (-915.117) (-912.749) * [-913.734] (-910.776) (-910.898) (-912.638) -- 0:00:39
347500 -- (-913.105) (-912.859) [-911.035] (-910.610) * (-911.880) (-910.826) [-910.962] (-910.811) -- 0:00:39
348000 -- [-913.197] (-916.056) (-911.158) (-914.273) * (-911.557) (-913.290) [-910.679] (-911.929) -- 0:00:39
348500 -- (-913.680) [-913.147] (-911.109) (-914.092) * [-911.195] (-914.198) (-911.581) (-911.634) -- 0:00:39
349000 -- (-911.341) [-913.044] (-912.963) (-910.464) * [-914.232] (-910.249) (-911.293) (-913.134) -- 0:00:39
349500 -- [-910.739] (-912.445) (-911.765) (-912.260) * [-912.432] (-911.916) (-914.477) (-910.529) -- 0:00:39
350000 -- (-915.136) [-910.840] (-911.544) (-912.646) * (-915.276) [-910.719] (-912.339) (-913.017) -- 0:00:39
Average standard deviation of split frequencies: 0.009410
350500 -- (-912.022) (-910.766) (-910.478) [-911.962] * (-911.516) [-913.766] (-910.654) (-910.533) -- 0:00:38
351000 -- (-911.287) (-910.779) [-910.892] (-918.210) * [-912.845] (-912.273) (-911.607) (-914.487) -- 0:00:38
351500 -- (-914.798) [-912.744] (-911.436) (-914.506) * [-913.403] (-913.442) (-913.141) (-910.553) -- 0:00:38
352000 -- [-913.600] (-911.854) (-912.925) (-911.733) * (-919.296) (-911.306) [-913.300] (-911.072) -- 0:00:38
352500 -- (-910.683) [-916.698] (-913.281) (-912.983) * (-912.233) (-914.727) [-912.329] (-916.821) -- 0:00:40
353000 -- (-912.843) (-911.548) [-910.544] (-909.919) * (-910.008) [-910.806] (-913.946) (-913.971) -- 0:00:40
353500 -- [-911.730] (-911.813) (-912.794) (-913.735) * [-910.465] (-911.778) (-911.430) (-915.983) -- 0:00:40
354000 -- (-917.393) (-912.817) (-912.894) [-912.861] * [-910.510] (-917.083) (-914.657) (-913.641) -- 0:00:40
354500 -- (-911.763) [-912.621] (-913.746) (-911.130) * (-910.021) (-911.226) (-910.320) [-913.111] -- 0:00:40
355000 -- (-912.523) (-913.379) [-910.814] (-911.353) * (-912.113) [-912.127] (-912.368) (-913.825) -- 0:00:39
Average standard deviation of split frequencies: 0.009581
355500 -- [-912.509] (-913.903) (-913.155) (-912.389) * (-911.442) (-913.512) [-915.447] (-916.978) -- 0:00:39
356000 -- [-912.622] (-914.223) (-910.663) (-913.439) * [-910.711] (-911.244) (-912.177) (-911.386) -- 0:00:39
356500 -- (-909.828) (-913.890) [-912.350] (-911.942) * [-911.193] (-911.184) (-910.502) (-911.190) -- 0:00:39
357000 -- (-910.410) (-911.764) (-912.543) [-911.213] * (-910.950) (-911.158) (-914.179) [-912.747] -- 0:00:39
357500 -- [-909.943] (-911.948) (-917.479) (-911.413) * (-911.632) (-913.388) (-913.002) [-914.427] -- 0:00:39
358000 -- (-910.685) [-912.640] (-911.877) (-910.965) * (-912.948) (-912.913) (-911.036) [-913.104] -- 0:00:39
358500 -- (-911.523) (-910.253) [-910.894] (-912.164) * (-910.543) (-915.554) [-911.099] (-913.038) -- 0:00:39
359000 -- (-910.507) (-920.104) (-911.981) [-910.290] * [-911.547] (-910.354) (-910.539) (-912.349) -- 0:00:39
359500 -- [-913.947] (-912.031) (-912.271) (-914.138) * (-911.839) (-911.619) (-910.607) [-912.210] -- 0:00:39
360000 -- (-911.980) (-914.605) (-911.260) [-913.638] * (-909.856) (-918.429) (-911.022) [-913.095] -- 0:00:39
Average standard deviation of split frequencies: 0.010379
360500 -- (-909.745) [-911.632] (-911.658) (-912.683) * [-910.675] (-915.038) (-913.357) (-914.137) -- 0:00:39
361000 -- (-911.274) [-913.937] (-911.605) (-911.055) * (-911.421) (-911.090) (-912.853) [-910.368] -- 0:00:38
361500 -- (-912.491) (-912.017) (-911.965) [-912.306] * (-910.335) [-911.160] (-912.579) (-912.081) -- 0:00:38
362000 -- (-913.428) [-911.237] (-910.443) (-909.668) * (-911.186) (-912.248) (-914.684) [-910.382] -- 0:00:38
362500 -- [-910.793] (-912.044) (-914.290) (-910.757) * (-912.269) [-910.187] (-910.046) (-910.842) -- 0:00:38
363000 -- [-910.364] (-913.547) (-911.810) (-912.903) * (-911.491) (-911.007) (-918.340) [-911.828] -- 0:00:38
363500 -- [-911.199] (-910.616) (-914.591) (-911.611) * [-912.178] (-910.007) (-912.410) (-910.565) -- 0:00:38
364000 -- [-910.220] (-910.535) (-912.412) (-910.150) * (-912.378) (-912.061) (-912.756) [-910.784] -- 0:00:38
364500 -- (-910.394) (-911.418) [-910.989] (-909.936) * (-912.872) (-912.811) (-913.284) [-910.700] -- 0:00:38
365000 -- (-910.051) [-911.296] (-912.763) (-910.685) * [-911.354] (-913.920) (-911.870) (-915.464) -- 0:00:38
Average standard deviation of split frequencies: 0.011137
365500 -- [-913.784] (-911.936) (-913.658) (-914.064) * (-911.165) [-911.202] (-911.737) (-914.944) -- 0:00:38
366000 -- (-909.984) (-911.372) (-915.831) [-911.669] * (-913.441) [-911.804] (-912.559) (-910.906) -- 0:00:38
366500 -- (-912.515) (-914.038) (-911.846) [-912.776] * [-910.223] (-911.613) (-911.915) (-911.356) -- 0:00:38
367000 -- (-913.341) (-916.015) (-913.363) [-911.567] * (-910.874) [-911.664] (-912.571) (-915.237) -- 0:00:37
367500 -- (-911.098) (-913.225) (-910.501) [-911.380] * (-912.693) [-912.021] (-912.317) (-913.104) -- 0:00:37
368000 -- (-911.861) (-915.123) (-912.953) [-912.895] * [-912.153] (-912.341) (-911.740) (-912.680) -- 0:00:37
368500 -- (-913.824) (-912.826) [-913.854] (-910.287) * [-911.999] (-911.947) (-910.616) (-910.800) -- 0:00:37
369000 -- [-913.750] (-912.019) (-915.571) (-913.922) * (-911.267) (-911.153) [-913.851] (-914.978) -- 0:00:39
369500 -- [-911.294] (-910.200) (-910.953) (-909.952) * [-913.230] (-914.355) (-911.500) (-913.233) -- 0:00:39
370000 -- (-913.493) (-911.202) [-911.149] (-910.662) * [-914.824] (-912.910) (-910.557) (-910.584) -- 0:00:39
Average standard deviation of split frequencies: 0.010810
370500 -- (-914.114) [-910.772] (-911.287) (-910.123) * (-914.812) (-910.522) (-911.513) [-910.881] -- 0:00:39
371000 -- (-914.146) (-912.027) (-910.134) [-909.893] * [-910.209] (-910.911) (-912.449) (-912.224) -- 0:00:38
371500 -- (-914.615) (-912.712) [-909.826] (-910.780) * (-911.516) (-911.347) [-911.792] (-911.339) -- 0:00:38
372000 -- [-912.213] (-914.106) (-912.751) (-911.337) * (-913.353) (-912.194) (-912.779) [-913.641] -- 0:00:38
372500 -- (-910.716) (-913.848) (-910.346) [-910.213] * [-912.549] (-912.972) (-912.298) (-912.896) -- 0:00:38
373000 -- [-912.752] (-920.262) (-910.362) (-911.266) * [-911.619] (-914.804) (-914.183) (-911.569) -- 0:00:38
373500 -- (-912.998) [-912.693] (-911.569) (-912.118) * (-913.023) (-914.386) [-912.768] (-911.313) -- 0:00:38
374000 -- (-915.465) (-912.772) [-916.198] (-913.494) * (-911.912) (-910.507) (-913.794) [-910.847] -- 0:00:38
374500 -- (-913.493) [-910.685] (-910.360) (-913.312) * (-911.717) (-910.034) [-922.904] (-914.281) -- 0:00:38
375000 -- (-911.407) [-911.576] (-910.512) (-912.489) * [-911.902] (-910.698) (-916.375) (-913.847) -- 0:00:38
Average standard deviation of split frequencies: 0.010500
375500 -- [-911.054] (-913.767) (-912.262) (-912.166) * [-911.553] (-911.572) (-914.321) (-911.689) -- 0:00:38
376000 -- [-910.279] (-912.539) (-912.893) (-913.253) * [-911.582] (-913.430) (-911.615) (-911.228) -- 0:00:38
376500 -- (-912.150) (-912.238) (-910.120) [-919.902] * (-911.664) [-910.533] (-911.161) (-911.576) -- 0:00:38
377000 -- (-912.333) [-913.214] (-910.049) (-909.954) * (-913.686) [-912.003] (-912.084) (-914.607) -- 0:00:38
377500 -- (-910.914) [-909.727] (-913.069) (-911.238) * (-914.169) [-910.712] (-910.644) (-913.609) -- 0:00:37
378000 -- [-911.965] (-911.600) (-912.288) (-911.692) * (-913.453) [-910.669] (-911.832) (-912.954) -- 0:00:37
378500 -- [-911.306] (-912.954) (-912.658) (-916.518) * (-913.974) (-910.953) [-913.669] (-911.600) -- 0:00:37
379000 -- [-909.815] (-911.796) (-911.782) (-912.513) * (-914.626) (-911.641) [-913.168] (-911.717) -- 0:00:37
379500 -- [-909.683] (-909.684) (-914.012) (-913.822) * (-915.272) (-911.923) (-913.427) [-910.894] -- 0:00:37
380000 -- (-913.500) (-909.680) [-915.522] (-912.786) * [-915.363] (-911.754) (-912.823) (-917.137) -- 0:00:37
Average standard deviation of split frequencies: 0.009752
380500 -- (-912.777) [-910.435] (-913.230) (-918.622) * (-912.771) (-910.666) [-912.149] (-916.165) -- 0:00:37
381000 -- (-912.380) (-910.957) (-911.734) [-910.875] * (-911.289) (-910.790) [-911.548] (-913.453) -- 0:00:37
381500 -- (-910.357) (-911.161) (-910.228) [-910.442] * (-910.442) (-911.721) [-910.965] (-912.806) -- 0:00:37
382000 -- (-912.976) [-910.173] (-915.244) (-910.868) * (-911.190) (-912.699) (-914.335) [-913.893] -- 0:00:37
382500 -- (-915.098) (-910.317) [-910.017] (-910.481) * (-912.794) (-911.693) [-909.858] (-913.417) -- 0:00:37
383000 -- (-911.433) [-912.318] (-911.996) (-912.104) * (-914.985) (-911.116) [-910.816] (-911.961) -- 0:00:37
383500 -- [-912.686] (-911.301) (-915.577) (-910.628) * (-911.354) (-910.973) [-910.652] (-913.560) -- 0:00:36
384000 -- (-912.742) [-910.902] (-912.208) (-911.107) * (-916.982) (-911.074) [-910.972] (-914.005) -- 0:00:36
384500 -- [-912.165] (-912.598) (-913.776) (-911.394) * [-913.574] (-920.162) (-911.299) (-910.034) -- 0:00:36
385000 -- (-910.622) (-913.551) (-910.660) [-910.219] * (-911.952) (-912.740) (-911.950) [-910.594] -- 0:00:36
Average standard deviation of split frequencies: 0.009914
385500 -- (-911.218) (-913.092) (-912.107) [-914.164] * [-911.606] (-914.278) (-911.414) (-910.852) -- 0:00:38
386000 -- [-915.323] (-911.625) (-910.373) (-911.190) * (-912.878) (-911.146) [-913.724] (-915.319) -- 0:00:38
386500 -- (-911.711) (-913.925) (-911.747) [-916.775] * (-914.943) (-911.226) (-910.646) [-915.293] -- 0:00:38
387000 -- (-911.985) (-910.976) (-913.890) [-910.568] * (-917.535) (-911.159) (-910.988) [-912.289] -- 0:00:38
387500 -- (-911.722) (-913.686) [-913.131] (-911.574) * (-912.266) (-912.115) [-910.467] (-909.912) -- 0:00:37
388000 -- (-910.144) (-916.511) [-910.764] (-911.824) * (-912.735) (-913.317) [-911.117] (-912.320) -- 0:00:37
388500 -- (-911.632) (-910.457) [-910.853] (-916.842) * (-918.264) (-916.003) (-912.595) [-911.559] -- 0:00:37
389000 -- [-911.528] (-909.976) (-912.051) (-915.150) * (-912.152) (-916.457) [-913.853] (-912.165) -- 0:00:37
389500 -- (-912.519) (-915.615) [-912.596] (-915.230) * [-914.404] (-909.984) (-914.978) (-912.099) -- 0:00:37
390000 -- [-911.645] (-916.076) (-914.418) (-917.798) * (-911.806) (-911.016) [-911.378] (-916.632) -- 0:00:37
Average standard deviation of split frequencies: 0.009015
390500 -- [-913.526] (-911.200) (-912.396) (-910.960) * (-911.013) (-914.870) (-911.525) [-918.185] -- 0:00:37
391000 -- [-913.314] (-911.148) (-913.576) (-914.619) * [-912.141] (-911.221) (-911.814) (-913.424) -- 0:00:37
391500 -- [-910.302] (-911.973) (-911.485) (-914.700) * [-912.347] (-911.940) (-911.642) (-913.078) -- 0:00:37
392000 -- (-910.673) (-911.416) (-911.078) [-910.924] * (-916.306) [-912.635] (-911.552) (-910.649) -- 0:00:37
392500 -- (-912.973) (-911.169) [-909.894] (-914.421) * (-911.759) (-911.089) [-913.183] (-916.616) -- 0:00:37
393000 -- (-911.290) (-914.284) [-911.080] (-916.864) * (-913.751) (-911.313) (-912.084) [-913.731] -- 0:00:37
393500 -- (-910.575) (-911.610) [-910.559] (-916.079) * (-911.239) (-911.495) (-912.459) [-910.706] -- 0:00:36
394000 -- [-910.552] (-911.389) (-913.744) (-911.097) * [-910.179] (-910.842) (-913.582) (-911.301) -- 0:00:36
394500 -- [-911.002] (-910.694) (-913.326) (-914.812) * [-912.536] (-910.815) (-911.335) (-912.987) -- 0:00:36
395000 -- (-911.693) (-913.285) (-911.337) [-911.846] * (-910.983) [-910.729] (-909.774) (-913.511) -- 0:00:36
Average standard deviation of split frequencies: 0.009243
395500 -- (-914.003) (-910.474) [-911.163] (-914.326) * (-911.580) (-913.946) (-912.214) [-910.475] -- 0:00:36
396000 -- (-915.829) [-912.313] (-912.354) (-910.865) * (-914.521) (-915.277) (-912.468) [-912.732] -- 0:00:36
396500 -- (-911.762) (-914.655) [-910.425] (-912.955) * (-913.671) [-911.216] (-913.671) (-913.313) -- 0:00:36
397000 -- (-910.243) [-911.799] (-911.477) (-912.309) * (-917.131) (-913.609) [-912.845] (-915.838) -- 0:00:36
397500 -- [-910.807] (-912.073) (-911.069) (-910.315) * (-911.712) (-910.984) [-913.144] (-909.738) -- 0:00:36
398000 -- [-911.121] (-916.103) (-912.856) (-911.339) * (-910.468) [-911.294] (-914.252) (-910.072) -- 0:00:36
398500 -- (-910.989) (-912.998) [-910.252] (-910.659) * [-910.976] (-911.573) (-914.106) (-910.379) -- 0:00:36
399000 -- (-909.996) (-910.065) (-909.611) [-910.287] * (-911.408) (-915.557) (-913.012) [-912.239] -- 0:00:36
399500 -- (-913.597) [-911.202] (-909.595) (-910.326) * (-911.056) (-917.012) (-915.000) [-910.849] -- 0:00:36
400000 -- (-916.791) (-911.927) (-910.106) [-910.579] * [-912.964] (-918.140) (-912.020) (-913.006) -- 0:00:36
Average standard deviation of split frequencies: 0.009620
400500 -- (-913.206) (-911.526) [-911.174] (-910.274) * [-910.173] (-915.400) (-913.330) (-912.455) -- 0:00:35
401000 -- (-910.481) (-910.215) [-912.094] (-910.274) * [-912.994] (-910.851) (-925.771) (-911.911) -- 0:00:35
401500 -- (-913.014) (-912.031) [-910.253] (-913.059) * (-912.672) [-912.856] (-913.020) (-911.856) -- 0:00:37
402000 -- (-913.107) (-912.076) [-911.402] (-911.791) * (-917.310) (-912.963) [-912.847] (-913.008) -- 0:00:37
402500 -- [-912.346] (-910.560) (-912.516) (-912.086) * (-919.451) (-917.493) (-910.054) [-911.386] -- 0:00:37
403000 -- (-910.216) [-913.722] (-910.203) (-915.645) * [-911.024] (-912.503) (-911.099) (-911.058) -- 0:00:37
403500 -- (-911.010) (-910.439) [-910.353] (-910.200) * (-913.479) [-913.374] (-912.395) (-911.031) -- 0:00:36
404000 -- (-911.472) [-911.034] (-912.637) (-911.538) * (-913.254) (-911.526) (-914.808) [-910.097] -- 0:00:36
404500 -- [-910.798] (-910.868) (-912.279) (-910.073) * (-911.485) (-910.763) (-915.081) [-911.674] -- 0:00:36
405000 -- (-910.993) (-910.754) (-911.183) [-914.904] * (-912.417) [-914.065] (-916.185) (-911.720) -- 0:00:36
Average standard deviation of split frequencies: 0.009835
405500 -- (-912.151) [-910.611] (-911.666) (-911.730) * (-910.341) [-911.371] (-914.030) (-911.910) -- 0:00:36
406000 -- (-914.628) (-911.179) [-912.325] (-910.873) * [-912.307] (-911.555) (-910.897) (-912.493) -- 0:00:36
406500 -- (-914.849) [-913.078] (-912.341) (-910.970) * (-915.154) (-911.818) (-915.639) [-911.955] -- 0:00:36
407000 -- [-913.448] (-912.732) (-911.311) (-911.728) * (-909.712) [-911.100] (-914.516) (-913.008) -- 0:00:36
407500 -- [-910.320] (-914.368) (-911.136) (-911.540) * (-910.358) (-910.518) (-912.237) [-914.483] -- 0:00:36
408000 -- (-910.290) (-910.796) (-913.656) [-911.111] * (-909.809) [-911.027] (-914.228) (-912.464) -- 0:00:36
408500 -- (-912.338) (-911.097) [-912.773] (-911.087) * (-909.743) (-914.771) (-912.045) [-916.022] -- 0:00:36
409000 -- [-910.909] (-912.504) (-912.059) (-912.901) * [-910.594] (-913.020) (-913.363) (-911.710) -- 0:00:36
409500 -- (-912.635) [-912.270] (-911.239) (-912.415) * (-913.470) [-911.956] (-915.359) (-912.206) -- 0:00:36
410000 -- (-913.004) (-917.444) [-910.875] (-914.026) * [-910.628] (-911.799) (-913.538) (-911.973) -- 0:00:35
Average standard deviation of split frequencies: 0.009723
410500 -- (-910.166) (-913.041) (-912.121) [-912.403] * (-913.386) [-912.233] (-913.597) (-911.894) -- 0:00:35
411000 -- [-912.187] (-910.918) (-910.753) (-912.017) * (-913.022) [-912.232] (-911.537) (-912.301) -- 0:00:35
411500 -- (-911.962) (-911.421) [-910.635] (-913.192) * (-914.718) [-912.266] (-911.822) (-915.759) -- 0:00:35
412000 -- (-912.973) (-913.864) (-911.965) [-910.747] * (-914.669) [-911.677] (-914.515) (-913.429) -- 0:00:35
412500 -- (-911.466) (-914.343) [-914.945] (-913.611) * (-913.672) (-913.459) [-915.768] (-911.824) -- 0:00:35
413000 -- (-911.256) (-915.428) (-913.191) [-915.173] * (-912.442) (-912.461) (-910.567) [-910.612] -- 0:00:35
413500 -- [-910.919] (-915.272) (-911.639) (-914.561) * (-911.071) [-913.953] (-911.543) (-911.877) -- 0:00:35
414000 -- [-911.069] (-910.980) (-911.436) (-914.318) * [-912.070] (-912.632) (-913.908) (-911.387) -- 0:00:35
414500 -- [-912.305] (-910.122) (-911.680) (-911.735) * (-913.265) (-913.564) [-911.909] (-910.991) -- 0:00:35
415000 -- [-912.306] (-911.575) (-911.320) (-910.997) * (-910.587) [-918.604] (-913.151) (-912.178) -- 0:00:35
Average standard deviation of split frequencies: 0.009732
415500 -- (-911.608) [-912.831] (-910.505) (-911.171) * (-911.107) (-918.208) [-911.044] (-910.915) -- 0:00:35
416000 -- (-912.664) (-910.707) (-913.564) [-911.140] * (-913.218) (-913.201) (-913.308) [-910.788] -- 0:00:35
416500 -- (-911.268) [-911.481] (-910.450) (-911.647) * (-911.708) (-911.482) [-910.014] (-912.933) -- 0:00:35
417000 -- (-910.655) (-913.597) (-912.142) [-910.677] * (-912.439) (-914.514) [-909.938] (-914.599) -- 0:00:34
417500 -- (-910.310) (-912.409) (-912.133) [-910.723] * (-911.776) [-912.618] (-910.917) (-913.866) -- 0:00:34
418000 -- [-911.236] (-916.225) (-911.643) (-912.728) * (-911.081) (-912.422) (-910.734) [-910.108] -- 0:00:36
418500 -- (-912.155) (-912.355) (-910.329) [-910.625] * (-913.227) (-912.361) (-913.473) [-911.404] -- 0:00:36
419000 -- (-911.729) (-914.167) [-912.523] (-915.831) * (-912.514) (-913.787) [-912.272] (-912.746) -- 0:00:36
419500 -- (-912.609) (-914.853) [-911.055] (-910.539) * (-912.053) (-909.616) [-912.669] (-912.707) -- 0:00:35
420000 -- (-910.959) [-910.545] (-910.935) (-910.116) * (-917.976) (-910.881) [-913.254] (-912.707) -- 0:00:35
Average standard deviation of split frequencies: 0.010217
420500 -- (-914.496) (-913.319) (-910.284) [-912.317] * (-914.470) (-913.918) [-912.996] (-910.510) -- 0:00:35
421000 -- (-914.251) (-909.680) [-910.380] (-910.618) * (-911.181) (-914.957) [-914.168] (-912.607) -- 0:00:35
421500 -- (-912.289) [-909.933] (-911.758) (-913.224) * (-911.005) (-912.970) (-910.076) [-911.653] -- 0:00:35
422000 -- (-910.721) (-911.770) [-912.799] (-911.995) * (-913.547) [-912.212] (-911.518) (-915.505) -- 0:00:35
422500 -- (-910.552) (-913.816) [-909.915] (-910.394) * (-915.713) (-913.490) (-911.506) [-911.038] -- 0:00:35
423000 -- [-910.469] (-911.211) (-912.718) (-914.701) * [-911.264] (-911.557) (-912.726) (-911.067) -- 0:00:35
423500 -- (-914.567) (-911.805) (-914.250) [-912.349] * (-910.647) (-912.128) [-913.413] (-912.840) -- 0:00:35
424000 -- (-912.420) (-914.518) [-911.245] (-911.906) * (-911.910) (-911.770) [-910.128] (-910.314) -- 0:00:35
424500 -- (-916.299) (-921.102) [-910.545] (-912.180) * [-912.197] (-911.557) (-913.915) (-913.244) -- 0:00:35
425000 -- (-911.924) [-910.682] (-912.136) (-911.813) * (-912.785) (-911.506) [-912.801] (-913.174) -- 0:00:35
Average standard deviation of split frequencies: 0.010220
425500 -- [-911.613] (-910.907) (-913.001) (-910.497) * (-911.835) [-910.647] (-910.913) (-911.039) -- 0:00:35
426000 -- [-913.155] (-913.219) (-913.796) (-916.790) * (-912.095) [-910.346] (-915.211) (-910.603) -- 0:00:35
426500 -- (-911.500) (-914.435) [-910.102] (-915.020) * (-912.115) (-913.745) [-912.197] (-911.319) -- 0:00:34
427000 -- (-911.410) [-910.676] (-912.924) (-912.765) * (-914.014) (-911.971) [-911.842] (-912.049) -- 0:00:34
427500 -- [-911.008] (-914.335) (-910.706) (-911.701) * [-913.704] (-913.392) (-911.402) (-911.419) -- 0:00:34
428000 -- (-911.510) [-912.359] (-915.320) (-913.901) * (-912.990) (-914.796) [-911.616] (-912.159) -- 0:00:34
428500 -- [-909.942] (-911.093) (-911.721) (-911.951) * (-910.354) (-913.836) [-910.235] (-911.771) -- 0:00:34
429000 -- (-911.090) (-909.980) [-910.460] (-911.386) * (-913.515) (-916.721) (-911.274) [-914.955] -- 0:00:34
429500 -- (-911.886) (-913.061) (-911.213) [-911.690] * (-911.682) [-911.935] (-914.274) (-912.936) -- 0:00:34
430000 -- (-912.047) (-911.317) [-910.786] (-913.791) * (-912.784) [-912.133] (-912.112) (-911.839) -- 0:00:34
Average standard deviation of split frequencies: 0.010560
430500 -- [-912.508] (-914.092) (-910.900) (-912.342) * [-911.695] (-911.476) (-912.265) (-912.556) -- 0:00:34
431000 -- (-917.132) (-913.466) [-910.093] (-912.429) * (-911.780) (-911.399) (-911.738) [-913.824] -- 0:00:34
431500 -- (-913.585) (-911.039) [-911.133] (-912.075) * (-911.099) [-910.264] (-910.813) (-911.351) -- 0:00:34
432000 -- (-919.044) (-913.035) (-912.534) [-912.005] * (-912.271) (-912.472) (-911.113) [-911.034] -- 0:00:34
432500 -- (-916.923) (-910.941) (-914.907) [-911.119] * [-915.375] (-911.832) (-911.471) (-914.445) -- 0:00:34
433000 -- (-912.999) (-910.700) [-911.075] (-910.806) * (-913.505) (-915.067) [-911.303] (-910.676) -- 0:00:34
433500 -- (-912.474) [-912.662] (-910.837) (-910.872) * (-911.510) [-911.075] (-912.283) (-912.843) -- 0:00:33
434000 -- (-911.990) (-911.837) [-910.972] (-911.105) * [-913.745] (-913.480) (-912.360) (-910.370) -- 0:00:33
434500 -- (-914.823) [-912.652] (-910.320) (-912.904) * (-910.296) [-912.203] (-909.649) (-912.067) -- 0:00:35
435000 -- (-911.015) (-919.323) (-909.988) [-912.933] * (-910.934) [-911.473] (-911.359) (-912.435) -- 0:00:35
Average standard deviation of split frequencies: 0.010407
435500 -- (-910.999) (-913.601) [-910.958] (-911.031) * (-913.381) [-911.728] (-912.404) (-910.889) -- 0:00:34
436000 -- [-910.745] (-912.411) (-910.727) (-911.376) * [-910.154] (-910.002) (-913.056) (-910.838) -- 0:00:34
436500 -- (-910.677) (-912.229) [-911.752] (-910.140) * (-912.224) (-909.859) [-914.279] (-911.617) -- 0:00:34
437000 -- (-912.742) (-912.728) [-911.167] (-910.898) * (-910.834) [-909.843] (-912.935) (-911.519) -- 0:00:34
437500 -- (-914.291) [-910.392] (-911.884) (-915.369) * [-910.301] (-910.591) (-914.036) (-911.411) -- 0:00:34
438000 -- (-916.908) (-912.700) [-913.078] (-910.893) * (-910.856) (-911.331) (-910.590) [-912.706] -- 0:00:34
438500 -- (-911.252) (-910.443) [-912.103] (-914.446) * (-910.608) (-911.533) (-913.662) [-910.585] -- 0:00:34
439000 -- (-916.946) [-913.664] (-911.148) (-912.950) * (-911.181) [-912.641] (-909.660) (-910.523) -- 0:00:34
439500 -- (-911.065) [-914.043] (-912.829) (-911.420) * (-909.864) [-911.329] (-909.658) (-913.369) -- 0:00:34
440000 -- (-910.264) (-911.618) (-911.026) [-913.470] * [-911.887] (-913.453) (-910.945) (-912.284) -- 0:00:34
Average standard deviation of split frequencies: 0.010497
440500 -- [-910.819] (-914.218) (-910.070) (-915.102) * (-914.803) (-917.352) [-912.976] (-912.222) -- 0:00:34
441000 -- [-911.611] (-914.389) (-910.039) (-914.699) * (-912.905) [-916.058] (-913.972) (-916.476) -- 0:00:34
441500 -- [-911.859] (-915.434) (-913.984) (-911.979) * (-911.589) [-910.046] (-911.805) (-912.534) -- 0:00:34
442000 -- (-910.848) [-912.419] (-911.072) (-911.147) * (-910.455) (-910.165) [-910.786] (-910.323) -- 0:00:34
442500 -- (-913.370) [-912.791] (-910.886) (-911.449) * (-916.277) (-912.368) (-910.459) [-910.960] -- 0:00:34
443000 -- [-912.016] (-911.167) (-913.138) (-910.334) * (-911.913) (-911.942) (-911.853) [-912.495] -- 0:00:33
443500 -- [-910.340] (-912.131) (-910.538) (-910.200) * (-911.525) (-911.973) [-911.360] (-913.218) -- 0:00:33
444000 -- [-910.530] (-911.931) (-910.610) (-910.019) * (-914.575) (-912.025) (-911.690) [-913.622] -- 0:00:33
444500 -- [-910.471] (-912.251) (-912.578) (-911.234) * (-915.122) (-911.760) [-911.827] (-911.959) -- 0:00:33
445000 -- (-912.413) (-911.902) [-911.789] (-910.258) * [-912.876] (-922.357) (-911.839) (-911.256) -- 0:00:33
Average standard deviation of split frequencies: 0.010507
445500 -- (-910.939) [-910.855] (-912.496) (-911.646) * [-911.763] (-910.622) (-911.043) (-911.471) -- 0:00:33
446000 -- (-910.661) (-909.904) (-913.129) [-911.468] * (-912.651) [-912.797] (-911.014) (-911.831) -- 0:00:33
446500 -- (-915.101) (-912.124) [-915.854] (-911.537) * (-910.618) [-910.931] (-911.098) (-911.736) -- 0:00:33
447000 -- (-912.937) [-913.422] (-912.784) (-911.425) * [-912.036] (-910.243) (-913.433) (-911.671) -- 0:00:33
447500 -- [-912.995] (-910.022) (-913.528) (-911.854) * (-916.427) [-911.684] (-911.886) (-910.701) -- 0:00:33
448000 -- [-917.368] (-914.034) (-911.175) (-911.487) * (-911.779) [-911.576] (-911.437) (-921.418) -- 0:00:33
448500 -- (-914.884) (-910.029) [-911.043] (-910.801) * (-911.129) [-909.643] (-913.789) (-910.619) -- 0:00:33
449000 -- (-913.807) (-909.602) (-910.253) [-910.097] * (-911.059) (-910.836) [-912.120] (-910.283) -- 0:00:33
449500 -- [-912.146] (-911.139) (-912.583) (-910.129) * (-913.262) [-912.534] (-913.258) (-910.679) -- 0:00:33
450000 -- (-910.992) [-912.828] (-911.338) (-910.130) * [-913.700] (-911.716) (-911.827) (-914.234) -- 0:00:33
Average standard deviation of split frequencies: 0.009906
450500 -- [-911.187] (-911.695) (-910.480) (-909.924) * (-915.767) [-910.987] (-910.649) (-910.575) -- 0:00:32
451000 -- (-910.520) (-912.635) (-911.155) [-910.543] * (-912.481) [-910.902] (-910.618) (-911.047) -- 0:00:34
451500 -- (-913.021) (-912.309) [-911.418] (-910.292) * (-911.782) (-910.957) [-913.508] (-911.447) -- 0:00:34
452000 -- (-911.837) [-914.150] (-917.923) (-910.216) * (-910.596) (-911.159) [-910.702] (-912.365) -- 0:00:33
452500 -- (-910.443) (-910.747) [-911.836] (-912.297) * (-910.209) (-909.931) (-913.582) [-912.590] -- 0:00:33
453000 -- (-910.617) [-910.472] (-913.968) (-915.897) * (-910.610) (-912.990) (-911.313) [-910.523] -- 0:00:33
453500 -- (-909.684) (-913.191) [-911.182] (-912.463) * (-911.127) [-909.646] (-910.978) (-912.533) -- 0:00:33
454000 -- (-911.112) (-910.693) (-909.781) [-910.357] * (-910.914) [-910.233] (-912.809) (-914.191) -- 0:00:33
454500 -- (-910.740) (-910.242) [-912.060] (-914.985) * (-917.758) (-909.754) (-914.035) [-912.789] -- 0:00:33
455000 -- (-914.311) (-911.541) (-910.479) [-910.985] * [-917.886] (-912.852) (-914.101) (-914.672) -- 0:00:33
Average standard deviation of split frequencies: 0.009304
455500 -- [-911.746] (-911.268) (-910.586) (-914.914) * [-910.084] (-909.773) (-912.288) (-913.410) -- 0:00:33
456000 -- (-911.992) (-911.593) [-917.342] (-914.009) * (-911.598) (-910.894) [-912.593] (-913.856) -- 0:00:33
456500 -- (-910.930) [-911.825] (-912.461) (-913.027) * [-910.641] (-911.313) (-911.330) (-913.839) -- 0:00:33
457000 -- (-910.819) (-916.992) (-920.061) [-911.283] * (-912.376) (-910.376) [-911.942] (-919.171) -- 0:00:33
457500 -- (-913.583) [-917.991] (-910.551) (-910.253) * [-910.752] (-911.350) (-913.015) (-914.013) -- 0:00:33
458000 -- (-914.587) (-917.350) [-913.172] (-909.587) * (-912.189) (-910.475) [-910.692] (-911.382) -- 0:00:33
458500 -- (-910.300) (-911.346) [-911.847] (-910.026) * (-910.428) (-911.633) [-910.613] (-910.954) -- 0:00:33
459000 -- [-911.229] (-912.905) (-910.638) (-911.372) * (-911.024) [-910.094] (-913.805) (-910.595) -- 0:00:33
459500 -- (-910.393) (-912.138) (-915.414) [-912.545] * (-915.716) [-913.616] (-911.848) (-911.068) -- 0:00:32
460000 -- [-910.070] (-915.432) (-912.860) (-910.515) * (-911.432) (-913.786) [-911.455] (-913.023) -- 0:00:32
Average standard deviation of split frequencies: 0.009270
460500 -- (-911.446) (-912.842) (-913.824) [-912.126] * [-911.778] (-911.300) (-913.002) (-913.819) -- 0:00:32
461000 -- [-911.095] (-913.635) (-912.207) (-913.061) * (-911.264) [-909.848] (-912.104) (-910.030) -- 0:00:32
461500 -- (-913.233) (-913.353) [-911.220] (-916.185) * (-913.113) (-910.785) [-910.672] (-912.604) -- 0:00:32
462000 -- (-913.922) [-911.641] (-910.492) (-914.592) * [-913.831] (-912.028) (-913.072) (-910.495) -- 0:00:32
462500 -- (-910.515) (-910.510) [-910.561] (-915.496) * [-912.866] (-912.327) (-914.267) (-910.687) -- 0:00:32
463000 -- (-910.091) [-910.473] (-912.100) (-915.306) * (-915.350) (-916.499) (-912.139) [-912.888] -- 0:00:32
463500 -- [-909.908] (-910.823) (-910.021) (-916.194) * [-910.612] (-913.598) (-917.054) (-916.023) -- 0:00:32
464000 -- [-910.102] (-910.362) (-910.702) (-912.025) * [-910.023] (-912.634) (-914.637) (-911.123) -- 0:00:32
464500 -- [-910.226] (-917.889) (-912.393) (-912.427) * (-909.746) (-910.452) (-914.388) [-910.326] -- 0:00:32
465000 -- [-912.170] (-917.282) (-912.512) (-912.146) * (-911.935) (-912.499) [-913.016] (-910.468) -- 0:00:32
Average standard deviation of split frequencies: 0.009461
465500 -- [-911.023] (-911.348) (-911.832) (-911.339) * (-911.720) [-910.237] (-912.238) (-910.223) -- 0:00:32
466000 -- (-910.210) (-910.780) (-914.981) [-911.352] * (-913.214) (-909.911) [-911.595] (-913.182) -- 0:00:32
466500 -- (-912.211) [-913.659] (-913.533) (-912.853) * [-916.605] (-911.418) (-911.598) (-911.606) -- 0:00:32
467000 -- [-910.940] (-915.955) (-915.240) (-911.079) * (-910.030) (-915.606) [-912.280] (-911.543) -- 0:00:31
467500 -- (-910.806) (-913.850) (-914.770) [-910.851] * [-910.282] (-912.866) (-911.008) (-913.259) -- 0:00:33
468000 -- (-918.596) (-912.222) [-910.496] (-912.305) * [-911.080] (-913.638) (-912.919) (-914.536) -- 0:00:32
468500 -- [-916.296] (-913.977) (-915.732) (-916.203) * (-912.570) (-913.085) [-911.514] (-912.236) -- 0:00:32
469000 -- (-912.433) (-912.003) (-911.234) [-912.196] * (-911.864) (-911.035) [-912.298] (-913.297) -- 0:00:32
469500 -- [-910.913] (-919.202) (-912.671) (-910.545) * (-911.866) (-911.933) (-909.994) [-915.897] -- 0:00:32
470000 -- (-911.185) [-910.192] (-913.433) (-911.945) * [-910.743] (-912.045) (-911.903) (-910.795) -- 0:00:32
Average standard deviation of split frequencies: 0.008764
470500 -- (-910.401) [-910.652] (-912.317) (-911.801) * (-910.553) (-911.828) [-912.593] (-911.103) -- 0:00:32
471000 -- (-911.617) (-912.887) [-912.487] (-911.687) * (-912.793) (-911.808) [-910.626] (-910.673) -- 0:00:32
471500 -- (-910.144) (-911.352) [-910.067] (-911.074) * (-911.348) [-913.411] (-911.226) (-910.592) -- 0:00:32
472000 -- (-910.506) (-910.162) [-909.924] (-910.401) * [-910.570] (-910.132) (-913.325) (-911.619) -- 0:00:32
472500 -- (-910.445) [-909.778] (-912.822) (-913.448) * (-913.852) [-910.462] (-910.350) (-913.450) -- 0:00:32
473000 -- [-910.863] (-910.239) (-910.277) (-911.706) * (-912.580) (-910.093) [-910.927] (-912.364) -- 0:00:32
473500 -- (-910.393) (-910.502) [-912.650] (-912.690) * (-912.367) (-911.655) (-910.732) [-910.561] -- 0:00:32
474000 -- [-913.759] (-914.141) (-914.826) (-911.522) * (-915.294) (-910.980) (-913.710) [-913.526] -- 0:00:32
474500 -- (-915.373) [-911.820] (-911.502) (-911.704) * (-912.776) (-911.455) (-912.045) [-913.793] -- 0:00:32
475000 -- (-915.034) [-912.410] (-910.542) (-915.836) * (-910.479) (-913.162) [-912.813] (-911.630) -- 0:00:32
Average standard deviation of split frequencies: 0.008564
475500 -- (-912.792) [-911.167] (-910.553) (-911.137) * (-911.753) (-910.183) [-913.300] (-912.425) -- 0:00:31
476000 -- (-910.764) (-910.307) (-911.606) [-911.600] * [-910.751] (-910.306) (-914.010) (-911.654) -- 0:00:31
476500 -- (-910.504) (-916.702) (-911.933) [-911.116] * [-911.430] (-912.549) (-911.500) (-910.517) -- 0:00:31
477000 -- (-912.080) (-912.586) [-911.838] (-911.600) * (-910.810) [-911.264] (-913.753) (-913.197) -- 0:00:31
477500 -- (-914.593) (-910.186) (-911.271) [-912.105] * [-912.074] (-910.773) (-912.880) (-913.123) -- 0:00:31
478000 -- (-914.253) (-911.035) (-916.731) [-912.169] * (-910.575) (-909.870) [-912.235] (-915.278) -- 0:00:31
478500 -- (-910.898) (-911.983) (-911.229) [-910.066] * (-915.341) [-911.786] (-911.229) (-911.992) -- 0:00:31
479000 -- (-912.339) [-911.779] (-911.438) (-909.763) * (-910.781) (-912.479) (-913.437) [-912.139] -- 0:00:31
479500 -- (-913.026) (-910.599) (-912.177) [-912.678] * (-910.389) [-910.948] (-912.701) (-917.055) -- 0:00:31
480000 -- (-912.010) [-915.709] (-911.807) (-910.883) * (-909.968) (-915.195) (-911.017) [-912.591] -- 0:00:31
Average standard deviation of split frequencies: 0.008459
480500 -- [-915.126] (-912.676) (-911.900) (-912.587) * (-911.471) (-917.269) (-911.763) [-911.273] -- 0:00:31
481000 -- [-912.594] (-911.532) (-915.007) (-910.569) * (-911.248) (-913.968) (-913.387) [-910.307] -- 0:00:31
481500 -- (-914.782) (-912.055) (-913.593) [-910.446] * (-912.263) (-912.867) (-912.946) [-913.125] -- 0:00:31
482000 -- (-911.279) (-913.315) [-912.126] (-910.821) * (-910.180) (-912.948) (-917.077) [-913.444] -- 0:00:31
482500 -- (-911.238) (-913.833) (-910.920) [-910.753] * [-911.220] (-910.271) (-912.262) (-912.150) -- 0:00:31
483000 -- (-912.886) (-916.168) (-910.803) [-910.920] * (-912.940) (-910.351) (-910.581) [-910.848] -- 0:00:31
483500 -- (-911.080) (-913.647) [-910.302] (-914.809) * [-912.157] (-910.701) (-910.185) (-913.169) -- 0:00:30
484000 -- (-912.369) (-913.669) [-912.157] (-912.836) * (-909.730) [-911.604] (-912.754) (-914.480) -- 0:00:31
484500 -- (-911.185) (-912.540) [-911.500] (-915.044) * (-909.888) [-912.176] (-917.853) (-914.384) -- 0:00:31
485000 -- (-910.771) (-911.151) [-912.402] (-913.564) * (-910.113) (-913.839) (-911.911) [-912.632] -- 0:00:31
Average standard deviation of split frequencies: 0.008460
485500 -- (-913.471) (-913.508) [-912.234] (-913.922) * [-910.161] (-913.561) (-911.177) (-912.163) -- 0:00:31
486000 -- [-911.923] (-913.457) (-911.992) (-911.201) * (-914.055) (-912.696) (-911.881) [-914.172] -- 0:00:31
486500 -- (-917.827) (-913.067) (-910.044) [-913.147] * (-909.571) (-913.173) [-912.222] (-913.734) -- 0:00:31
487000 -- (-912.793) (-912.204) [-910.248] (-912.618) * (-912.079) [-911.626] (-913.055) (-916.022) -- 0:00:31
487500 -- (-916.137) (-912.079) (-910.691) [-910.323] * (-915.559) (-910.383) [-914.442] (-910.458) -- 0:00:31
488000 -- (-914.070) (-912.649) [-911.291] (-914.280) * (-916.750) [-913.092] (-910.717) (-910.490) -- 0:00:31
488500 -- (-912.761) (-910.048) [-910.989] (-913.248) * [-912.280] (-910.269) (-915.250) (-917.853) -- 0:00:31
489000 -- (-911.696) [-911.468] (-915.573) (-913.208) * [-914.156] (-909.844) (-911.871) (-920.630) -- 0:00:31
489500 -- (-913.689) [-911.604] (-916.239) (-910.996) * (-911.663) (-915.107) [-910.855] (-915.921) -- 0:00:31
490000 -- (-911.394) (-913.895) [-911.035] (-910.213) * (-911.748) (-914.333) [-911.484] (-914.244) -- 0:00:31
Average standard deviation of split frequencies: 0.008967
490500 -- (-912.143) (-916.384) [-910.794] (-912.762) * (-912.702) (-911.774) (-912.159) [-911.951] -- 0:00:31
491000 -- [-911.230] (-916.814) (-910.383) (-916.556) * (-911.579) (-912.685) [-912.895] (-913.163) -- 0:00:31
491500 -- [-911.481] (-911.074) (-911.224) (-910.316) * (-911.927) [-912.503] (-912.526) (-913.036) -- 0:00:31
492000 -- (-912.556) (-913.101) (-911.825) [-910.879] * (-912.202) (-912.115) (-910.470) [-912.944] -- 0:00:30
492500 -- [-912.217] (-913.163) (-911.842) (-910.709) * (-915.801) [-911.657] (-912.624) (-912.050) -- 0:00:30
493000 -- (-910.397) [-912.405] (-911.835) (-911.089) * (-913.774) (-911.902) (-911.574) [-910.957] -- 0:00:30
493500 -- (-912.008) (-911.243) [-909.930] (-911.840) * (-911.876) (-914.484) [-912.032] (-913.754) -- 0:00:30
494000 -- (-913.870) (-911.780) (-911.028) [-911.040] * (-911.711) [-911.029] (-914.880) (-911.246) -- 0:00:30
494500 -- (-912.839) (-912.648) [-910.607] (-912.920) * (-911.571) (-910.479) (-916.615) [-910.645] -- 0:00:30
495000 -- [-914.643] (-915.132) (-909.892) (-910.930) * (-911.321) (-909.729) (-911.071) [-911.246] -- 0:00:30
Average standard deviation of split frequencies: 0.008554
495500 -- [-909.991] (-914.619) (-910.805) (-910.753) * [-912.416] (-913.373) (-914.684) (-917.671) -- 0:00:30
496000 -- (-910.027) (-912.626) [-909.974] (-911.799) * (-914.723) (-911.676) (-911.184) [-913.655] -- 0:00:30
496500 -- [-911.216] (-915.243) (-913.525) (-912.716) * (-914.963) [-909.619] (-915.039) (-909.781) -- 0:00:30
497000 -- (-910.928) [-911.643] (-912.392) (-913.054) * [-913.156] (-909.619) (-911.378) (-909.896) -- 0:00:30
497500 -- (-911.648) (-911.056) (-913.499) [-912.275] * (-910.300) (-911.097) (-911.634) [-912.193] -- 0:00:30
498000 -- (-913.943) (-910.631) (-910.423) [-911.345] * (-912.326) (-910.018) [-912.436] (-912.440) -- 0:00:30
498500 -- [-910.338] (-912.163) (-912.886) (-920.740) * (-911.095) (-910.495) (-914.484) [-913.296] -- 0:00:30
499000 -- (-910.103) [-910.835] (-911.505) (-913.817) * [-911.136] (-913.619) (-914.996) (-913.811) -- 0:00:30
499500 -- (-912.728) [-910.377] (-911.812) (-910.472) * [-911.067] (-913.349) (-914.277) (-911.856) -- 0:00:30
500000 -- [-911.489] (-916.023) (-910.071) (-910.790) * (-911.737) (-914.349) (-911.924) [-911.470] -- 0:00:30
Average standard deviation of split frequencies: 0.008197
500500 -- (-912.941) [-913.317] (-909.740) (-913.303) * [-911.224] (-913.409) (-913.497) (-910.005) -- 0:00:30
501000 -- (-911.709) [-912.913] (-910.462) (-910.890) * [-913.416] (-914.662) (-910.620) (-910.605) -- 0:00:30
501500 -- [-912.395] (-914.740) (-911.784) (-911.216) * (-910.338) (-910.797) (-913.624) [-909.829] -- 0:00:30
502000 -- (-910.828) [-912.428] (-912.027) (-913.268) * (-910.920) (-914.291) [-913.423] (-910.433) -- 0:00:30
502500 -- [-912.641] (-912.173) (-910.882) (-911.137) * [-911.355] (-911.320) (-911.784) (-910.767) -- 0:00:30
503000 -- [-912.089] (-917.893) (-911.463) (-912.968) * (-910.455) (-912.162) (-910.226) [-912.638] -- 0:00:30
503500 -- (-911.134) (-912.567) (-911.746) [-912.667] * (-911.284) (-912.664) [-911.580] (-910.342) -- 0:00:30
504000 -- (-913.566) (-911.544) [-911.320] (-910.538) * [-910.743] (-918.292) (-915.139) (-912.272) -- 0:00:30
504500 -- (-913.806) (-913.755) [-911.143] (-910.815) * (-915.839) (-919.820) [-911.828] (-911.129) -- 0:00:30
505000 -- (-912.577) (-913.580) [-914.123] (-911.352) * [-910.949] (-915.241) (-917.796) (-913.425) -- 0:00:30
Average standard deviation of split frequencies: 0.008604
505500 -- [-915.161] (-910.880) (-909.921) (-910.416) * (-913.846) (-912.072) (-920.176) [-914.950] -- 0:00:30
506000 -- (-912.484) [-911.351] (-912.256) (-910.135) * (-914.951) (-912.381) [-914.143] (-910.971) -- 0:00:30
506500 -- [-913.648] (-914.104) (-918.527) (-912.659) * (-911.554) [-914.446] (-911.997) (-912.987) -- 0:00:30
507000 -- (-911.100) [-910.336] (-915.344) (-913.293) * (-912.759) (-911.475) [-912.654] (-912.288) -- 0:00:30
507500 -- [-912.232] (-911.564) (-915.026) (-912.036) * (-915.866) (-911.613) [-911.147] (-910.862) -- 0:00:30
508000 -- (-911.619) [-911.593] (-914.294) (-910.839) * (-913.897) (-911.204) [-912.732] (-913.247) -- 0:00:30
508500 -- (-911.439) [-912.931] (-915.398) (-912.206) * (-912.146) (-912.244) [-910.509] (-910.888) -- 0:00:29
509000 -- (-912.425) (-911.111) (-913.328) [-910.953] * [-911.983] (-910.166) (-917.324) (-912.374) -- 0:00:29
509500 -- (-910.372) (-911.317) (-913.491) [-911.081] * (-910.218) (-909.762) [-912.320] (-913.157) -- 0:00:29
510000 -- (-910.372) [-912.389] (-913.272) (-911.324) * (-912.449) (-914.725) (-915.311) [-912.129] -- 0:00:29
Average standard deviation of split frequencies: 0.008634
510500 -- (-911.041) (-911.170) (-911.260) [-911.029] * (-913.210) (-920.642) (-914.578) [-910.769] -- 0:00:29
511000 -- (-911.687) (-911.282) (-911.595) [-910.354] * (-915.204) [-912.056] (-914.095) (-911.171) -- 0:00:29
511500 -- (-912.467) (-910.618) [-910.453] (-910.848) * (-917.862) (-910.659) [-913.978] (-913.324) -- 0:00:29
512000 -- [-912.871] (-911.865) (-910.587) (-911.512) * [-915.273] (-911.932) (-911.433) (-910.217) -- 0:00:29
512500 -- (-910.562) [-910.343] (-910.155) (-912.945) * (-913.129) (-911.424) (-914.165) [-911.831] -- 0:00:29
513000 -- [-913.373] (-909.547) (-909.919) (-912.614) * (-910.966) (-911.979) (-913.630) [-911.910] -- 0:00:29
513500 -- (-910.293) (-909.823) (-910.454) [-912.664] * (-910.069) (-912.201) (-911.729) [-912.388] -- 0:00:29
514000 -- [-910.085] (-910.478) (-910.697) (-909.896) * (-910.281) [-911.726] (-911.975) (-909.830) -- 0:00:29
514500 -- [-912.010] (-912.942) (-909.990) (-910.696) * (-913.968) (-913.034) [-910.787] (-910.966) -- 0:00:29
515000 -- (-913.986) [-911.464] (-910.365) (-912.486) * (-914.302) (-912.592) (-911.780) [-911.392] -- 0:00:29
Average standard deviation of split frequencies: 0.008222
515500 -- [-911.804] (-912.141) (-913.656) (-912.740) * [-911.668] (-911.434) (-911.129) (-913.104) -- 0:00:29
516000 -- (-911.432) [-910.384] (-914.087) (-911.107) * (-918.552) (-911.521) (-911.327) [-911.944] -- 0:00:29
516500 -- (-910.589) [-910.425] (-913.493) (-912.574) * (-912.134) [-912.386] (-913.946) (-913.765) -- 0:00:29
517000 -- (-911.525) [-911.823] (-912.251) (-916.838) * (-911.224) (-915.674) (-912.860) [-914.155] -- 0:00:29
517500 -- (-913.548) (-912.494) (-911.585) [-915.266] * (-910.492) [-915.124] (-910.725) (-912.451) -- 0:00:29
518000 -- (-911.765) (-911.360) [-913.542] (-916.138) * (-912.922) (-911.462) (-911.160) [-911.378] -- 0:00:29
518500 -- [-912.612] (-911.800) (-912.135) (-912.043) * (-912.065) (-910.272) (-919.077) [-910.094] -- 0:00:29
519000 -- (-910.372) (-913.590) [-912.909] (-911.779) * (-910.792) (-915.038) (-914.022) [-912.860] -- 0:00:29
519500 -- (-915.644) (-911.843) [-913.217] (-912.121) * (-911.190) (-916.427) (-910.953) [-912.254] -- 0:00:29
520000 -- (-914.664) [-913.208] (-915.207) (-913.926) * (-913.894) (-913.442) [-912.861] (-915.006) -- 0:00:29
Average standard deviation of split frequencies: 0.008828
520500 -- (-910.349) (-912.057) [-914.924] (-913.190) * (-913.913) [-912.576] (-910.686) (-912.991) -- 0:00:29
521000 -- (-910.172) [-914.291] (-911.585) (-912.705) * (-912.041) [-910.256] (-916.763) (-910.728) -- 0:00:29
521500 -- (-912.469) (-910.725) [-912.193] (-911.506) * [-912.268] (-909.713) (-915.922) (-912.771) -- 0:00:29
522000 -- (-913.129) (-910.583) (-912.123) [-910.529] * (-913.397) (-913.609) [-910.084] (-910.224) -- 0:00:29
522500 -- [-912.085] (-911.045) (-911.866) (-911.831) * (-913.926) (-912.535) [-912.093] (-913.705) -- 0:00:29
523000 -- (-910.917) (-912.242) [-912.534] (-912.401) * [-911.732] (-913.433) (-910.629) (-911.201) -- 0:00:29
523500 -- (-915.612) [-914.568] (-913.983) (-916.541) * (-910.967) (-918.288) [-911.687] (-910.715) -- 0:00:29
524000 -- (-911.780) (-910.309) [-911.260] (-912.278) * [-913.070] (-913.017) (-911.329) (-909.967) -- 0:00:29
524500 -- (-912.595) [-910.002] (-911.797) (-911.171) * (-912.485) (-912.442) [-911.157] (-910.034) -- 0:00:29
525000 -- (-910.602) [-911.091] (-913.962) (-910.248) * [-911.500] (-911.775) (-912.673) (-910.164) -- 0:00:28
Average standard deviation of split frequencies: 0.008698
525500 -- [-910.445] (-912.188) (-914.400) (-911.087) * (-911.830) [-910.826] (-911.872) (-910.856) -- 0:00:28
526000 -- (-911.685) (-912.185) (-911.502) [-910.982] * (-912.935) [-910.807] (-910.353) (-909.499) -- 0:00:28
526500 -- (-914.228) (-911.642) (-913.388) [-910.267] * [-911.321] (-911.404) (-910.382) (-912.455) -- 0:00:28
527000 -- (-914.695) (-915.886) [-913.312] (-910.520) * (-911.378) [-912.740] (-915.742) (-910.180) -- 0:00:28
527500 -- (-911.598) (-912.340) [-910.454] (-914.327) * [-911.143] (-912.651) (-912.351) (-912.935) -- 0:00:28
528000 -- (-913.378) [-910.933] (-911.714) (-911.539) * [-912.308] (-912.784) (-913.848) (-911.773) -- 0:00:28
528500 -- [-912.512] (-911.077) (-910.520) (-910.986) * [-910.672] (-913.750) (-913.195) (-910.433) -- 0:00:28
529000 -- (-912.843) (-911.553) (-917.647) [-911.240] * (-913.529) (-914.749) [-914.929] (-911.987) -- 0:00:28
529500 -- (-915.805) (-913.929) (-914.223) [-912.618] * (-912.997) [-913.120] (-916.085) (-914.554) -- 0:00:28
530000 -- [-913.280] (-911.602) (-910.345) (-910.261) * (-913.531) [-911.736] (-913.449) (-912.056) -- 0:00:28
Average standard deviation of split frequencies: 0.008828
530500 -- (-911.731) [-912.270] (-911.810) (-911.333) * (-913.453) (-911.813) [-912.410] (-913.795) -- 0:00:28
531000 -- (-910.907) [-912.270] (-910.905) (-911.268) * (-910.888) (-913.125) (-911.781) [-913.984] -- 0:00:28
531500 -- (-910.904) (-910.458) [-910.845] (-913.422) * (-913.396) (-911.829) [-917.864] (-912.995) -- 0:00:28
532000 -- [-913.925] (-910.149) (-910.336) (-910.530) * (-911.504) (-913.121) (-913.278) [-910.709] -- 0:00:28
532500 -- [-911.229] (-917.215) (-909.905) (-910.530) * (-911.976) (-911.554) (-911.372) [-913.141] -- 0:00:28
533000 -- [-912.145] (-912.212) (-911.037) (-913.118) * (-911.966) (-913.687) (-910.712) [-912.072] -- 0:00:28
533500 -- (-910.461) (-919.264) [-911.079] (-911.458) * [-911.546] (-912.938) (-911.832) (-913.945) -- 0:00:28
534000 -- (-911.482) (-913.032) [-913.681] (-912.770) * (-910.225) (-912.223) (-910.736) [-911.496] -- 0:00:28
534500 -- (-910.353) (-912.734) (-910.695) [-910.922] * (-912.073) (-910.188) (-912.553) [-909.871] -- 0:00:28
535000 -- (-911.614) (-912.860) [-911.554] (-914.331) * (-911.932) (-911.125) (-911.980) [-909.729] -- 0:00:28
Average standard deviation of split frequencies: 0.008740
535500 -- (-911.435) (-911.829) [-911.528] (-916.016) * (-914.305) [-911.788] (-911.901) (-913.089) -- 0:00:28
536000 -- (-912.016) [-910.977] (-911.457) (-916.527) * (-912.029) (-913.967) [-910.160] (-913.606) -- 0:00:28
536500 -- (-914.129) [-910.957] (-911.525) (-911.210) * [-914.753] (-915.485) (-910.285) (-910.518) -- 0:00:28
537000 -- [-911.403] (-910.317) (-913.248) (-913.414) * (-910.942) (-910.519) (-914.762) [-910.689] -- 0:00:28
537500 -- (-911.099) [-913.831] (-910.440) (-911.751) * (-910.454) [-911.514] (-910.073) (-910.145) -- 0:00:28
538000 -- [-911.989] (-915.714) (-909.894) (-911.172) * (-912.440) (-911.846) [-910.777] (-910.352) -- 0:00:28
538500 -- (-915.249) (-912.368) [-910.000] (-910.893) * [-915.391] (-911.400) (-914.696) (-910.278) -- 0:00:28
539000 -- (-913.266) (-911.103) (-910.246) [-909.707] * (-912.471) [-912.269] (-912.644) (-911.309) -- 0:00:28
539500 -- (-911.937) (-909.876) (-909.700) [-912.621] * (-912.401) (-914.182) [-910.999] (-911.604) -- 0:00:28
540000 -- (-913.076) [-909.813] (-910.530) (-912.186) * (-912.830) (-911.896) [-910.247] (-911.905) -- 0:00:28
Average standard deviation of split frequencies: 0.009155
540500 -- [-912.805] (-911.305) (-910.353) (-911.708) * (-909.816) (-912.378) [-911.411] (-913.716) -- 0:00:28
541000 -- (-911.127) [-909.916] (-917.745) (-910.667) * (-910.459) [-912.835] (-911.749) (-915.225) -- 0:00:27
541500 -- [-910.767] (-910.598) (-910.713) (-910.315) * [-909.925] (-916.887) (-914.018) (-911.670) -- 0:00:27
542000 -- (-911.802) (-912.000) [-911.356] (-914.385) * (-910.072) [-911.825] (-912.723) (-909.566) -- 0:00:27
542500 -- [-912.554] (-911.496) (-912.053) (-913.324) * [-911.518] (-912.345) (-913.329) (-909.668) -- 0:00:27
543000 -- (-911.791) [-916.856] (-910.718) (-914.230) * (-913.951) [-911.288] (-913.325) (-911.301) -- 0:00:27
543500 -- (-910.373) (-916.998) (-912.547) [-913.248] * (-910.312) (-910.883) [-911.428] (-910.419) -- 0:00:27
544000 -- (-911.297) [-911.444] (-917.146) (-915.699) * [-910.602] (-911.344) (-912.201) (-910.109) -- 0:00:27
544500 -- (-913.813) (-911.935) [-915.537] (-913.019) * (-911.847) (-910.367) (-914.458) [-913.108] -- 0:00:27
545000 -- (-912.068) [-912.172] (-914.340) (-913.462) * (-910.986) (-909.852) [-914.278] (-912.417) -- 0:00:27
Average standard deviation of split frequencies: 0.008735
545500 -- [-912.565] (-910.595) (-916.821) (-915.346) * (-910.086) (-910.632) (-910.869) [-910.628] -- 0:00:27
546000 -- [-911.690] (-911.660) (-912.346) (-912.269) * (-910.477) (-912.755) (-913.014) [-910.575] -- 0:00:27
546500 -- (-913.370) [-911.471] (-910.625) (-910.828) * [-910.562] (-909.876) (-913.117) (-915.552) -- 0:00:27
547000 -- (-912.453) (-911.367) (-910.510) [-912.676] * [-911.967] (-913.577) (-912.741) (-911.184) -- 0:00:27
547500 -- (-914.622) (-911.634) [-912.521] (-915.506) * (-913.223) (-913.473) (-916.548) [-911.628] -- 0:00:27
548000 -- (-910.779) [-913.860] (-913.682) (-911.678) * (-910.565) (-910.283) [-912.528] (-912.705) -- 0:00:27
548500 -- [-912.038] (-912.919) (-912.878) (-913.745) * (-911.204) (-910.813) (-911.996) [-913.753] -- 0:00:27
549000 -- (-912.175) (-917.437) [-913.164] (-912.600) * (-912.059) (-911.718) [-912.864] (-914.703) -- 0:00:27
549500 -- [-911.949] (-918.672) (-921.799) (-912.019) * (-910.343) [-911.138] (-910.437) (-912.095) -- 0:00:27
550000 -- [-912.343] (-914.590) (-915.835) (-911.277) * (-910.576) (-910.618) (-915.219) [-912.556] -- 0:00:27
Average standard deviation of split frequencies: 0.009115
550500 -- (-912.356) (-916.571) [-910.724] (-911.879) * (-915.817) (-910.792) (-917.278) [-912.018] -- 0:00:27
551000 -- (-913.010) (-911.490) (-911.793) [-913.543] * [-910.956] (-912.711) (-915.494) (-915.734) -- 0:00:27
551500 -- (-912.807) [-910.299] (-912.314) (-911.164) * [-911.806] (-912.832) (-916.657) (-912.471) -- 0:00:27
552000 -- (-913.191) (-911.312) [-914.402] (-913.019) * (-912.198) (-914.485) [-916.003] (-913.164) -- 0:00:27
552500 -- (-912.214) (-910.530) (-910.678) [-912.568] * (-918.335) [-911.144] (-911.435) (-911.950) -- 0:00:27
553000 -- (-912.970) (-911.442) [-913.832] (-916.455) * [-915.415] (-910.581) (-913.239) (-911.337) -- 0:00:27
553500 -- (-909.912) (-915.726) [-917.734] (-915.027) * (-912.237) (-910.676) (-910.947) [-912.549] -- 0:00:27
554000 -- (-913.166) (-911.899) (-914.550) [-911.137] * (-911.201) [-911.513] (-912.124) (-912.547) -- 0:00:27
554500 -- (-910.303) [-911.554] (-913.963) (-913.986) * (-911.912) [-910.343] (-913.031) (-911.740) -- 0:00:27
555000 -- (-910.907) (-911.638) (-911.517) [-911.230] * (-910.389) (-913.544) [-912.528] (-912.625) -- 0:00:27
Average standard deviation of split frequencies: 0.009379
555500 -- (-912.834) (-911.251) [-911.232] (-917.036) * [-912.724] (-911.477) (-914.196) (-916.362) -- 0:00:27
556000 -- (-911.967) (-913.716) (-913.591) [-915.678] * (-911.812) [-911.883] (-911.268) (-909.961) -- 0:00:27
556500 -- (-910.534) [-912.019] (-913.987) (-910.997) * (-918.589) (-911.097) (-914.183) [-909.885] -- 0:00:27
557000 -- (-915.419) [-910.920] (-910.843) (-911.485) * (-915.259) (-911.195) [-910.999] (-910.497) -- 0:00:27
557500 -- (-914.818) (-911.488) [-911.008] (-914.458) * (-914.662) (-910.859) [-910.712] (-911.448) -- 0:00:26
558000 -- (-914.473) (-913.191) [-912.913] (-912.033) * (-913.478) [-911.540] (-915.172) (-913.726) -- 0:00:26
558500 -- (-911.634) (-910.766) [-910.263] (-912.298) * (-911.925) (-910.892) [-911.413] (-912.124) -- 0:00:26
559000 -- [-911.017] (-912.107) (-915.234) (-915.065) * (-913.368) (-910.619) (-912.790) [-911.271] -- 0:00:26
559500 -- [-911.222] (-912.048) (-917.291) (-911.821) * (-916.216) (-910.613) [-911.514] (-910.570) -- 0:00:26
560000 -- (-911.000) (-914.822) (-911.554) [-914.855] * (-912.473) (-911.088) [-912.518] (-911.498) -- 0:00:26
Average standard deviation of split frequencies: 0.009039
560500 -- (-911.081) (-912.016) [-910.627] (-912.008) * [-912.825] (-911.029) (-912.638) (-911.047) -- 0:00:26
561000 -- (-910.810) (-915.421) (-913.321) [-911.517] * (-911.525) (-911.032) (-912.767) [-911.134] -- 0:00:26
561500 -- (-915.121) (-916.740) (-912.206) [-913.675] * (-911.995) (-915.490) (-914.003) [-911.325] -- 0:00:26
562000 -- (-912.410) (-914.822) [-911.716] (-922.176) * (-914.029) (-912.967) (-912.559) [-912.761] -- 0:00:26
562500 -- (-914.466) [-911.668] (-911.120) (-913.648) * [-913.173] (-912.428) (-914.197) (-912.177) -- 0:00:26
563000 -- [-911.722] (-913.307) (-913.537) (-914.352) * (-915.007) [-912.817] (-910.823) (-910.776) -- 0:00:26
563500 -- [-910.989] (-910.335) (-910.945) (-912.850) * (-915.846) (-912.775) [-915.083] (-915.212) -- 0:00:26
564000 -- (-910.774) (-911.922) (-911.890) [-912.529] * (-911.567) [-910.986] (-913.392) (-914.128) -- 0:00:26
564500 -- (-910.427) (-911.284) (-910.691) [-915.380] * [-912.782] (-910.395) (-911.802) (-912.039) -- 0:00:26
565000 -- [-911.023] (-912.138) (-914.620) (-915.684) * (-913.218) (-913.428) (-911.573) [-912.700] -- 0:00:26
Average standard deviation of split frequencies: 0.008797
565500 -- (-911.036) (-912.950) [-910.468] (-911.789) * (-913.059) (-911.819) (-910.346) [-913.741] -- 0:00:26
566000 -- (-912.064) [-910.690] (-911.381) (-912.303) * (-914.641) (-911.946) (-910.274) [-912.318] -- 0:00:26
566500 -- (-912.681) (-913.658) [-911.310] (-915.589) * (-911.631) (-912.684) [-910.398] (-911.966) -- 0:00:26
567000 -- [-914.370] (-912.164) (-911.563) (-910.509) * (-910.070) (-916.650) (-910.117) [-911.874] -- 0:00:26
567500 -- [-912.693] (-910.802) (-910.713) (-912.266) * (-909.711) (-916.292) (-910.542) [-910.677] -- 0:00:26
568000 -- [-914.636] (-911.475) (-910.731) (-913.235) * (-909.938) [-912.641] (-911.405) (-910.617) -- 0:00:26
568500 -- (-910.830) [-911.996] (-912.908) (-912.884) * (-912.303) (-911.888) (-911.448) [-910.234] -- 0:00:26
569000 -- (-911.784) (-912.390) (-912.178) [-910.053] * (-911.934) (-910.923) [-913.249] (-912.419) -- 0:00:26
569500 -- [-910.730] (-912.352) (-910.681) (-910.000) * (-912.530) (-913.370) [-911.403] (-910.858) -- 0:00:26
570000 -- [-910.374] (-911.215) (-910.622) (-911.454) * [-915.259] (-912.868) (-913.648) (-911.658) -- 0:00:26
Average standard deviation of split frequencies: 0.008519
570500 -- (-910.819) (-911.849) (-911.877) [-910.456] * (-914.041) (-913.004) (-909.698) [-913.428] -- 0:00:26
571000 -- (-911.051) [-911.213] (-910.831) (-911.875) * (-916.255) (-913.359) (-913.788) [-911.856] -- 0:00:26
571500 -- (-910.542) [-911.966] (-913.596) (-913.829) * (-911.114) (-911.774) (-918.276) [-911.039] -- 0:00:26
572000 -- (-910.118) (-911.189) [-912.343] (-910.168) * (-912.763) (-911.024) [-912.349] (-912.067) -- 0:00:26
572500 -- (-912.297) [-910.234] (-915.657) (-910.723) * (-911.993) (-911.766) (-912.905) [-911.895] -- 0:00:26
573000 -- [-910.833] (-910.723) (-911.665) (-913.547) * (-911.873) [-911.202] (-912.404) (-912.812) -- 0:00:26
573500 -- [-910.128] (-912.314) (-911.696) (-912.541) * (-911.950) [-911.984] (-913.282) (-911.860) -- 0:00:26
574000 -- (-910.326) (-910.224) [-911.048] (-910.159) * (-913.916) (-912.509) [-911.023] (-910.835) -- 0:00:25
574500 -- [-912.240] (-912.356) (-911.226) (-913.421) * (-912.898) (-912.664) (-913.252) [-911.999] -- 0:00:25
575000 -- [-913.607] (-912.196) (-916.255) (-912.045) * (-912.987) (-914.758) [-912.334] (-910.166) -- 0:00:25
Average standard deviation of split frequencies: 0.008521
575500 -- (-911.735) [-911.941] (-913.948) (-914.401) * (-910.833) [-910.989] (-914.099) (-910.938) -- 0:00:25
576000 -- (-912.543) [-911.245] (-911.404) (-910.846) * (-910.737) (-913.043) [-911.094] (-913.008) -- 0:00:25
576500 -- [-910.481] (-913.009) (-915.286) (-910.696) * (-912.909) [-911.476] (-912.807) (-910.410) -- 0:00:25
577000 -- (-914.248) (-912.686) (-911.177) [-912.000] * (-912.742) (-911.357) [-912.872] (-911.451) -- 0:00:25
577500 -- (-912.753) (-913.090) (-911.104) [-912.067] * (-916.478) [-911.185] (-912.427) (-912.354) -- 0:00:25
578000 -- (-910.474) (-911.432) [-912.037] (-911.540) * (-914.457) (-911.611) [-913.999] (-911.595) -- 0:00:25
578500 -- (-915.435) (-913.581) (-912.464) [-911.656] * (-914.030) (-913.469) [-912.211] (-911.304) -- 0:00:25
579000 -- (-910.332) [-911.649] (-915.832) (-911.730) * (-915.036) (-910.386) [-913.633] (-911.954) -- 0:00:25
579500 -- (-912.411) (-913.735) (-913.044) [-912.913] * (-912.100) (-910.083) [-910.639] (-911.317) -- 0:00:25
580000 -- [-910.581] (-910.331) (-912.267) (-911.879) * (-915.690) (-912.137) [-910.112] (-911.319) -- 0:00:25
Average standard deviation of split frequencies: 0.008691
580500 -- [-911.124] (-910.726) (-912.444) (-912.022) * (-912.805) (-911.205) (-911.318) [-910.073] -- 0:00:25
581000 -- (-915.657) (-917.035) [-912.897] (-912.810) * [-912.171] (-912.393) (-910.340) (-911.013) -- 0:00:25
581500 -- (-911.953) (-916.072) [-910.832] (-913.758) * [-911.699] (-911.041) (-910.849) (-910.450) -- 0:00:25
582000 -- [-912.372] (-913.343) (-911.596) (-912.921) * (-913.544) (-911.044) [-911.628] (-911.152) -- 0:00:25
582500 -- (-912.436) [-910.287] (-919.653) (-913.312) * [-911.657] (-910.816) (-912.012) (-911.340) -- 0:00:25
583000 -- [-910.677] (-910.742) (-913.833) (-911.092) * (-911.074) (-914.044) [-913.689] (-912.115) -- 0:00:25
583500 -- [-910.768] (-911.702) (-913.187) (-909.994) * (-910.743) (-910.067) [-910.132] (-912.031) -- 0:00:25
584000 -- (-911.122) (-910.432) [-913.008] (-912.634) * (-914.275) (-913.560) [-910.636] (-911.299) -- 0:00:25
584500 -- (-913.052) (-912.097) [-911.757] (-911.234) * (-911.870) (-918.448) (-914.248) [-911.051] -- 0:00:25
585000 -- (-910.726) (-911.485) (-913.097) [-909.963] * (-910.488) [-911.141] (-913.708) (-910.931) -- 0:00:25
Average standard deviation of split frequencies: 0.008754
585500 -- (-910.112) (-912.189) (-911.544) [-910.123] * (-910.787) (-910.367) (-914.182) [-910.672] -- 0:00:25
586000 -- (-910.064) (-912.285) (-911.758) [-911.097] * (-911.741) (-910.818) (-912.998) [-910.395] -- 0:00:25
586500 -- (-912.300) [-912.919] (-911.829) (-911.348) * (-911.501) (-910.729) [-910.922] (-914.152) -- 0:00:25
587000 -- (-910.315) [-911.249] (-912.342) (-910.700) * (-910.303) (-910.087) [-911.723] (-911.735) -- 0:00:25
587500 -- [-914.473] (-913.269) (-911.641) (-912.128) * (-912.494) [-909.984] (-918.256) (-916.993) -- 0:00:25
588000 -- (-913.364) (-910.373) [-913.316] (-915.639) * [-911.372] (-910.873) (-910.627) (-910.736) -- 0:00:25
588500 -- (-913.391) (-911.306) [-914.774] (-913.544) * (-911.275) (-912.866) [-911.382] (-911.545) -- 0:00:25
589000 -- (-912.360) (-916.878) [-910.357] (-911.185) * [-912.827] (-911.426) (-913.578) (-910.797) -- 0:00:25
589500 -- (-911.274) (-911.806) [-910.924] (-914.639) * [-912.798] (-911.672) (-913.148) (-910.098) -- 0:00:25
590000 -- (-911.084) (-911.921) [-912.316] (-917.596) * (-912.396) [-913.220] (-914.149) (-912.703) -- 0:00:25
Average standard deviation of split frequencies: 0.008779
590500 -- [-911.581] (-910.531) (-910.261) (-918.635) * (-909.947) (-912.330) (-911.812) [-914.047] -- 0:00:24
591000 -- (-913.072) [-911.543] (-911.007) (-912.460) * (-910.959) (-912.123) (-912.115) [-911.101] -- 0:00:24
591500 -- (-914.487) (-914.856) [-910.088] (-912.741) * (-911.766) [-912.151] (-910.857) (-911.116) -- 0:00:24
592000 -- [-913.769] (-912.990) (-912.687) (-913.317) * (-911.931) [-909.963] (-910.177) (-911.815) -- 0:00:24
592500 -- (-915.933) (-912.730) [-910.996] (-910.714) * [-910.074] (-910.406) (-911.664) (-911.866) -- 0:00:24
593000 -- (-911.655) [-912.191] (-911.482) (-915.855) * (-912.039) [-910.684] (-911.617) (-912.128) -- 0:00:24
593500 -- (-917.854) (-912.484) [-913.991] (-914.308) * (-910.622) (-913.106) (-912.364) [-910.608] -- 0:00:24
594000 -- (-916.239) (-911.282) [-912.302] (-910.881) * [-911.994] (-913.329) (-911.197) (-911.081) -- 0:00:24
594500 -- (-911.227) (-911.348) (-910.338) [-910.805] * (-910.803) [-912.280] (-910.702) (-912.876) -- 0:00:24
595000 -- (-913.030) (-912.033) [-911.799] (-914.897) * (-910.799) (-912.314) (-910.156) [-911.067] -- 0:00:24
Average standard deviation of split frequencies: 0.009046
595500 -- [-912.129] (-912.456) (-911.796) (-913.219) * (-910.145) (-909.843) (-910.782) [-912.000] -- 0:00:24
596000 -- (-918.143) (-912.480) (-913.139) [-912.122] * (-910.738) (-909.843) [-910.063] (-912.730) -- 0:00:24
596500 -- (-916.222) [-914.844] (-910.912) (-911.243) * [-911.392] (-910.223) (-910.529) (-912.760) -- 0:00:24
597000 -- (-910.240) [-915.292] (-912.219) (-912.136) * (-911.397) (-911.783) [-911.190] (-916.928) -- 0:00:24
597500 -- [-915.450] (-912.911) (-910.470) (-910.564) * (-911.856) (-911.663) (-912.024) [-911.597] -- 0:00:24
598000 -- (-911.059) (-917.160) [-910.219] (-910.602) * [-912.485] (-910.918) (-911.302) (-914.978) -- 0:00:24
598500 -- (-911.419) [-911.296] (-910.850) (-911.132) * (-912.899) (-910.315) [-910.692] (-912.183) -- 0:00:24
599000 -- [-912.426] (-911.036) (-910.532) (-915.539) * (-911.212) (-913.450) [-911.391] (-911.144) -- 0:00:24
599500 -- (-910.073) [-911.822] (-911.682) (-914.688) * (-912.135) (-911.691) (-911.902) [-912.851] -- 0:00:24
600000 -- (-910.503) [-912.984] (-911.752) (-916.685) * [-911.708] (-918.072) (-912.198) (-911.694) -- 0:00:24
Average standard deviation of split frequencies: 0.009320
600500 -- (-910.846) (-914.230) [-910.275] (-914.416) * (-911.213) [-918.447] (-911.924) (-910.506) -- 0:00:24
601000 -- (-915.140) [-910.463] (-912.423) (-915.519) * (-913.140) [-917.149] (-911.111) (-910.506) -- 0:00:24
601500 -- (-912.080) (-910.158) (-911.834) [-909.983] * [-912.433] (-912.292) (-910.975) (-911.939) -- 0:00:24
602000 -- (-911.171) (-911.806) (-913.673) [-910.397] * [-912.634] (-910.604) (-911.081) (-911.558) -- 0:00:24
602500 -- (-913.881) (-911.647) [-912.582] (-913.833) * (-911.639) (-911.396) (-911.183) [-910.378] -- 0:00:24
603000 -- (-910.610) [-910.150] (-912.828) (-913.344) * (-910.450) [-910.271] (-911.953) (-910.535) -- 0:00:24
603500 -- (-913.835) (-915.786) [-911.260] (-913.628) * (-913.819) [-910.406] (-911.117) (-913.044) -- 0:00:24
604000 -- (-913.535) (-911.864) (-912.591) [-911.320] * (-914.049) (-909.836) [-913.359] (-911.050) -- 0:00:24
604500 -- (-910.813) [-912.598] (-909.904) (-910.056) * (-909.660) (-915.096) [-912.362] (-910.942) -- 0:00:24
605000 -- (-911.144) (-916.421) (-909.769) [-910.616] * (-911.780) (-911.499) (-913.437) [-911.045] -- 0:00:24
Average standard deviation of split frequencies: 0.008969
605500 -- (-912.525) (-917.792) [-910.127] (-909.931) * (-911.057) [-911.455] (-912.831) (-909.812) -- 0:00:24
606000 -- [-912.166] (-919.100) (-911.949) (-910.435) * (-911.724) (-913.787) [-913.176] (-910.577) -- 0:00:24
606500 -- (-909.969) (-917.203) (-911.770) [-911.265] * [-911.985] (-912.874) (-910.563) (-911.664) -- 0:00:24
607000 -- (-910.151) (-909.950) (-914.487) [-910.531] * (-911.750) (-911.113) (-909.979) [-912.756] -- 0:00:23
607500 -- (-910.965) [-910.767] (-910.276) (-910.657) * (-912.982) (-910.963) (-913.832) [-910.860] -- 0:00:23
608000 -- (-910.095) [-910.798] (-911.972) (-910.600) * (-911.509) (-911.031) [-912.276] (-911.702) -- 0:00:23
608500 -- (-915.734) [-910.374] (-913.485) (-913.333) * (-911.547) (-911.222) (-915.857) [-909.693] -- 0:00:23
609000 -- (-912.111) [-910.338] (-912.510) (-911.910) * (-910.599) (-912.829) (-910.856) [-910.508] -- 0:00:23
609500 -- (-911.219) (-918.261) (-911.894) [-911.706] * (-909.959) (-910.860) [-911.820] (-912.019) -- 0:00:23
610000 -- (-910.959) (-916.376) (-915.519) [-914.186] * (-911.622) (-918.439) [-913.216] (-912.492) -- 0:00:23
Average standard deviation of split frequencies: 0.009490
610500 -- (-913.825) (-911.746) [-912.183] (-914.039) * [-911.818] (-915.540) (-913.970) (-913.611) -- 0:00:23
611000 -- (-913.538) (-915.282) [-912.552] (-914.050) * (-910.856) (-911.230) [-911.068] (-913.147) -- 0:00:23
611500 -- (-910.796) (-913.760) [-911.526] (-918.817) * (-912.000) [-910.953] (-912.435) (-911.396) -- 0:00:23
612000 -- (-910.283) (-913.157) (-910.826) [-911.796] * (-910.949) (-910.278) [-913.393] (-913.758) -- 0:00:23
612500 -- [-910.494] (-913.935) (-912.735) (-911.489) * (-911.158) (-910.919) [-912.095] (-910.247) -- 0:00:23
613000 -- [-914.861] (-914.355) (-914.090) (-912.278) * (-917.516) [-910.546] (-916.757) (-910.095) -- 0:00:23
613500 -- (-914.891) (-913.352) (-914.000) [-916.832] * (-910.515) (-910.693) (-912.263) [-912.471] -- 0:00:23
614000 -- (-911.212) (-912.782) (-912.865) [-911.850] * (-912.150) (-918.161) [-911.875] (-911.010) -- 0:00:23
614500 -- [-910.000] (-912.266) (-910.599) (-913.957) * [-910.851] (-915.440) (-909.887) (-914.773) -- 0:00:23
615000 -- (-911.291) (-912.729) [-910.643] (-912.514) * [-911.674] (-912.251) (-912.593) (-910.477) -- 0:00:23
Average standard deviation of split frequencies: 0.009318
615500 -- (-911.994) (-911.777) [-912.185] (-913.288) * (-911.519) [-910.958] (-911.592) (-910.714) -- 0:00:23
616000 -- [-916.295] (-910.692) (-910.879) (-914.504) * [-911.279] (-916.108) (-912.437) (-915.947) -- 0:00:23
616500 -- (-917.496) (-910.074) [-912.064] (-913.848) * (-910.526) (-910.135) [-914.110] (-912.096) -- 0:00:23
617000 -- (-912.202) (-910.489) [-911.726] (-910.724) * (-914.535) (-912.860) (-915.179) [-910.469] -- 0:00:23
617500 -- (-910.011) [-917.319] (-912.092) (-910.550) * (-910.461) (-912.064) [-912.465] (-911.194) -- 0:00:23
618000 -- [-910.170] (-914.367) (-910.303) (-910.175) * [-910.888] (-909.881) (-912.421) (-912.195) -- 0:00:23
618500 -- (-911.370) [-912.918] (-910.324) (-914.761) * (-919.088) [-911.618] (-911.049) (-914.964) -- 0:00:23
619000 -- [-911.238] (-913.353) (-912.751) (-911.968) * [-911.358] (-912.616) (-910.598) (-911.628) -- 0:00:23
619500 -- (-911.464) [-911.418] (-913.111) (-911.302) * (-915.785) [-913.082] (-913.126) (-910.278) -- 0:00:23
620000 -- (-913.971) [-910.525] (-913.965) (-911.620) * [-914.989] (-909.999) (-913.783) (-911.263) -- 0:00:23
Average standard deviation of split frequencies: 0.009293
620500 -- [-914.250] (-910.404) (-910.844) (-912.585) * (-911.344) (-911.457) (-911.357) [-912.228] -- 0:00:23
621000 -- (-912.703) [-911.049] (-910.949) (-914.004) * [-912.072] (-910.129) (-912.222) (-912.606) -- 0:00:23
621500 -- (-912.094) (-912.904) (-910.458) [-913.270] * (-912.988) (-912.902) [-913.834] (-913.639) -- 0:00:23
622000 -- (-911.481) [-910.565] (-913.017) (-912.091) * [-912.021] (-911.124) (-914.658) (-911.909) -- 0:00:23
622500 -- (-917.009) (-913.409) (-912.843) [-914.201] * [-910.619] (-911.640) (-913.670) (-912.660) -- 0:00:23
623000 -- [-914.221] (-910.441) (-914.043) (-913.766) * (-910.913) (-912.923) (-913.052) [-910.398] -- 0:00:22
623500 -- (-911.564) (-910.466) (-911.954) [-912.644] * [-913.955] (-911.710) (-913.707) (-910.894) -- 0:00:22
624000 -- (-911.061) (-912.603) (-912.028) [-912.647] * (-913.117) [-911.422] (-913.018) (-914.397) -- 0:00:22
624500 -- (-911.778) (-914.391) (-910.560) [-913.431] * [-912.558] (-911.931) (-913.368) (-919.958) -- 0:00:22
625000 -- (-914.121) (-912.474) [-910.896] (-913.092) * (-912.739) (-913.598) (-911.138) [-915.317] -- 0:00:22
Average standard deviation of split frequencies: 0.009435
625500 -- (-910.560) [-914.892] (-910.450) (-913.593) * (-911.986) [-910.500] (-915.025) (-915.316) -- 0:00:22
626000 -- [-913.263] (-914.012) (-915.307) (-910.950) * (-910.326) (-911.258) (-911.219) [-911.402] -- 0:00:22
626500 -- (-916.048) (-914.012) (-911.990) [-912.616] * [-910.326] (-911.666) (-911.325) (-913.057) -- 0:00:22
627000 -- (-910.846) [-911.412] (-911.913) (-911.963) * (-910.847) [-911.893] (-913.440) (-913.863) -- 0:00:22
627500 -- [-910.282] (-913.015) (-912.309) (-910.928) * [-911.968] (-910.856) (-911.998) (-911.255) -- 0:00:22
628000 -- (-918.109) (-910.435) (-911.575) [-910.524] * (-911.402) [-912.236] (-913.742) (-911.081) -- 0:00:22
628500 -- (-915.073) (-911.987) [-918.585] (-910.531) * [-912.676] (-912.222) (-912.557) (-911.665) -- 0:00:22
629000 -- (-915.927) [-913.416] (-911.290) (-912.425) * (-912.681) (-911.924) (-910.390) [-914.266] -- 0:00:22
629500 -- (-918.514) [-911.148] (-913.001) (-913.374) * (-912.252) (-910.849) [-912.066] (-911.756) -- 0:00:22
630000 -- (-910.657) (-914.345) [-911.582] (-917.127) * (-915.211) (-912.584) (-914.958) [-912.757] -- 0:00:22
Average standard deviation of split frequencies: 0.009146
630500 -- [-913.511] (-911.691) (-911.192) (-912.583) * (-910.575) [-911.494] (-912.086) (-911.074) -- 0:00:22
631000 -- (-913.343) (-912.177) [-910.663] (-913.230) * [-910.174] (-911.750) (-911.136) (-910.964) -- 0:00:22
631500 -- [-910.427] (-913.368) (-910.992) (-913.958) * [-911.101] (-911.265) (-910.524) (-910.604) -- 0:00:22
632000 -- [-910.107] (-913.752) (-910.562) (-911.603) * (-910.404) [-913.964] (-916.231) (-910.589) -- 0:00:22
632500 -- (-910.349) (-910.820) [-916.776] (-912.233) * [-912.095] (-912.766) (-911.259) (-913.285) -- 0:00:22
633000 -- (-912.420) (-910.851) [-911.694] (-911.982) * [-913.084] (-911.145) (-910.458) (-912.665) -- 0:00:22
633500 -- (-910.887) [-911.536] (-913.796) (-915.013) * [-913.420] (-911.075) (-911.038) (-910.404) -- 0:00:22
634000 -- (-915.061) [-910.426] (-913.000) (-911.828) * (-913.936) (-910.972) (-910.493) [-913.564] -- 0:00:22
634500 -- (-912.175) (-910.572) [-914.224] (-910.733) * [-911.279] (-911.503) (-909.771) (-911.210) -- 0:00:22
635000 -- (-910.524) (-911.982) [-912.506] (-913.999) * [-912.163] (-909.638) (-914.230) (-916.981) -- 0:00:22
Average standard deviation of split frequencies: 0.009461
635500 -- (-912.166) (-910.855) [-914.224] (-911.235) * [-911.724] (-910.795) (-911.993) (-916.772) -- 0:00:22
636000 -- (-912.559) (-913.912) [-913.061] (-914.473) * [-912.373] (-910.781) (-914.615) (-909.723) -- 0:00:22
636500 -- (-913.918) [-910.031] (-912.741) (-912.704) * (-910.330) (-910.107) (-913.083) [-910.313] -- 0:00:22
637000 -- (-910.388) (-912.869) (-914.562) [-910.248] * [-914.497] (-910.655) (-916.606) (-911.264) -- 0:00:22
637500 -- (-911.219) [-909.759] (-913.204) (-910.929) * [-910.897] (-914.387) (-914.695) (-913.810) -- 0:00:22
638000 -- (-916.664) [-909.967] (-918.953) (-910.614) * [-911.640] (-912.135) (-912.818) (-914.042) -- 0:00:22
638500 -- (-911.444) (-910.432) (-919.778) [-910.274] * [-912.027] (-911.258) (-914.758) (-910.163) -- 0:00:22
639000 -- (-911.804) (-912.820) [-910.369] (-914.520) * (-910.185) (-910.811) (-910.037) [-910.341] -- 0:00:22
639500 -- (-914.570) (-911.895) [-912.554] (-913.559) * (-910.723) [-910.884] (-911.456) (-910.218) -- 0:00:21
640000 -- [-915.757] (-913.397) (-910.530) (-912.251) * (-913.717) (-913.309) [-912.240] (-910.278) -- 0:00:21
Average standard deviation of split frequencies: 0.008916
640500 -- (-911.014) [-912.407] (-911.259) (-911.137) * [-910.129] (-911.495) (-911.672) (-910.950) -- 0:00:21
641000 -- (-912.175) [-912.107] (-910.470) (-911.288) * [-909.942] (-916.615) (-910.301) (-913.089) -- 0:00:21
641500 -- (-911.299) (-913.657) (-915.202) [-910.737] * (-911.442) (-914.733) (-912.273) [-913.433] -- 0:00:21
642000 -- (-912.502) [-912.792] (-914.066) (-912.597) * (-910.092) [-918.277] (-910.757) (-911.872) -- 0:00:21
642500 -- (-913.604) [-910.593] (-914.726) (-914.843) * [-912.914] (-917.226) (-912.200) (-911.147) -- 0:00:21
643000 -- (-915.346) (-910.406) (-915.534) [-913.172] * (-917.092) (-918.135) [-911.464] (-912.833) -- 0:00:21
643500 -- [-912.082] (-910.958) (-917.683) (-911.769) * [-910.155] (-918.712) (-911.138) (-915.759) -- 0:00:21
644000 -- [-910.518] (-911.304) (-914.908) (-910.466) * (-912.295) (-910.303) [-911.040] (-913.082) -- 0:00:21
644500 -- [-910.221] (-912.937) (-913.711) (-911.590) * (-912.029) [-911.117] (-910.105) (-909.848) -- 0:00:21
645000 -- (-912.125) (-912.841) [-909.958] (-911.807) * (-910.694) (-913.128) (-911.122) [-910.148] -- 0:00:21
Average standard deviation of split frequencies: 0.009143
645500 -- (-911.744) (-913.961) (-911.276) [-909.862] * (-911.059) (-911.893) (-913.929) [-910.985] -- 0:00:21
646000 -- (-913.078) [-910.944] (-912.602) (-912.055) * (-911.056) [-912.404] (-914.557) (-913.211) -- 0:00:21
646500 -- (-910.056) [-911.842] (-912.352) (-909.853) * [-912.931] (-912.760) (-911.863) (-916.353) -- 0:00:21
647000 -- (-910.826) (-912.838) [-910.114] (-910.131) * (-913.046) (-911.714) [-912.975] (-911.169) -- 0:00:21
647500 -- (-913.537) [-912.581] (-917.008) (-912.231) * (-911.910) (-912.348) [-912.302] (-911.598) -- 0:00:21
648000 -- [-913.161] (-912.556) (-912.894) (-914.487) * [-915.222] (-911.460) (-912.258) (-911.308) -- 0:00:21
648500 -- [-912.699] (-911.213) (-909.984) (-910.815) * [-911.722] (-910.687) (-913.736) (-910.626) -- 0:00:21
649000 -- (-910.663) [-913.955] (-914.950) (-914.100) * [-911.330] (-913.902) (-914.114) (-910.192) -- 0:00:21
649500 -- (-910.663) [-913.656] (-911.852) (-912.304) * (-910.699) (-913.798) (-913.934) [-911.366] -- 0:00:21
650000 -- [-912.434] (-912.799) (-911.739) (-912.257) * (-911.162) (-910.616) (-912.340) [-911.996] -- 0:00:21
Average standard deviation of split frequencies: 0.009418
650500 -- [-910.979] (-913.912) (-910.805) (-911.012) * (-912.189) [-913.008] (-911.660) (-916.794) -- 0:00:21
651000 -- (-910.087) [-911.239] (-916.986) (-910.435) * (-910.965) (-913.639) [-911.271] (-912.828) -- 0:00:21
651500 -- (-911.137) (-909.805) (-910.245) [-909.863] * (-911.579) (-917.355) [-911.413] (-910.701) -- 0:00:21
652000 -- (-913.059) (-910.548) [-910.374] (-911.410) * (-912.581) (-912.696) [-914.140] (-910.456) -- 0:00:21
652500 -- (-912.550) (-910.752) [-912.024] (-917.690) * (-913.298) (-917.464) [-913.536] (-911.699) -- 0:00:21
653000 -- [-910.345] (-914.812) (-912.266) (-912.026) * (-911.161) (-911.067) [-912.800] (-910.867) -- 0:00:21
653500 -- [-910.044] (-910.350) (-911.937) (-910.665) * (-911.495) (-913.359) (-910.682) [-912.860] -- 0:00:21
654000 -- [-910.660] (-910.821) (-911.254) (-913.642) * (-910.895) [-917.011] (-910.996) (-913.584) -- 0:00:21
654500 -- (-912.808) [-910.399] (-909.970) (-911.677) * (-911.509) [-910.894] (-909.933) (-912.588) -- 0:00:21
655000 -- (-911.514) (-910.931) (-912.709) [-911.223] * [-910.552] (-913.278) (-911.351) (-910.683) -- 0:00:21
Average standard deviation of split frequencies: 0.009046
655500 -- (-911.485) [-911.111] (-917.369) (-912.097) * (-911.544) [-916.917] (-914.997) (-910.652) -- 0:00:21
656000 -- [-911.569] (-912.087) (-911.813) (-911.102) * (-911.403) [-914.394] (-913.640) (-911.575) -- 0:00:20
656500 -- (-912.320) (-912.359) (-912.862) [-910.902] * (-912.689) [-913.692] (-915.117) (-911.549) -- 0:00:20
657000 -- (-918.652) (-910.390) (-912.500) [-913.179] * (-909.669) (-912.605) (-912.812) [-911.697] -- 0:00:20
657500 -- (-917.800) (-912.550) [-911.058] (-913.972) * (-912.070) [-912.085] (-913.442) (-911.668) -- 0:00:20
658000 -- (-914.206) (-913.776) (-911.693) [-912.737] * [-911.542] (-911.316) (-911.664) (-910.784) -- 0:00:20
658500 -- [-915.784] (-916.874) (-914.799) (-912.067) * [-912.711] (-911.254) (-910.762) (-910.261) -- 0:00:20
659000 -- [-911.514] (-916.607) (-913.762) (-911.203) * [-912.840] (-912.364) (-910.614) (-918.595) -- 0:00:20
659500 -- [-912.313] (-913.722) (-911.469) (-911.610) * (-915.444) (-911.793) (-912.641) [-911.622] -- 0:00:20
660000 -- [-911.244] (-912.423) (-910.146) (-910.995) * (-913.196) (-913.095) [-911.429] (-911.092) -- 0:00:20
Average standard deviation of split frequencies: 0.009150
660500 -- (-913.840) (-912.123) (-911.439) [-910.963] * (-915.677) (-911.134) (-912.704) [-910.963] -- 0:00:20
661000 -- (-913.283) (-911.296) (-910.453) [-911.819] * (-913.083) [-910.752] (-911.881) (-911.978) -- 0:00:20
661500 -- (-913.976) (-919.026) [-909.974] (-916.268) * (-914.841) [-910.167] (-913.329) (-911.660) -- 0:00:20
662000 -- (-912.975) (-912.344) [-910.678] (-914.212) * (-913.068) (-911.327) [-910.808] (-912.225) -- 0:00:20
662500 -- [-912.478] (-912.706) (-912.105) (-910.691) * [-911.134] (-910.952) (-911.034) (-910.581) -- 0:00:20
663000 -- (-911.123) (-910.548) [-910.982] (-910.741) * (-911.911) (-911.798) [-911.591] (-910.870) -- 0:00:20
663500 -- (-909.807) [-911.488] (-911.496) (-913.542) * [-912.105] (-914.874) (-915.146) (-914.824) -- 0:00:20
664000 -- (-910.876) (-912.244) (-912.274) [-913.013] * (-915.117) (-911.296) [-914.224] (-912.513) -- 0:00:20
664500 -- (-910.291) (-910.645) [-911.737] (-912.058) * (-912.118) [-910.661] (-913.158) (-910.236) -- 0:00:20
665000 -- (-917.580) (-911.123) (-911.854) [-910.235] * (-911.699) (-909.676) (-911.313) [-911.330] -- 0:00:20
Average standard deviation of split frequencies: 0.008993
665500 -- (-910.966) (-912.908) [-912.283] (-909.966) * [-910.935] (-912.263) (-912.275) (-912.829) -- 0:00:20
666000 -- (-909.987) [-911.312] (-913.425) (-912.306) * [-911.226] (-915.044) (-916.037) (-912.817) -- 0:00:20
666500 -- (-911.276) [-911.477] (-910.976) (-913.256) * (-913.824) (-914.271) (-912.280) [-911.159] -- 0:00:20
667000 -- (-913.917) (-911.545) (-913.011) [-910.675] * (-911.724) (-919.817) [-910.799] (-913.577) -- 0:00:20
667500 -- (-913.638) [-912.007] (-910.793) (-910.952) * (-911.085) (-914.697) [-911.899] (-910.404) -- 0:00:20
668000 -- (-912.270) (-912.518) [-910.650] (-913.029) * (-915.630) (-911.358) [-910.559] (-910.829) -- 0:00:20
668500 -- (-914.836) (-912.646) (-910.649) [-911.087] * [-915.388] (-911.725) (-911.430) (-912.098) -- 0:00:20
669000 -- [-913.427] (-910.988) (-911.445) (-912.020) * [-913.554] (-910.511) (-913.310) (-910.366) -- 0:00:20
669500 -- (-916.075) (-910.993) [-914.384] (-914.669) * (-911.537) [-911.004] (-914.283) (-913.500) -- 0:00:20
670000 -- (-912.813) (-911.696) [-911.141] (-910.383) * [-910.434] (-911.427) (-910.691) (-912.449) -- 0:00:20
Average standard deviation of split frequencies: 0.009386
670500 -- [-912.651] (-917.090) (-911.619) (-912.218) * (-917.145) (-911.985) [-911.979] (-913.237) -- 0:00:20
671000 -- (-912.062) [-913.768] (-912.171) (-914.539) * (-912.029) [-910.010] (-914.009) (-913.183) -- 0:00:20
671500 -- (-910.445) (-917.344) (-911.128) [-910.292] * (-910.116) [-914.321] (-912.305) (-918.048) -- 0:00:20
672000 -- [-911.857] (-915.086) (-911.583) (-911.604) * (-909.804) (-912.798) [-913.835] (-912.379) -- 0:00:20
672500 -- [-912.890] (-912.165) (-912.108) (-912.615) * (-909.599) (-913.133) [-910.460] (-913.663) -- 0:00:19
673000 -- [-911.991] (-913.529) (-911.487) (-915.118) * (-914.483) [-913.911] (-910.654) (-912.847) -- 0:00:19
673500 -- (-914.279) [-911.592] (-915.540) (-913.386) * [-912.771] (-916.956) (-914.806) (-914.349) -- 0:00:19
674000 -- [-912.999] (-911.182) (-912.721) (-913.732) * (-910.926) (-911.177) (-912.948) [-918.032] -- 0:00:19
674500 -- (-912.381) (-910.771) (-910.508) [-914.719] * (-915.986) (-912.874) (-911.996) [-913.718] -- 0:00:19
675000 -- (-917.206) (-920.275) [-910.447] (-913.458) * [-912.168] (-911.555) (-912.454) (-912.494) -- 0:00:19
Average standard deviation of split frequencies: 0.008819
675500 -- (-911.816) [-915.042] (-910.891) (-913.580) * (-910.768) [-910.933] (-913.821) (-912.939) -- 0:00:19
676000 -- [-912.964] (-916.333) (-918.081) (-911.240) * (-912.072) [-911.941] (-914.017) (-911.563) -- 0:00:19
676500 -- (-914.534) (-912.203) (-915.908) [-913.538] * (-915.214) (-912.333) [-912.553] (-910.299) -- 0:00:19
677000 -- (-914.914) (-912.529) (-911.346) [-911.371] * (-916.004) (-910.713) [-910.469] (-912.787) -- 0:00:19
677500 -- (-911.041) (-912.702) (-911.712) [-910.364] * (-916.173) [-911.729] (-912.814) (-913.293) -- 0:00:19
678000 -- [-916.877] (-910.248) (-913.748) (-910.895) * (-910.995) (-913.902) [-912.202] (-912.140) -- 0:00:19
678500 -- (-916.654) (-910.708) (-913.350) [-913.179] * (-914.012) (-911.151) (-912.670) [-918.012] -- 0:00:19
679000 -- (-911.835) [-912.037] (-914.649) (-912.437) * [-913.301] (-910.431) (-910.839) (-920.030) -- 0:00:19
679500 -- [-910.944] (-913.300) (-910.861) (-910.556) * (-916.171) [-911.692] (-912.145) (-913.882) -- 0:00:19
680000 -- (-911.590) (-910.902) [-914.710] (-914.638) * (-911.721) (-910.100) (-914.312) [-910.616] -- 0:00:19
Average standard deviation of split frequencies: 0.008311
680500 -- (-911.508) (-911.250) (-912.523) [-911.192] * [-913.508] (-911.102) (-911.631) (-909.921) -- 0:00:19
681000 -- (-910.030) [-910.556] (-912.952) (-909.861) * [-912.893] (-916.472) (-912.237) (-911.966) -- 0:00:19
681500 -- (-915.017) (-918.196) (-913.473) [-910.270] * (-910.881) [-913.585] (-911.091) (-914.045) -- 0:00:19
682000 -- [-912.331] (-910.371) (-910.214) (-913.171) * (-914.539) [-910.915] (-915.281) (-910.239) -- 0:00:19
682500 -- (-913.461) [-915.412] (-910.856) (-913.462) * (-912.970) (-911.303) [-912.539] (-910.666) -- 0:00:19
683000 -- (-915.120) (-911.006) [-911.496] (-916.084) * (-909.658) (-912.909) (-913.066) [-912.033] -- 0:00:19
683500 -- (-914.953) (-909.771) [-912.147] (-915.801) * (-912.473) (-910.664) (-912.757) [-910.972] -- 0:00:19
684000 -- [-911.924] (-909.571) (-912.037) (-911.662) * (-910.404) (-910.427) (-915.196) [-909.949] -- 0:00:19
684500 -- (-912.938) (-911.672) (-910.255) [-914.113] * [-911.409] (-914.365) (-914.729) (-909.978) -- 0:00:19
685000 -- [-910.202] (-911.083) (-913.799) (-912.597) * (-909.934) (-910.581) [-911.875] (-910.862) -- 0:00:19
Average standard deviation of split frequencies: 0.008547
685500 -- (-909.963) (-912.306) [-912.651] (-910.309) * (-910.299) [-910.585] (-910.892) (-916.090) -- 0:00:19
686000 -- (-912.061) [-911.746] (-912.259) (-912.898) * (-910.299) (-917.072) (-921.220) [-912.894] -- 0:00:19
686500 -- [-912.600] (-911.175) (-912.641) (-912.238) * [-911.934] (-914.162) (-915.989) (-911.128) -- 0:00:19
687000 -- [-910.100] (-911.911) (-912.342) (-912.617) * [-910.920] (-911.609) (-914.670) (-911.826) -- 0:00:19
687500 -- (-913.708) (-911.915) (-912.165) [-911.166] * (-911.616) [-912.899] (-911.848) (-911.062) -- 0:00:19
688000 -- (-913.551) (-911.822) [-916.026] (-913.643) * [-912.652] (-911.566) (-911.261) (-912.235) -- 0:00:19
688500 -- [-912.309] (-910.457) (-912.149) (-913.258) * (-910.232) (-912.346) [-911.810] (-914.692) -- 0:00:19
689000 -- (-912.474) [-912.499] (-911.837) (-911.413) * (-910.462) [-915.765] (-913.962) (-911.125) -- 0:00:18
689500 -- (-911.982) (-918.512) [-911.796] (-910.839) * [-910.523] (-912.914) (-912.987) (-911.979) -- 0:00:18
690000 -- [-911.577] (-917.971) (-911.783) (-911.713) * (-913.030) [-910.601] (-913.902) (-914.301) -- 0:00:18
Average standard deviation of split frequencies: 0.009034
690500 -- (-913.087) (-913.691) [-911.811] (-910.829) * (-914.018) [-911.149] (-913.472) (-914.064) -- 0:00:18
691000 -- (-910.215) [-912.119] (-912.286) (-910.563) * (-915.481) [-912.035] (-913.215) (-915.041) -- 0:00:18
691500 -- [-911.811] (-912.127) (-912.008) (-910.237) * (-911.562) (-911.201) [-912.896] (-911.314) -- 0:00:18
692000 -- [-913.232] (-916.398) (-911.149) (-918.759) * (-910.297) [-917.440] (-913.046) (-912.863) -- 0:00:18
692500 -- [-911.938] (-912.295) (-910.526) (-911.362) * (-911.787) (-914.184) (-913.484) [-911.399] -- 0:00:18
693000 -- (-912.045) (-910.810) [-911.050] (-914.813) * (-913.029) (-912.820) (-910.031) [-911.087] -- 0:00:18
693500 -- [-911.551] (-911.114) (-910.533) (-911.315) * (-914.675) (-913.454) [-913.205] (-914.202) -- 0:00:18
694000 -- (-911.258) (-910.511) (-913.224) [-913.714] * [-912.314] (-913.713) (-911.193) (-912.612) -- 0:00:18
694500 -- (-911.388) [-910.129] (-910.360) (-912.965) * (-912.378) (-911.757) (-910.427) [-910.758] -- 0:00:18
695000 -- (-911.635) (-911.052) (-913.817) [-910.784] * (-911.017) [-910.395] (-910.391) (-911.337) -- 0:00:18
Average standard deviation of split frequencies: 0.009323
695500 -- (-914.425) (-911.705) (-914.937) [-910.757] * [-912.557] (-910.239) (-911.711) (-912.426) -- 0:00:18
696000 -- [-910.633] (-912.786) (-911.010) (-911.375) * (-914.034) (-911.528) (-911.640) [-914.910] -- 0:00:18
696500 -- (-914.313) [-911.861] (-912.393) (-914.776) * (-912.831) (-910.621) [-912.553] (-910.328) -- 0:00:18
697000 -- [-914.806] (-911.801) (-913.903) (-916.326) * (-911.120) (-910.675) [-912.043] (-911.394) -- 0:00:18
697500 -- (-911.683) (-912.930) (-910.720) [-913.661] * (-913.332) [-910.238] (-910.916) (-912.175) -- 0:00:18
698000 -- [-914.224] (-918.772) (-916.312) (-914.297) * (-916.046) (-914.486) (-909.776) [-912.547] -- 0:00:18
698500 -- (-913.656) [-917.577] (-910.857) (-913.420) * (-919.889) (-911.373) [-910.004] (-914.292) -- 0:00:18
699000 -- (-912.373) [-913.062] (-911.007) (-912.001) * (-915.181) [-912.266] (-912.489) (-913.881) -- 0:00:18
699500 -- [-911.920] (-910.101) (-909.762) (-911.019) * (-916.268) [-910.386] (-912.032) (-910.491) -- 0:00:18
700000 -- (-911.068) (-911.214) (-913.678) [-911.124] * (-913.830) [-910.388] (-913.517) (-911.300) -- 0:00:18
Average standard deviation of split frequencies: 0.009419
700500 -- (-912.151) (-912.572) (-910.843) [-910.730] * (-911.032) (-909.672) (-913.842) [-909.623] -- 0:00:18
701000 -- (-911.715) (-911.312) (-909.883) [-912.994] * (-911.289) (-911.695) [-912.662] (-911.764) -- 0:00:18
701500 -- [-911.893] (-910.941) (-911.006) (-911.733) * [-910.984] (-913.093) (-910.551) (-912.095) -- 0:00:18
702000 -- (-915.068) (-914.915) (-912.844) [-910.421] * (-913.885) [-916.508] (-913.198) (-911.330) -- 0:00:18
702500 -- (-913.725) (-912.391) [-913.421] (-910.592) * (-912.821) (-916.747) (-911.731) [-910.587] -- 0:00:18
703000 -- [-910.768] (-912.358) (-912.572) (-921.077) * (-914.777) (-910.645) (-911.976) [-912.509] -- 0:00:18
703500 -- (-911.351) (-910.004) [-909.700] (-920.879) * (-914.961) (-915.424) (-911.855) [-911.313] -- 0:00:18
704000 -- (-910.811) [-910.848] (-911.646) (-910.535) * (-913.586) (-914.574) (-914.153) [-913.210] -- 0:00:18
704500 -- (-910.517) (-911.353) [-909.731] (-911.519) * [-911.177] (-912.824) (-912.557) (-914.468) -- 0:00:18
705000 -- [-910.251] (-910.103) (-917.827) (-912.158) * [-910.620] (-910.565) (-913.197) (-915.101) -- 0:00:17
Average standard deviation of split frequencies: 0.009427
705500 -- (-911.330) (-912.359) [-912.308] (-911.111) * (-910.204) (-910.515) (-910.282) [-910.938] -- 0:00:17
706000 -- (-909.693) (-911.563) [-915.392] (-912.644) * (-915.929) (-918.541) (-910.997) [-911.304] -- 0:00:17
706500 -- (-910.504) [-910.535] (-910.239) (-912.064) * (-914.059) (-914.191) [-912.113] (-910.381) -- 0:00:17
707000 -- (-910.504) (-911.663) [-909.725] (-911.589) * (-912.145) [-914.282] (-912.588) (-910.908) -- 0:00:17
707500 -- (-911.885) (-911.114) [-911.215] (-912.467) * (-911.984) (-912.488) (-910.464) [-912.376] -- 0:00:17
708000 -- [-910.607] (-915.359) (-910.315) (-918.332) * (-915.546) (-911.963) [-910.108] (-910.197) -- 0:00:17
708500 -- (-911.685) (-913.942) [-912.647] (-910.833) * (-912.968) (-909.961) (-915.917) [-910.054] -- 0:00:17
709000 -- (-912.207) (-910.227) [-911.185] (-913.152) * (-911.451) (-912.234) (-911.315) [-912.914] -- 0:00:17
709500 -- (-914.668) (-910.165) (-910.511) [-911.608] * (-910.617) (-913.347) (-916.072) [-909.826] -- 0:00:17
710000 -- (-913.830) [-910.747] (-910.535) (-913.463) * (-913.455) [-911.572] (-913.769) (-916.561) -- 0:00:17
Average standard deviation of split frequencies: 0.009560
710500 -- (-915.785) (-910.469) (-915.108) [-912.459] * (-914.293) [-914.524] (-913.100) (-918.190) -- 0:00:17
711000 -- (-913.080) (-911.564) (-916.383) [-912.123] * (-911.241) (-913.262) (-910.629) [-911.056] -- 0:00:17
711500 -- [-910.887] (-913.221) (-913.777) (-912.583) * (-910.994) (-910.772) [-910.835] (-913.103) -- 0:00:17
712000 -- (-910.865) (-912.604) (-916.214) [-913.924] * (-912.442) (-912.737) (-915.090) [-912.413] -- 0:00:17
712500 -- (-915.791) [-910.961] (-912.794) (-911.694) * [-914.384] (-911.783) (-911.352) (-912.085) -- 0:00:17
713000 -- (-911.151) (-915.952) (-911.425) [-911.862] * (-910.244) [-910.676] (-910.297) (-913.668) -- 0:00:17
713500 -- (-910.805) (-912.877) (-914.237) [-911.094] * (-910.179) [-914.069] (-913.437) (-913.441) -- 0:00:17
714000 -- (-910.072) (-912.351) (-913.907) [-910.347] * (-910.959) (-911.464) [-911.520] (-915.755) -- 0:00:17
714500 -- [-911.049] (-910.423) (-912.568) (-912.496) * [-911.380] (-911.944) (-912.606) (-915.653) -- 0:00:17
715000 -- (-910.395) (-914.235) (-910.607) [-910.909] * (-913.535) [-913.545] (-912.041) (-910.347) -- 0:00:17
Average standard deviation of split frequencies: 0.009217
715500 -- (-913.320) (-911.542) (-912.700) [-915.302] * (-913.539) [-909.998] (-911.994) (-910.497) -- 0:00:17
716000 -- (-914.027) [-911.182] (-912.940) (-910.283) * (-911.287) (-916.145) (-913.457) [-910.331] -- 0:00:17
716500 -- (-914.244) (-912.473) (-909.952) [-911.556] * (-910.901) (-918.284) [-910.476] (-910.658) -- 0:00:17
717000 -- (-912.352) (-911.452) [-913.822] (-911.116) * (-912.447) (-912.972) [-910.133] (-912.589) -- 0:00:17
717500 -- (-914.410) [-913.330] (-912.537) (-911.527) * [-913.031] (-911.193) (-909.836) (-916.064) -- 0:00:17
718000 -- (-911.501) [-912.125] (-912.468) (-913.217) * (-913.571) [-911.391] (-912.105) (-915.796) -- 0:00:17
718500 -- [-912.182] (-910.999) (-911.520) (-911.418) * (-914.488) (-912.080) [-915.375] (-911.148) -- 0:00:17
719000 -- (-913.125) [-911.981] (-911.309) (-916.652) * (-913.247) (-910.347) (-915.022) [-911.142] -- 0:00:17
719500 -- (-912.344) [-911.599] (-914.419) (-913.910) * (-910.943) (-910.220) [-912.518] (-913.623) -- 0:00:17
720000 -- (-912.068) (-911.721) [-914.604] (-912.414) * (-912.204) (-913.074) [-913.160] (-911.415) -- 0:00:17
Average standard deviation of split frequencies: 0.009696
720500 -- (-913.767) [-912.690] (-914.865) (-916.584) * (-912.265) (-912.427) (-916.774) [-910.502] -- 0:00:17
721000 -- [-912.500] (-916.326) (-919.117) (-916.532) * [-914.266] (-914.808) (-913.120) (-914.958) -- 0:00:17
721500 -- (-913.558) [-910.565] (-910.339) (-911.007) * (-916.423) (-913.709) [-913.671] (-912.555) -- 0:00:16
722000 -- [-911.201] (-910.333) (-912.589) (-910.842) * (-917.370) (-909.761) (-917.417) [-915.283] -- 0:00:16
722500 -- (-909.709) (-911.323) [-911.393] (-910.011) * (-913.123) (-912.665) [-913.673] (-913.840) -- 0:00:16
723000 -- (-913.047) (-911.871) (-913.112) [-910.035] * [-911.055] (-912.945) (-912.345) (-912.856) -- 0:00:16
723500 -- [-912.439] (-911.199) (-913.592) (-913.481) * [-910.621] (-916.359) (-910.671) (-910.457) -- 0:00:16
724000 -- (-916.691) (-911.778) (-911.033) [-910.394] * (-912.450) [-910.770] (-910.356) (-911.115) -- 0:00:16
724500 -- [-909.786] (-910.575) (-913.375) (-912.576) * (-912.580) (-909.948) (-916.127) [-910.423] -- 0:00:16
725000 -- (-912.095) (-910.262) [-914.217] (-909.890) * (-912.893) (-913.224) (-916.576) [-913.786] -- 0:00:16
Average standard deviation of split frequencies: 0.009663
725500 -- (-916.578) (-910.545) (-912.709) [-910.350] * [-912.862] (-912.948) (-916.594) (-912.731) -- 0:00:16
726000 -- [-911.164] (-911.139) (-911.633) (-910.734) * (-910.894) (-916.065) (-915.873) [-910.688] -- 0:00:16
726500 -- [-912.447] (-913.093) (-912.267) (-913.366) * [-910.739] (-912.558) (-914.940) (-910.604) -- 0:00:16
727000 -- (-917.393) [-911.149] (-913.144) (-910.954) * (-911.434) [-910.584] (-910.194) (-911.518) -- 0:00:16
727500 -- (-914.112) (-912.469) (-910.460) [-911.358] * (-911.840) [-909.890] (-911.465) (-913.494) -- 0:00:16
728000 -- (-916.028) [-911.308] (-910.589) (-917.349) * (-913.132) (-911.635) (-910.730) [-913.838] -- 0:00:16
728500 -- (-910.285) (-915.192) (-910.696) [-912.374] * (-911.068) (-912.774) [-911.402] (-912.791) -- 0:00:16
729000 -- (-913.891) (-911.589) (-914.671) [-910.828] * [-911.788] (-911.983) (-912.470) (-909.856) -- 0:00:16
729500 -- (-918.454) (-911.537) (-909.910) [-910.563] * (-915.411) [-912.471] (-913.104) (-911.365) -- 0:00:16
730000 -- (-914.016) (-913.908) (-912.266) [-911.718] * [-911.546] (-911.023) (-911.580) (-911.185) -- 0:00:16
Average standard deviation of split frequencies: 0.009412
730500 -- [-910.384] (-914.406) (-913.343) (-912.149) * (-913.982) [-911.442] (-914.942) (-915.452) -- 0:00:16
731000 -- [-912.167] (-912.080) (-912.380) (-913.071) * (-911.513) (-910.420) (-912.990) [-911.336] -- 0:00:16
731500 -- (-912.327) (-913.638) (-915.698) [-914.528] * (-913.265) (-915.593) [-913.889] (-915.850) -- 0:00:16
732000 -- (-912.440) [-910.235] (-911.533) (-912.241) * (-912.722) (-915.589) (-914.869) [-914.468] -- 0:00:16
732500 -- (-911.993) [-912.393] (-911.835) (-910.194) * (-912.187) (-916.053) [-913.487] (-911.242) -- 0:00:16
733000 -- (-910.766) (-912.745) (-913.979) [-910.871] * (-912.008) (-915.100) [-910.802] (-911.451) -- 0:00:16
733500 -- (-911.551) [-909.953] (-918.331) (-911.993) * (-911.987) (-916.019) (-910.778) [-913.017] -- 0:00:16
734000 -- [-912.311] (-912.427) (-915.177) (-910.904) * (-910.114) [-913.035] (-910.704) (-913.459) -- 0:00:16
734500 -- (-910.509) [-913.763] (-913.389) (-911.510) * (-914.358) [-914.369] (-914.807) (-910.602) -- 0:00:16
735000 -- (-911.377) (-911.543) (-917.022) [-910.548] * [-911.824] (-919.316) (-920.485) (-912.707) -- 0:00:16
Average standard deviation of split frequencies: 0.009494
735500 -- [-914.365] (-910.836) (-910.160) (-913.222) * (-910.534) (-912.235) [-912.011] (-912.791) -- 0:00:16
736000 -- (-912.964) (-913.344) (-911.807) [-913.550] * (-914.030) [-910.439] (-911.753) (-915.935) -- 0:00:16
736500 -- (-915.324) (-913.938) [-910.444] (-911.712) * [-911.418] (-915.135) (-911.449) (-912.081) -- 0:00:16
737000 -- (-913.491) (-912.142) (-911.813) [-912.326] * (-914.159) (-911.761) (-910.750) [-911.400] -- 0:00:16
737500 -- (-913.726) (-911.494) (-913.978) [-911.968] * [-910.351] (-912.987) (-910.849) (-912.491) -- 0:00:16
738000 -- (-912.549) [-911.785] (-913.235) (-916.574) * [-910.476] (-909.989) (-911.741) (-910.979) -- 0:00:15
738500 -- (-913.612) [-913.929] (-910.719) (-912.948) * (-911.689) (-909.576) (-911.281) [-911.851] -- 0:00:15
739000 -- [-913.749] (-912.479) (-912.747) (-913.100) * (-910.763) [-912.362] (-913.937) (-911.643) -- 0:00:15
739500 -- (-913.293) (-910.931) (-911.920) [-914.690] * (-916.782) [-910.331] (-910.060) (-910.280) -- 0:00:15
740000 -- (-915.373) (-914.775) [-912.457] (-911.089) * (-916.977) [-911.436] (-913.964) (-912.483) -- 0:00:15
Average standard deviation of split frequencies: 0.009322
740500 -- (-910.118) [-913.750] (-911.091) (-914.220) * (-911.369) (-912.469) [-910.439] (-911.186) -- 0:00:15
741000 -- (-912.726) [-913.213] (-911.539) (-915.658) * (-913.825) (-911.665) [-911.058] (-912.018) -- 0:00:15
741500 -- (-914.866) [-917.119] (-911.484) (-914.488) * [-911.687] (-911.006) (-912.303) (-912.055) -- 0:00:15
742000 -- (-914.076) [-911.222] (-911.425) (-912.674) * (-910.829) (-910.572) [-912.349] (-911.504) -- 0:00:15
742500 -- (-911.294) [-910.984] (-910.761) (-911.359) * (-910.228) (-912.440) (-915.559) [-912.099] -- 0:00:15
743000 -- (-913.161) (-912.337) (-910.535) [-910.165] * [-913.828] (-912.362) (-913.598) (-911.732) -- 0:00:15
743500 -- (-911.854) (-913.652) [-913.375] (-918.404) * [-911.682] (-911.306) (-910.856) (-912.000) -- 0:00:15
744000 -- (-912.402) [-910.796] (-911.126) (-918.213) * (-910.572) (-916.514) (-913.672) [-910.779] -- 0:00:15
744500 -- (-910.657) (-915.540) [-912.471] (-911.611) * (-912.434) (-911.692) [-911.018] (-910.978) -- 0:00:15
745000 -- [-911.817] (-915.419) (-910.910) (-913.013) * (-910.882) [-910.101] (-914.868) (-912.019) -- 0:00:15
Average standard deviation of split frequencies: 0.009256
745500 -- (-913.599) (-914.547) (-910.592) [-914.226] * (-911.238) (-911.578) (-911.831) [-911.498] -- 0:00:15
746000 -- (-914.654) (-914.794) [-910.975] (-912.536) * (-911.103) (-911.408) (-910.733) [-913.611] -- 0:00:15
746500 -- (-914.943) (-912.322) (-912.498) [-911.026] * (-910.071) (-913.291) (-915.270) [-913.982] -- 0:00:15
747000 -- (-915.457) [-912.249] (-913.306) (-910.745) * (-909.854) [-913.724] (-914.553) (-915.742) -- 0:00:15
747500 -- (-912.091) [-912.849] (-911.412) (-910.814) * [-911.725] (-912.135) (-912.153) (-917.382) -- 0:00:15
748000 -- [-909.961] (-910.909) (-914.963) (-912.087) * [-909.537] (-911.797) (-910.840) (-913.969) -- 0:00:15
748500 -- (-911.022) (-912.069) [-910.226] (-911.518) * (-913.301) (-916.639) (-911.569) [-912.066] -- 0:00:15
749000 -- (-911.014) [-911.918] (-913.002) (-911.441) * (-910.639) (-913.621) (-910.813) [-912.674] -- 0:00:15
749500 -- (-912.483) (-915.551) (-911.147) [-916.058] * (-913.363) [-911.018] (-912.618) (-912.929) -- 0:00:15
750000 -- (-911.739) [-914.154] (-910.049) (-910.730) * (-916.419) (-915.580) (-912.659) [-910.315] -- 0:00:15
Average standard deviation of split frequencies: 0.009531
750500 -- (-912.125) (-912.743) [-910.731] (-911.460) * [-911.010] (-913.975) (-912.036) (-910.311) -- 0:00:15
751000 -- (-912.071) (-913.407) (-912.557) [-912.037] * (-911.140) [-911.519] (-910.177) (-912.330) -- 0:00:15
751500 -- (-911.055) [-914.384] (-912.107) (-914.144) * (-912.860) (-911.540) (-913.407) [-914.936] -- 0:00:15
752000 -- (-914.064) [-914.105] (-911.266) (-915.755) * (-910.578) (-911.591) [-912.778] (-916.015) -- 0:00:15
752500 -- (-915.674) (-914.824) [-910.572] (-913.396) * (-913.180) [-912.954] (-911.641) (-915.831) -- 0:00:15
753000 -- [-914.855] (-911.388) (-913.189) (-917.856) * [-912.878] (-913.158) (-911.469) (-917.822) -- 0:00:15
753500 -- (-915.557) (-911.927) [-910.993] (-917.199) * (-912.795) [-910.046] (-912.341) (-914.280) -- 0:00:15
754000 -- (-917.065) [-910.625] (-912.875) (-914.354) * (-912.668) (-912.886) (-912.886) [-913.526] -- 0:00:15
754500 -- (-918.211) (-910.670) [-912.980] (-913.587) * (-912.838) [-911.799] (-909.901) (-913.715) -- 0:00:14
755000 -- (-914.869) (-912.380) [-911.911] (-913.038) * [-912.707] (-912.016) (-913.842) (-915.238) -- 0:00:14
Average standard deviation of split frequencies: 0.009427
755500 -- [-910.797] (-913.168) (-912.823) (-911.837) * (-910.290) (-910.323) (-915.461) [-915.186] -- 0:00:14
756000 -- (-911.634) (-912.902) (-910.989) [-910.842] * (-911.820) (-913.653) (-911.523) [-911.109] -- 0:00:14
756500 -- (-911.904) (-913.571) [-910.671] (-912.252) * (-913.631) (-914.984) (-909.507) [-910.072] -- 0:00:14
757000 -- [-911.190] (-910.459) (-912.464) (-912.698) * (-913.493) (-912.350) [-911.130] (-909.899) -- 0:00:14
757500 -- (-913.417) (-916.989) [-914.098] (-911.029) * (-913.467) (-913.894) [-912.134] (-914.012) -- 0:00:14
758000 -- (-910.742) (-911.991) (-910.791) [-911.444] * (-912.388) (-912.356) [-915.498] (-917.670) -- 0:00:14
758500 -- [-911.078] (-911.824) (-911.817) (-912.827) * (-913.276) (-912.474) (-915.034) [-918.732] -- 0:00:14
759000 -- (-915.118) (-912.037) (-912.497) [-910.302] * [-911.279] (-916.353) (-912.987) (-911.701) -- 0:00:14
759500 -- (-918.529) (-910.072) (-911.002) [-910.270] * (-914.153) [-911.226] (-912.487) (-911.326) -- 0:00:14
760000 -- (-914.936) (-909.978) [-911.038] (-911.584) * (-911.379) (-910.307) (-910.844) [-910.219] -- 0:00:14
Average standard deviation of split frequencies: 0.009041
760500 -- (-911.089) (-913.818) [-911.105] (-912.884) * [-911.622] (-910.338) (-912.768) (-911.439) -- 0:00:14
761000 -- (-912.392) [-910.331] (-913.973) (-911.039) * (-911.769) [-909.772] (-910.338) (-910.314) -- 0:00:14
761500 -- (-910.319) (-913.332) [-916.619] (-911.754) * (-913.112) (-911.715) [-914.228] (-911.141) -- 0:00:14
762000 -- (-910.907) [-911.068] (-910.530) (-914.658) * [-913.015] (-913.883) (-910.711) (-912.502) -- 0:00:14
762500 -- (-912.142) (-914.478) [-912.874] (-910.601) * (-912.998) [-913.239] (-910.741) (-909.618) -- 0:00:14
763000 -- (-912.749) (-912.580) (-914.929) [-910.608] * (-913.921) (-920.064) (-912.832) [-909.736] -- 0:00:14
763500 -- (-911.936) [-911.247] (-912.521) (-910.868) * (-912.474) (-913.401) [-911.198] (-910.215) -- 0:00:14
764000 -- (-910.437) (-911.119) [-910.565] (-910.105) * (-913.091) (-913.256) (-911.684) [-912.308] -- 0:00:14
764500 -- [-911.000] (-911.469) (-911.772) (-911.198) * [-912.397] (-910.548) (-912.780) (-912.693) -- 0:00:14
765000 -- (-910.646) [-912.396] (-911.588) (-913.630) * [-910.310] (-910.723) (-912.901) (-914.104) -- 0:00:14
Average standard deviation of split frequencies: 0.009955
765500 -- [-911.702] (-911.227) (-910.518) (-910.176) * (-911.127) (-913.505) (-910.373) [-910.958] -- 0:00:14
766000 -- (-913.519) (-912.496) (-913.391) [-910.952] * [-911.699] (-913.852) (-914.981) (-912.234) -- 0:00:14
766500 -- (-913.967) (-911.010) (-911.917) [-911.358] * (-910.330) (-913.986) [-911.840] (-911.906) -- 0:00:14
767000 -- (-911.859) (-912.796) [-913.109] (-915.405) * (-911.688) (-913.389) [-919.048] (-912.346) -- 0:00:14
767500 -- [-911.991] (-910.645) (-912.339) (-911.496) * [-911.283] (-912.385) (-911.291) (-912.813) -- 0:00:14
768000 -- (-911.526) [-911.067] (-913.720) (-914.285) * (-912.085) (-913.636) [-912.717] (-911.487) -- 0:00:14
768500 -- (-911.933) (-911.473) [-910.759] (-911.076) * (-912.706) [-911.440] (-913.621) (-910.861) -- 0:00:14
769000 -- (-911.368) (-912.645) (-912.665) [-912.468] * (-913.823) [-911.402] (-912.917) (-911.945) -- 0:00:14
769500 -- (-911.649) (-913.480) [-911.636] (-910.263) * (-913.203) (-910.806) (-911.481) [-911.475] -- 0:00:14
770000 -- [-911.771] (-920.314) (-917.689) (-910.505) * (-911.691) (-913.945) [-910.789] (-911.855) -- 0:00:14
Average standard deviation of split frequencies: 0.010003
770500 -- (-911.464) [-914.292] (-912.830) (-910.670) * [-911.180] (-913.501) (-913.924) (-912.985) -- 0:00:13
771000 -- (-912.032) (-911.304) (-912.414) [-910.968] * (-910.401) (-912.268) (-912.507) [-911.751] -- 0:00:13
771500 -- (-915.137) (-911.834) (-912.698) [-912.379] * [-910.857] (-912.094) (-915.556) (-911.988) -- 0:00:13
772000 -- (-916.421) [-912.295] (-915.178) (-913.402) * (-911.820) [-914.633] (-913.020) (-914.173) -- 0:00:13
772500 -- (-912.194) [-915.391] (-914.296) (-916.650) * (-912.890) (-912.941) [-912.387] (-910.907) -- 0:00:13
773000 -- (-912.347) [-915.956] (-911.832) (-914.179) * (-911.133) (-910.728) (-912.104) [-912.625] -- 0:00:13
773500 -- (-911.548) (-914.245) (-911.571) [-911.119] * (-910.360) (-912.380) (-911.063) [-910.037] -- 0:00:13
774000 -- (-914.317) [-915.229] (-911.849) (-911.587) * (-911.971) [-911.229] (-912.208) (-911.816) -- 0:00:13
774500 -- (-911.186) (-910.672) [-911.497] (-911.404) * (-912.476) (-909.821) (-912.475) [-910.783] -- 0:00:13
775000 -- (-911.964) (-911.402) (-910.097) [-912.651] * (-911.889) [-915.190] (-915.171) (-912.558) -- 0:00:13
Average standard deviation of split frequencies: 0.009684
775500 -- (-912.659) (-911.089) [-910.278] (-911.269) * (-912.965) (-918.679) [-911.125] (-911.567) -- 0:00:13
776000 -- (-912.713) (-911.288) (-915.632) [-912.527] * (-911.364) (-917.211) [-912.193] (-913.311) -- 0:00:13
776500 -- (-912.235) (-914.128) (-911.085) [-912.087] * (-911.870) [-912.769] (-912.826) (-916.712) -- 0:00:13
777000 -- [-914.164] (-911.861) (-911.651) (-913.153) * (-914.480) (-911.526) (-911.732) [-910.482] -- 0:00:13
777500 -- (-913.813) (-909.924) [-911.836] (-910.552) * (-911.422) [-911.586] (-911.544) (-911.060) -- 0:00:13
778000 -- [-910.001] (-909.988) (-910.614) (-909.927) * (-912.076) [-911.701] (-911.975) (-909.746) -- 0:00:13
778500 -- [-910.541] (-910.048) (-914.028) (-912.172) * (-911.275) [-911.531] (-912.567) (-910.902) -- 0:00:13
779000 -- (-912.536) [-914.320] (-913.294) (-910.510) * (-911.714) (-912.580) [-912.549] (-910.652) -- 0:00:13
779500 -- (-910.911) (-911.610) [-912.310] (-910.310) * (-912.117) (-910.773) [-909.827] (-910.859) -- 0:00:13
780000 -- (-912.201) (-911.871) [-911.816] (-913.218) * (-912.931) [-911.722] (-917.127) (-915.968) -- 0:00:13
Average standard deviation of split frequencies: 0.009839
780500 -- (-913.530) (-911.999) [-912.924] (-913.358) * (-912.225) (-914.082) [-911.468] (-910.264) -- 0:00:13
781000 -- (-913.788) (-911.958) [-912.914] (-910.785) * (-910.266) (-912.614) [-912.183] (-912.040) -- 0:00:13
781500 -- (-911.949) (-914.674) (-911.692) [-912.053] * (-911.308) [-912.304] (-913.213) (-914.608) -- 0:00:13
782000 -- (-912.716) [-912.693] (-910.802) (-912.044) * [-912.019] (-912.752) (-911.308) (-915.347) -- 0:00:13
782500 -- (-912.647) [-912.228] (-911.158) (-911.544) * (-911.575) [-920.101] (-913.987) (-913.710) -- 0:00:13
783000 -- (-911.686) (-911.078) [-912.203] (-914.873) * (-910.950) (-916.515) (-915.573) [-912.545] -- 0:00:13
783500 -- (-911.387) (-910.412) [-911.276] (-914.215) * (-910.728) (-912.656) (-912.829) [-913.766] -- 0:00:13
784000 -- [-909.800] (-915.266) (-918.259) (-912.245) * [-913.175] (-910.807) (-911.748) (-912.119) -- 0:00:13
784500 -- (-911.021) (-916.722) [-911.455] (-914.642) * (-913.427) (-911.847) [-911.337] (-910.936) -- 0:00:13
785000 -- (-913.232) (-911.713) [-912.146] (-913.205) * (-910.544) (-911.616) [-911.124] (-911.812) -- 0:00:13
Average standard deviation of split frequencies: 0.010055
785500 -- [-912.186] (-914.858) (-912.949) (-914.396) * (-911.657) [-914.875] (-912.548) (-911.655) -- 0:00:13
786000 -- (-911.416) [-914.391] (-910.129) (-912.228) * (-913.799) [-911.446] (-911.502) (-913.713) -- 0:00:13
786500 -- (-914.533) (-910.545) (-917.401) [-910.542] * (-911.702) (-919.464) [-911.000] (-911.436) -- 0:00:13
787000 -- (-912.633) (-913.553) [-912.811] (-912.240) * (-911.791) (-914.120) (-911.061) [-914.105] -- 0:00:12
787500 -- (-916.282) (-912.226) [-910.488] (-911.107) * (-911.236) (-912.818) [-910.423] (-910.755) -- 0:00:12
788000 -- (-910.071) (-912.445) (-910.131) [-911.055] * (-911.478) (-917.129) [-913.833] (-913.575) -- 0:00:12
788500 -- (-913.755) (-912.272) (-910.093) [-913.222] * (-912.196) (-914.270) [-910.991] (-911.668) -- 0:00:12
789000 -- (-912.601) (-912.167) (-912.430) [-911.611] * (-913.448) (-913.222) (-911.784) [-911.934] -- 0:00:12
789500 -- (-911.817) [-913.159] (-914.358) (-911.678) * [-912.887] (-913.070) (-911.968) (-912.216) -- 0:00:12
790000 -- (-912.732) [-912.310] (-911.527) (-912.825) * (-913.362) (-910.942) (-910.662) [-912.226] -- 0:00:12
Average standard deviation of split frequencies: 0.009820
790500 -- (-915.555) [-911.561] (-911.584) (-910.609) * [-913.321] (-910.265) (-913.120) (-912.948) -- 0:00:12
791000 -- (-912.113) [-916.326] (-913.088) (-911.023) * (-911.896) [-913.912] (-914.299) (-915.437) -- 0:00:12
791500 -- (-911.584) [-910.451] (-913.196) (-912.972) * (-911.480) (-912.043) [-916.915] (-913.973) -- 0:00:12
792000 -- (-914.857) [-911.883] (-914.863) (-913.464) * (-910.894) (-910.699) [-911.182] (-910.919) -- 0:00:12
792500 -- (-928.849) (-914.263) (-910.604) [-909.810] * (-912.194) (-913.854) (-910.762) [-911.585] -- 0:00:12
793000 -- (-915.232) (-916.922) [-911.494] (-911.190) * [-912.083] (-912.617) (-911.035) (-910.523) -- 0:00:12
793500 -- [-911.673] (-911.475) (-910.933) (-910.512) * (-912.505) (-913.364) (-912.721) [-912.087] -- 0:00:12
794000 -- (-912.523) (-911.886) (-909.585) [-909.695] * [-910.001] (-911.767) (-912.368) (-911.823) -- 0:00:12
794500 -- (-912.120) [-911.229] (-911.454) (-916.078) * (-910.553) (-910.590) [-910.227] (-914.058) -- 0:00:12
795000 -- [-911.611] (-911.321) (-913.095) (-912.080) * (-911.214) (-910.589) (-910.278) [-916.251] -- 0:00:12
Average standard deviation of split frequencies: 0.009789
795500 -- [-912.289] (-912.124) (-912.375) (-911.954) * (-911.672) (-912.582) [-913.623] (-912.007) -- 0:00:12
796000 -- (-915.187) (-914.205) (-913.610) [-912.534] * (-911.866) (-912.933) (-910.696) [-911.904] -- 0:00:12
796500 -- (-910.773) (-911.957) (-910.790) [-914.565] * (-914.274) (-913.013) [-910.477] (-912.792) -- 0:00:12
797000 -- (-913.832) (-911.790) (-916.817) [-910.862] * (-914.659) (-910.733) (-912.243) [-911.675] -- 0:00:12
797500 -- (-913.604) (-912.644) [-910.209] (-910.276) * (-914.310) [-911.085] (-911.005) (-911.608) -- 0:00:12
798000 -- (-912.695) (-911.108) [-914.757] (-910.277) * (-912.279) [-913.661] (-910.119) (-910.470) -- 0:00:12
798500 -- [-914.863] (-912.357) (-914.028) (-910.667) * (-912.071) (-913.102) [-910.767] (-914.208) -- 0:00:12
799000 -- (-916.498) (-911.390) [-915.317] (-910.547) * [-911.016] (-917.558) (-912.309) (-912.200) -- 0:00:12
799500 -- [-911.053] (-911.176) (-913.167) (-912.024) * (-912.385) (-912.213) [-913.503] (-914.674) -- 0:00:12
800000 -- (-910.978) (-911.846) [-911.580] (-914.368) * (-911.347) (-911.120) [-914.123] (-914.043) -- 0:00:12
Average standard deviation of split frequencies: 0.009697
800500 -- [-910.705] (-913.226) (-911.828) (-912.032) * (-911.175) (-911.921) (-911.398) [-909.926] -- 0:00:12
801000 -- (-910.679) (-913.031) [-912.506] (-912.445) * (-910.432) [-910.803] (-915.613) (-912.704) -- 0:00:12
801500 -- (-910.210) (-910.706) (-916.354) [-910.590] * (-910.334) (-911.016) [-910.662] (-911.374) -- 0:00:12
802000 -- (-913.223) [-911.319] (-910.098) (-910.915) * (-910.787) [-912.087] (-914.730) (-916.985) -- 0:00:12
802500 -- [-911.786] (-913.584) (-910.461) (-912.245) * (-912.073) (-914.539) [-910.945] (-912.441) -- 0:00:12
803000 -- [-910.898] (-914.227) (-912.189) (-912.190) * (-913.669) (-911.811) (-909.981) [-913.684] -- 0:00:12
803500 -- (-913.239) (-910.382) [-910.567] (-910.743) * (-913.359) (-911.819) [-911.169] (-911.569) -- 0:00:11
804000 -- (-919.211) (-911.650) [-913.436] (-914.478) * (-914.751) (-912.438) [-912.299] (-911.196) -- 0:00:11
804500 -- (-915.643) (-911.702) (-912.377) [-913.435] * (-912.898) (-911.983) [-912.097] (-913.404) -- 0:00:11
805000 -- [-914.258] (-915.329) (-910.347) (-912.785) * (-912.627) (-910.234) [-910.304] (-910.573) -- 0:00:11
Average standard deviation of split frequencies: 0.009530
805500 -- (-911.292) [-911.639] (-914.941) (-911.997) * [-911.428] (-912.846) (-918.027) (-915.315) -- 0:00:11
806000 -- [-909.882] (-913.204) (-914.457) (-915.625) * [-911.657] (-916.093) (-911.593) (-915.546) -- 0:00:11
806500 -- (-910.811) [-914.598] (-914.111) (-910.858) * [-911.046] (-910.456) (-912.422) (-912.393) -- 0:00:11
807000 -- (-910.833) [-912.725] (-915.999) (-910.284) * [-911.117] (-911.786) (-910.769) (-912.144) -- 0:00:11
807500 -- (-911.523) (-911.601) (-912.916) [-910.681] * [-914.326] (-911.885) (-912.449) (-909.870) -- 0:00:11
808000 -- (-913.874) (-912.459) [-914.880] (-911.400) * (-912.528) [-913.763] (-912.223) (-910.917) -- 0:00:11
808500 -- (-910.542) [-914.062] (-913.469) (-911.864) * [-913.273] (-910.487) (-912.499) (-914.861) -- 0:00:11
809000 -- [-911.082] (-913.211) (-912.392) (-912.117) * (-912.138) [-912.001] (-915.356) (-910.557) -- 0:00:11
809500 -- (-911.218) (-912.716) [-911.477] (-911.827) * (-912.382) (-910.048) [-914.003] (-912.886) -- 0:00:11
810000 -- (-911.759) (-911.047) [-910.187] (-913.857) * (-913.249) (-911.679) (-914.696) [-910.392] -- 0:00:11
Average standard deviation of split frequencies: 0.009749
810500 -- (-912.658) (-911.116) [-912.821] (-910.770) * (-910.096) (-909.879) (-913.456) [-912.632] -- 0:00:11
811000 -- (-913.939) (-913.734) (-911.709) [-912.570] * (-914.242) [-911.288] (-917.006) (-910.815) -- 0:00:11
811500 -- (-914.813) (-912.902) [-910.259] (-915.216) * [-912.935] (-910.949) (-912.253) (-924.072) -- 0:00:11
812000 -- [-917.458] (-911.993) (-917.059) (-912.289) * [-910.424] (-912.926) (-912.126) (-913.715) -- 0:00:11
812500 -- (-921.551) (-910.716) (-912.329) [-912.245] * (-910.597) (-913.926) [-910.593] (-915.502) -- 0:00:11
813000 -- (-916.073) [-910.546] (-911.526) (-914.658) * [-910.300] (-912.409) (-910.594) (-910.066) -- 0:00:11
813500 -- (-911.336) (-910.591) [-912.734] (-914.605) * [-910.043] (-911.696) (-911.814) (-911.266) -- 0:00:11
814000 -- (-914.059) (-911.311) [-915.848] (-911.792) * [-910.790] (-911.319) (-911.659) (-910.884) -- 0:00:11
814500 -- (-916.435) (-909.746) [-914.500] (-910.645) * (-914.185) [-910.754] (-911.487) (-912.234) -- 0:00:11
815000 -- (-917.304) (-913.624) [-911.414] (-912.211) * (-914.497) (-911.751) [-911.920] (-917.183) -- 0:00:11
Average standard deviation of split frequencies: 0.009923
815500 -- (-915.256) [-911.582] (-911.132) (-915.914) * (-911.254) (-912.347) [-914.222] (-915.569) -- 0:00:11
816000 -- [-910.941] (-910.943) (-916.601) (-912.917) * (-911.343) [-910.629] (-911.023) (-910.540) -- 0:00:11
816500 -- (-910.541) (-910.587) [-910.874] (-914.912) * (-911.324) (-910.831) (-913.161) [-911.093] -- 0:00:11
817000 -- [-911.256] (-914.329) (-910.440) (-910.440) * [-911.701] (-911.772) (-912.557) (-913.236) -- 0:00:11
817500 -- (-912.702) (-915.957) [-911.564] (-911.066) * (-912.833) [-911.950] (-913.338) (-916.383) -- 0:00:11
818000 -- (-915.388) [-912.241] (-911.744) (-912.571) * (-913.279) [-911.875] (-914.650) (-911.953) -- 0:00:11
818500 -- (-922.984) (-911.919) [-912.094] (-913.268) * [-911.805] (-914.608) (-912.561) (-912.978) -- 0:00:11
819000 -- (-920.549) (-912.690) [-913.095] (-913.110) * (-914.326) (-910.873) (-915.618) [-914.221] -- 0:00:11
819500 -- (-914.468) (-909.910) (-913.467) [-915.669] * [-914.334] (-913.030) (-911.344) (-912.306) -- 0:00:11
820000 -- [-911.363] (-910.244) (-916.453) (-911.868) * (-917.112) [-911.764] (-913.820) (-911.175) -- 0:00:10
Average standard deviation of split frequencies: 0.009866
820500 -- (-913.420) (-913.022) (-910.585) [-913.517] * (-912.775) (-914.328) (-917.595) [-909.630] -- 0:00:10
821000 -- (-913.927) (-911.355) (-910.661) [-910.796] * (-910.621) [-912.533] (-916.854) (-914.004) -- 0:00:10
821500 -- (-913.026) [-911.664] (-912.424) (-910.515) * (-911.444) [-910.787] (-912.827) (-910.744) -- 0:00:10
822000 -- [-912.337] (-910.929) (-911.303) (-909.906) * (-911.546) (-910.629) [-911.628] (-910.631) -- 0:00:10
822500 -- [-909.968] (-913.469) (-913.875) (-912.263) * (-913.132) (-912.819) (-911.502) [-910.596] -- 0:00:10
823000 -- [-911.992] (-914.939) (-912.099) (-914.459) * (-911.224) (-913.001) [-910.138] (-914.803) -- 0:00:10
823500 -- (-919.041) [-912.017] (-911.519) (-912.007) * (-910.665) (-913.833) (-913.144) [-912.234] -- 0:00:10
824000 -- (-917.524) [-910.886] (-913.565) (-912.998) * (-912.811) (-916.106) [-910.615] (-915.340) -- 0:00:10
824500 -- [-910.138] (-910.636) (-911.739) (-911.627) * (-911.743) (-912.437) [-911.165] (-914.300) -- 0:00:10
825000 -- (-911.378) [-911.567] (-910.912) (-910.662) * (-913.017) [-910.307] (-915.701) (-912.095) -- 0:00:10
Average standard deviation of split frequencies: 0.009736
825500 -- (-910.586) (-911.166) (-914.958) [-912.137] * [-914.006] (-909.565) (-912.544) (-911.442) -- 0:00:10
826000 -- (-911.504) (-918.750) (-914.377) [-910.987] * (-911.724) (-910.316) [-914.304] (-910.211) -- 0:00:10
826500 -- [-911.782] (-911.548) (-914.891) (-911.004) * [-911.675] (-911.524) (-913.343) (-914.086) -- 0:00:10
827000 -- (-911.264) [-912.606] (-911.085) (-914.413) * (-912.518) [-912.039] (-912.242) (-914.113) -- 0:00:10
827500 -- [-914.787] (-912.540) (-911.304) (-911.304) * (-912.497) [-912.445] (-910.990) (-911.956) -- 0:00:10
828000 -- [-910.537] (-912.087) (-911.886) (-910.631) * (-912.512) (-911.259) [-910.688] (-914.446) -- 0:00:10
828500 -- (-911.350) [-911.004] (-909.777) (-910.655) * (-911.393) (-910.839) [-910.150] (-915.280) -- 0:00:10
829000 -- (-911.313) (-912.200) [-910.754] (-910.614) * (-914.404) (-911.916) (-911.098) [-914.961] -- 0:00:10
829500 -- (-913.761) (-910.163) (-911.482) [-913.661] * (-913.739) [-911.107] (-913.428) (-913.491) -- 0:00:10
830000 -- (-912.118) (-910.600) [-912.595] (-914.316) * (-911.383) [-910.479] (-911.812) (-913.553) -- 0:00:10
Average standard deviation of split frequencies: 0.009714
830500 -- (-915.020) [-909.808] (-913.068) (-911.906) * [-912.517] (-910.407) (-915.325) (-913.683) -- 0:00:10
831000 -- [-913.710] (-912.211) (-915.143) (-913.074) * [-910.539] (-909.673) (-912.124) (-913.921) -- 0:00:10
831500 -- (-911.425) (-914.167) [-912.190] (-912.518) * (-912.095) [-911.414] (-911.596) (-910.513) -- 0:00:10
832000 -- (-913.239) (-911.797) [-910.889] (-915.277) * (-911.412) (-912.541) (-912.455) [-914.248] -- 0:00:10
832500 -- (-911.811) (-915.791) [-910.515] (-912.782) * (-911.396) (-913.000) (-912.060) [-917.270] -- 0:00:10
833000 -- [-911.811] (-911.819) (-910.796) (-914.186) * [-910.713] (-912.744) (-914.853) (-913.961) -- 0:00:10
833500 -- (-912.144) [-910.562] (-913.983) (-913.157) * (-911.129) [-915.433] (-911.256) (-911.772) -- 0:00:10
834000 -- (-909.843) (-912.979) (-911.412) [-911.702] * (-912.453) (-911.928) [-910.471] (-912.764) -- 0:00:10
834500 -- (-910.762) (-911.735) [-912.857] (-911.415) * (-910.366) [-915.418] (-911.328) (-912.945) -- 0:00:10
835000 -- (-911.011) [-912.404] (-913.380) (-915.770) * (-915.464) (-914.166) (-916.354) [-910.573] -- 0:00:10
Average standard deviation of split frequencies: 0.009685
835500 -- (-911.919) (-910.189) (-915.740) [-910.092] * (-910.193) (-913.498) (-915.101) [-911.336] -- 0:00:10
836000 -- [-916.674] (-911.312) (-915.005) (-910.111) * (-911.751) [-913.658] (-911.605) (-916.165) -- 0:00:10
836500 -- (-913.839) (-910.541) (-912.569) [-909.849] * (-911.226) (-918.568) [-913.871] (-912.909) -- 0:00:09
837000 -- (-915.585) (-913.997) (-912.150) [-911.123] * (-910.673) (-911.923) (-914.473) [-915.771] -- 0:00:09
837500 -- (-915.684) (-913.036) (-913.637) [-910.439] * (-910.914) [-910.873] (-912.951) (-912.884) -- 0:00:09
838000 -- [-913.242] (-916.652) (-912.858) (-911.027) * (-912.741) [-912.931] (-911.185) (-914.489) -- 0:00:09
838500 -- (-912.536) [-910.971] (-910.824) (-911.036) * (-911.513) (-910.523) [-911.217] (-912.453) -- 0:00:09
839000 -- (-912.854) (-910.041) [-910.466] (-912.174) * [-909.980] (-912.023) (-911.793) (-914.990) -- 0:00:09
839500 -- (-914.831) (-914.400) [-910.359] (-913.335) * [-912.589] (-910.124) (-910.340) (-912.241) -- 0:00:09
840000 -- (-912.418) (-913.272) [-910.261] (-912.271) * (-915.016) (-909.796) [-910.562] (-911.267) -- 0:00:09
Average standard deviation of split frequencies: 0.009863
840500 -- (-911.574) (-916.975) (-913.186) [-909.852] * [-915.191] (-909.607) (-911.213) (-913.197) -- 0:00:09
841000 -- (-911.693) (-910.989) (-910.447) [-910.683] * [-911.900] (-911.591) (-912.003) (-912.808) -- 0:00:09
841500 -- [-909.886] (-911.478) (-909.659) (-911.267) * [-912.151] (-913.560) (-912.560) (-909.690) -- 0:00:09
842000 -- (-914.996) [-912.300] (-909.731) (-912.584) * [-910.435] (-911.714) (-914.929) (-912.569) -- 0:00:09
842500 -- (-912.469) [-912.649] (-912.325) (-912.198) * (-910.195) (-919.252) (-912.003) [-912.313] -- 0:00:09
843000 -- (-912.106) (-912.413) [-913.182] (-910.762) * (-910.365) [-910.231] (-911.823) (-912.138) -- 0:00:09
843500 -- (-912.044) [-912.837] (-916.793) (-914.680) * [-912.745] (-911.181) (-912.938) (-913.035) -- 0:00:09
844000 -- (-912.048) [-912.765] (-915.276) (-910.270) * (-911.954) (-911.094) [-910.541] (-913.875) -- 0:00:09
844500 -- (-912.254) [-913.997] (-915.375) (-912.677) * (-911.400) (-910.849) [-910.740] (-913.864) -- 0:00:09
845000 -- [-911.400] (-910.816) (-911.698) (-911.700) * (-916.675) (-910.439) [-910.171] (-913.860) -- 0:00:09
Average standard deviation of split frequencies: 0.009637
845500 -- (-911.031) [-913.094] (-914.127) (-911.720) * (-912.828) (-913.253) (-913.580) [-912.168] -- 0:00:09
846000 -- (-911.732) [-911.199] (-911.043) (-911.520) * [-912.374] (-914.355) (-912.007) (-911.626) -- 0:00:09
846500 -- (-910.596) (-912.380) (-911.588) [-910.901] * (-911.908) (-910.008) (-911.965) [-913.395] -- 0:00:09
847000 -- [-911.248] (-911.895) (-912.218) (-911.303) * (-911.413) (-912.631) [-911.185] (-912.377) -- 0:00:09
847500 -- (-912.720) (-911.734) [-910.585] (-909.967) * (-912.858) [-909.994] (-915.772) (-912.912) -- 0:00:09
848000 -- [-915.487] (-910.322) (-912.257) (-919.361) * (-913.008) (-910.872) [-911.388] (-912.991) -- 0:00:09
848500 -- (-910.294) (-913.571) (-914.211) [-912.780] * (-911.173) (-910.947) [-911.086] (-909.687) -- 0:00:09
849000 -- (-910.961) (-914.941) [-911.907] (-912.361) * [-911.691] (-912.822) (-913.367) (-909.662) -- 0:00:09
849500 -- [-910.504] (-911.928) (-913.209) (-916.334) * (-914.059) (-912.594) [-911.961] (-911.228) -- 0:00:09
850000 -- (-910.304) [-909.915] (-911.990) (-914.012) * (-918.203) (-911.389) [-909.932] (-911.142) -- 0:00:09
Average standard deviation of split frequencies: 0.009942
850500 -- (-911.105) [-911.652] (-914.088) (-912.457) * (-909.729) (-911.662) (-916.021) [-911.588] -- 0:00:09
851000 -- (-911.099) (-911.591) [-911.534] (-913.675) * (-911.578) (-910.579) (-913.488) [-911.626] -- 0:00:09
851500 -- (-912.472) (-912.950) [-911.585] (-911.502) * (-909.875) [-912.187] (-912.999) (-912.555) -- 0:00:09
852000 -- (-911.523) [-913.957] (-912.794) (-914.273) * [-910.295] (-913.566) (-915.024) (-913.204) -- 0:00:09
852500 -- (-913.839) (-910.578) (-913.909) [-912.967] * [-915.981] (-915.636) (-914.600) (-914.043) -- 0:00:08
853000 -- (-913.574) (-911.011) [-912.150] (-912.557) * (-910.555) (-916.568) [-911.266] (-912.903) -- 0:00:08
853500 -- [-912.626] (-914.892) (-919.195) (-909.982) * (-911.578) (-916.195) (-913.017) [-913.994] -- 0:00:08
854000 -- (-910.924) (-911.612) (-917.139) [-911.209] * (-911.787) (-915.299) (-912.887) [-911.011] -- 0:00:08
854500 -- [-913.570] (-910.670) (-912.429) (-911.747) * (-911.567) (-912.172) (-912.037) [-914.957] -- 0:00:08
855000 -- (-913.466) (-912.239) [-910.259] (-911.791) * [-914.274] (-912.620) (-913.355) (-913.593) -- 0:00:08
Average standard deviation of split frequencies: 0.009880
855500 -- (-910.737) (-910.947) (-912.039) [-911.540] * (-911.539) [-912.224] (-914.414) (-910.316) -- 0:00:08
856000 -- (-911.706) (-912.652) (-911.661) [-913.644] * (-912.444) (-914.918) (-912.586) [-910.686] -- 0:00:08
856500 -- (-916.409) [-910.434] (-911.315) (-910.935) * (-913.009) (-912.659) [-911.331] (-918.519) -- 0:00:08
857000 -- (-914.617) (-910.516) (-912.418) [-910.155] * (-910.341) (-912.981) (-914.363) [-921.175] -- 0:00:08
857500 -- [-913.643] (-911.498) (-911.425) (-912.277) * [-910.882] (-912.932) (-913.530) (-918.176) -- 0:00:08
858000 -- [-911.674] (-910.943) (-912.098) (-911.629) * [-911.539] (-915.829) (-910.569) (-918.831) -- 0:00:08
858500 -- (-914.004) [-910.720] (-915.101) (-912.119) * (-910.305) [-912.752] (-917.442) (-912.712) -- 0:00:08
859000 -- [-915.045] (-910.861) (-911.011) (-910.454) * (-910.895) (-921.420) [-915.276] (-913.019) -- 0:00:08
859500 -- [-912.746] (-913.649) (-910.637) (-912.138) * (-910.696) [-916.193] (-913.113) (-911.578) -- 0:00:08
860000 -- (-910.917) (-911.798) [-912.827] (-915.292) * (-912.300) [-910.645] (-912.295) (-910.130) -- 0:00:08
Average standard deviation of split frequencies: 0.009962
860500 -- [-910.916] (-912.378) (-913.786) (-910.714) * (-910.670) (-912.721) (-909.914) [-915.222] -- 0:00:08
861000 -- (-912.537) (-911.609) (-918.432) [-913.329] * (-910.993) (-910.917) [-911.045] (-915.332) -- 0:00:08
861500 -- (-917.408) (-912.285) (-910.949) [-909.832] * (-910.356) (-910.364) (-911.091) [-910.906] -- 0:00:08
862000 -- (-913.193) (-910.321) (-911.173) [-910.619] * (-911.251) (-913.247) [-910.025] (-913.113) -- 0:00:08
862500 -- (-911.411) [-910.394] (-913.376) (-912.233) * (-914.895) (-916.254) (-910.950) [-910.334] -- 0:00:08
863000 -- (-911.388) [-912.890] (-913.510) (-911.622) * (-914.845) [-911.773] (-910.555) (-910.380) -- 0:00:08
863500 -- (-911.895) (-910.682) [-913.477] (-910.196) * (-911.404) (-912.163) (-913.560) [-912.104] -- 0:00:08
864000 -- (-909.950) [-911.579] (-912.663) (-910.941) * (-911.163) [-910.254] (-912.530) (-913.710) -- 0:00:08
864500 -- [-910.691] (-913.518) (-911.510) (-913.446) * [-913.550] (-917.856) (-912.296) (-913.059) -- 0:00:08
865000 -- (-910.669) (-910.871) [-911.726] (-910.292) * (-910.148) [-911.728] (-911.670) (-911.463) -- 0:00:08
Average standard deviation of split frequencies: 0.010309
865500 -- (-911.576) [-915.594] (-911.606) (-912.068) * (-910.762) [-914.609] (-914.293) (-910.733) -- 0:00:08
866000 -- [-912.900] (-912.909) (-914.757) (-915.357) * [-910.132] (-911.741) (-911.082) (-911.257) -- 0:00:08
866500 -- (-911.516) (-913.275) [-913.147] (-913.101) * (-914.535) (-912.014) (-912.534) [-912.061] -- 0:00:08
867000 -- (-913.981) [-913.552] (-912.573) (-911.547) * (-912.079) (-916.407) (-911.422) [-913.274] -- 0:00:08
867500 -- [-912.291] (-912.948) (-916.522) (-912.365) * (-911.950) (-913.366) (-911.465) [-910.891] -- 0:00:08
868000 -- (-910.991) (-911.689) (-913.900) [-914.867] * (-912.284) (-915.426) [-910.459] (-910.521) -- 0:00:08
868500 -- (-909.806) (-915.888) [-913.053] (-912.519) * (-911.471) (-910.636) [-912.581] (-912.278) -- 0:00:08
869000 -- (-914.359) (-915.413) [-911.604] (-910.846) * (-913.804) (-913.673) [-910.556] (-909.957) -- 0:00:07
869500 -- (-913.249) [-912.530] (-911.541) (-909.961) * (-912.672) (-915.621) [-910.475] (-911.800) -- 0:00:07
870000 -- (-916.261) [-910.588] (-910.556) (-911.754) * (-911.200) [-911.980] (-911.507) (-911.675) -- 0:00:07
Average standard deviation of split frequencies: 0.010795
870500 -- (-912.330) [-910.719] (-910.847) (-910.174) * (-913.832) [-914.110] (-911.466) (-910.574) -- 0:00:07
871000 -- (-911.045) (-909.773) [-911.207] (-912.590) * (-913.873) [-911.468] (-910.017) (-911.620) -- 0:00:07
871500 -- [-914.060] (-909.773) (-911.268) (-911.616) * (-914.022) [-912.216] (-910.767) (-913.929) -- 0:00:07
872000 -- (-914.576) (-911.251) [-913.033] (-912.239) * (-914.478) [-911.912] (-910.664) (-912.432) -- 0:00:07
872500 -- [-910.151] (-910.882) (-910.710) (-909.684) * (-913.292) (-915.478) [-914.963] (-910.599) -- 0:00:07
873000 -- (-912.770) (-910.454) [-911.324] (-913.548) * (-913.223) (-910.578) (-914.520) [-912.609] -- 0:00:07
873500 -- (-910.929) [-910.306] (-914.725) (-915.922) * (-912.563) (-910.935) (-918.269) [-911.110] -- 0:00:07
874000 -- (-910.804) (-910.724) (-915.813) [-912.628] * [-914.436] (-912.037) (-910.808) (-914.041) -- 0:00:07
874500 -- (-911.974) (-912.020) (-912.300) [-910.194] * [-914.450] (-914.965) (-910.608) (-910.891) -- 0:00:07
875000 -- (-913.814) (-911.306) (-911.492) [-910.117] * (-912.073) [-911.465] (-910.464) (-910.308) -- 0:00:07
Average standard deviation of split frequencies: 0.011065
875500 -- (-913.168) (-911.536) (-912.783) [-910.775] * [-913.044] (-911.898) (-915.681) (-912.248) -- 0:00:07
876000 -- [-911.788] (-911.798) (-910.962) (-911.412) * (-912.443) (-912.673) (-912.155) [-911.866] -- 0:00:07
876500 -- [-913.036] (-910.723) (-911.818) (-910.958) * [-912.197] (-911.972) (-913.500) (-914.730) -- 0:00:07
877000 -- [-912.048] (-912.844) (-910.851) (-911.566) * (-910.560) [-911.805] (-910.693) (-915.663) -- 0:00:07
877500 -- (-912.276) [-918.791] (-912.060) (-916.416) * (-912.952) (-911.419) (-911.798) [-916.574] -- 0:00:07
878000 -- [-911.526] (-914.054) (-910.789) (-914.092) * (-914.021) (-910.934) (-913.637) [-912.562] -- 0:00:07
878500 -- [-911.666] (-914.676) (-912.013) (-911.071) * (-914.354) (-910.621) (-912.748) [-913.002] -- 0:00:07
879000 -- (-912.917) [-913.331] (-909.823) (-915.364) * [-911.257] (-911.088) (-911.638) (-909.856) -- 0:00:07
879500 -- (-915.304) (-911.547) [-911.658] (-917.488) * (-914.291) (-911.405) (-910.454) [-912.079] -- 0:00:07
880000 -- [-910.579] (-916.173) (-912.916) (-911.345) * (-910.349) (-911.678) [-910.377] (-910.063) -- 0:00:07
Average standard deviation of split frequencies: 0.010839
880500 -- (-911.021) (-921.305) (-911.661) [-910.873] * (-915.093) (-911.441) [-910.410] (-911.701) -- 0:00:07
881000 -- [-910.273] (-916.741) (-910.382) (-913.980) * (-911.903) (-910.574) (-912.211) [-911.378] -- 0:00:07
881500 -- (-910.269) (-910.984) [-912.233] (-911.100) * (-911.274) [-909.786] (-910.810) (-911.770) -- 0:00:07
882000 -- (-913.410) (-911.468) (-911.705) [-913.856] * (-911.664) [-909.788] (-912.010) (-910.867) -- 0:00:07
882500 -- (-911.515) [-911.119] (-910.781) (-913.498) * (-913.114) [-910.418] (-911.060) (-912.524) -- 0:00:07
883000 -- (-914.114) (-914.394) (-912.752) [-914.277] * (-914.018) (-911.292) (-910.975) [-912.720] -- 0:00:07
883500 -- (-911.304) (-911.460) [-909.945] (-910.313) * (-912.123) (-914.061) [-911.038] (-915.017) -- 0:00:07
884000 -- (-911.278) (-911.480) [-909.958] (-912.020) * [-909.639] (-910.015) (-912.437) (-913.928) -- 0:00:07
884500 -- (-911.121) (-910.662) [-911.026] (-912.157) * [-910.907] (-912.283) (-913.638) (-914.585) -- 0:00:07
885000 -- (-911.896) (-914.431) (-912.366) [-912.215] * (-911.892) (-919.853) (-912.994) [-914.815] -- 0:00:07
Average standard deviation of split frequencies: 0.010342
885500 -- [-911.216] (-911.725) (-910.413) (-910.906) * (-911.493) [-911.220] (-913.106) (-913.316) -- 0:00:06
886000 -- [-913.877] (-912.967) (-912.820) (-910.583) * [-910.997] (-913.859) (-910.913) (-914.396) -- 0:00:06
886500 -- [-911.963] (-914.166) (-913.232) (-913.039) * [-911.552] (-912.850) (-911.949) (-914.868) -- 0:00:06
887000 -- (-910.615) [-914.466] (-910.105) (-912.421) * (-910.477) (-912.515) (-913.230) [-911.819] -- 0:00:06
887500 -- (-911.106) (-913.218) [-913.202] (-916.301) * (-909.661) (-912.058) [-910.940] (-912.319) -- 0:00:06
888000 -- [-911.678] (-911.918) (-911.292) (-912.683) * (-911.206) (-913.655) [-912.487] (-914.767) -- 0:00:06
888500 -- (-915.468) (-911.451) [-912.428] (-910.240) * (-913.263) (-913.175) [-911.323] (-912.040) -- 0:00:06
889000 -- (-915.218) [-911.209] (-915.056) (-913.343) * (-913.235) (-910.955) [-912.085] (-914.692) -- 0:00:06
889500 -- (-914.436) [-913.290] (-910.274) (-914.692) * (-910.995) (-915.670) [-915.096] (-911.537) -- 0:00:06
890000 -- (-917.387) [-912.164] (-909.732) (-917.523) * (-912.743) (-912.555) [-912.619] (-910.914) -- 0:00:06
Average standard deviation of split frequencies: 0.010122
890500 -- (-914.193) (-911.934) [-912.237] (-911.456) * (-912.914) [-913.611] (-911.758) (-910.477) -- 0:00:06
891000 -- (-914.267) [-911.529] (-911.566) (-912.349) * (-910.486) (-911.639) (-911.869) [-912.690] -- 0:00:06
891500 -- (-912.482) [-909.763] (-911.138) (-912.832) * [-911.842] (-912.910) (-911.126) (-912.315) -- 0:00:06
892000 -- (-914.951) [-909.767] (-912.055) (-912.694) * (-914.245) (-918.416) [-911.624] (-911.861) -- 0:00:06
892500 -- [-911.178] (-914.141) (-909.965) (-912.018) * [-910.741] (-912.861) (-910.835) (-911.704) -- 0:00:06
893000 -- [-912.852] (-911.994) (-911.792) (-912.434) * (-911.293) [-913.833] (-914.776) (-916.780) -- 0:00:06
893500 -- (-911.095) [-910.447] (-911.493) (-913.241) * [-910.568] (-912.685) (-910.088) (-912.916) -- 0:00:06
894000 -- [-915.705] (-911.836) (-912.817) (-912.678) * (-911.932) [-911.320] (-911.189) (-910.523) -- 0:00:06
894500 -- (-913.281) (-911.864) (-910.391) [-910.350] * (-913.885) (-910.218) (-912.332) [-909.993] -- 0:00:06
895000 -- [-918.165] (-915.778) (-912.556) (-910.879) * (-915.709) (-909.900) (-911.425) [-913.193] -- 0:00:06
Average standard deviation of split frequencies: 0.010095
895500 -- [-913.327] (-910.399) (-911.087) (-912.952) * (-915.764) (-912.955) [-910.103] (-910.947) -- 0:00:06
896000 -- (-913.067) (-911.796) (-911.121) [-910.203] * (-912.321) (-913.058) [-909.946] (-913.683) -- 0:00:06
896500 -- (-912.255) [-910.634] (-911.614) (-912.765) * [-913.451] (-910.077) (-912.580) (-911.870) -- 0:00:06
897000 -- [-914.414] (-911.455) (-914.340) (-913.990) * (-919.750) [-914.509] (-912.452) (-912.529) -- 0:00:06
897500 -- [-912.364] (-911.499) (-910.517) (-911.268) * (-912.323) (-910.648) (-919.171) [-910.661] -- 0:00:06
898000 -- (-914.573) (-910.544) [-912.666] (-915.945) * (-917.575) [-910.304] (-912.570) (-910.433) -- 0:00:06
898500 -- (-911.354) (-911.066) (-911.006) [-914.344] * [-911.429] (-912.155) (-910.916) (-910.899) -- 0:00:06
899000 -- (-915.179) (-911.175) (-912.765) [-913.026] * (-910.166) (-910.479) (-912.804) [-910.510] -- 0:00:06
899500 -- (-912.032) (-911.719) [-915.143] (-915.124) * [-912.093] (-909.795) (-913.625) (-912.438) -- 0:00:06
900000 -- (-910.614) [-910.629] (-912.892) (-911.321) * (-917.753) (-912.277) [-911.962] (-911.667) -- 0:00:06
Average standard deviation of split frequencies: 0.010173
900500 -- (-910.710) [-913.048] (-912.890) (-911.531) * (-916.066) (-912.910) (-912.402) [-911.495] -- 0:00:06
901000 -- [-912.377] (-912.951) (-910.772) (-913.729) * (-912.385) [-912.640] (-910.048) (-911.528) -- 0:00:06
901500 -- (-914.339) (-913.907) (-910.432) [-911.971] * (-912.541) [-911.135] (-910.773) (-915.848) -- 0:00:06
902000 -- (-909.767) (-912.996) [-909.906] (-911.773) * (-912.393) (-916.899) (-911.727) [-914.259] -- 0:00:05
902500 -- (-911.129) [-913.004] (-912.946) (-912.577) * (-911.922) (-914.897) [-912.162] (-911.683) -- 0:00:05
903000 -- [-910.299] (-913.723) (-913.890) (-912.853) * (-915.453) (-912.591) [-910.413] (-912.451) -- 0:00:05
903500 -- (-910.832) (-915.115) (-912.093) [-910.523] * (-911.801) (-914.807) (-910.341) [-910.691] -- 0:00:05
904000 -- [-911.308] (-912.387) (-912.434) (-911.472) * (-912.152) [-911.968] (-912.194) (-909.887) -- 0:00:05
904500 -- (-911.510) (-914.090) (-911.115) [-914.754] * (-910.252) (-911.280) [-912.629] (-910.351) -- 0:00:05
905000 -- (-910.130) [-910.573] (-911.826) (-915.143) * (-910.133) [-911.979] (-917.862) (-912.948) -- 0:00:05
Average standard deviation of split frequencies: 0.009886
905500 -- (-910.977) [-912.021] (-917.360) (-914.814) * (-911.789) [-911.927] (-911.632) (-912.140) -- 0:00:05
906000 -- (-911.510) (-912.331) (-913.492) [-915.129] * (-915.378) (-914.030) (-911.690) [-913.078] -- 0:00:05
906500 -- [-911.908] (-910.430) (-910.564) (-914.033) * (-911.402) (-912.819) [-911.353] (-912.795) -- 0:00:05
907000 -- (-910.332) [-910.923] (-914.415) (-913.399) * (-912.762) (-911.534) (-910.241) [-911.963] -- 0:00:05
907500 -- (-913.541) (-911.014) (-910.970) [-912.776] * [-911.087] (-913.254) (-911.281) (-911.977) -- 0:00:05
908000 -- (-910.475) (-912.839) [-910.847] (-916.145) * (-911.053) [-912.946] (-909.875) (-912.356) -- 0:00:05
908500 -- (-911.238) (-911.538) (-911.617) [-916.065] * (-910.696) (-913.906) [-912.485] (-912.424) -- 0:00:05
909000 -- (-916.288) (-910.216) [-910.336] (-913.542) * (-911.833) (-915.498) [-910.947] (-910.365) -- 0:00:05
909500 -- (-911.999) [-912.659] (-913.037) (-911.844) * (-911.315) (-911.856) [-910.690] (-912.128) -- 0:00:05
910000 -- (-918.126) [-917.653] (-914.492) (-911.589) * [-911.217] (-915.947) (-910.058) (-910.157) -- 0:00:05
Average standard deviation of split frequencies: 0.009868
910500 -- [-910.433] (-915.031) (-912.489) (-910.232) * (-914.245) [-919.386] (-914.812) (-911.423) -- 0:00:05
911000 -- (-911.743) (-915.265) [-910.119] (-913.638) * (-911.483) [-912.582] (-913.491) (-912.151) -- 0:00:05
911500 -- (-910.141) (-909.870) [-910.945] (-913.229) * (-912.259) (-912.484) [-915.793] (-912.143) -- 0:00:05
912000 -- [-910.850] (-911.205) (-910.410) (-914.566) * (-915.874) [-912.104] (-915.294) (-912.502) -- 0:00:05
912500 -- (-912.158) (-912.919) (-910.931) [-912.437] * (-912.786) (-913.409) [-914.770] (-911.518) -- 0:00:05
913000 -- [-910.689] (-911.269) (-911.089) (-915.490) * (-911.640) [-911.288] (-913.997) (-911.574) -- 0:00:05
913500 -- (-913.263) (-910.107) [-913.026] (-916.697) * (-911.320) [-909.697] (-914.897) (-910.283) -- 0:00:05
914000 -- (-915.236) (-910.875) (-911.869) [-913.233] * (-913.615) [-910.310] (-916.996) (-911.861) -- 0:00:05
914500 -- (-912.699) [-911.310] (-915.202) (-911.540) * (-914.981) (-910.146) (-911.513) [-911.079] -- 0:00:05
915000 -- (-912.904) [-910.309] (-915.088) (-912.817) * (-912.429) [-911.930] (-910.144) (-912.991) -- 0:00:05
Average standard deviation of split frequencies: 0.009875
915500 -- (-911.823) [-912.509] (-912.391) (-913.108) * (-913.902) [-910.735] (-910.055) (-912.660) -- 0:00:05
916000 -- (-913.947) (-910.548) [-910.999] (-913.748) * (-910.713) (-910.467) (-912.224) [-910.334] -- 0:00:05
916500 -- (-911.067) (-910.879) (-910.381) [-910.612] * (-912.783) [-913.963] (-913.542) (-912.605) -- 0:00:05
917000 -- [-912.556] (-910.755) (-914.273) (-911.288) * (-911.734) (-914.193) [-914.064] (-911.545) -- 0:00:05
917500 -- (-912.982) (-913.873) [-912.970] (-912.156) * (-910.474) (-913.647) [-912.922] (-914.524) -- 0:00:05
918000 -- (-911.135) (-915.599) (-913.125) [-910.609] * (-912.326) (-916.805) [-911.899] (-915.175) -- 0:00:05
918500 -- [-914.331] (-917.886) (-910.325) (-915.384) * (-912.199) (-911.802) (-915.975) [-912.253] -- 0:00:04
919000 -- [-911.703] (-911.598) (-910.406) (-910.750) * [-912.817] (-910.798) (-915.315) (-911.400) -- 0:00:04
919500 -- [-913.168] (-915.060) (-910.594) (-910.531) * (-914.223) (-911.018) (-913.308) [-910.878] -- 0:00:04
920000 -- (-912.758) (-910.103) (-914.597) [-911.362] * [-912.887] (-911.613) (-913.965) (-911.591) -- 0:00:04
Average standard deviation of split frequencies: 0.009696
920500 -- (-911.477) (-911.751) (-912.730) [-911.965] * [-911.885] (-911.906) (-912.494) (-914.239) -- 0:00:04
921000 -- (-911.465) (-910.565) (-911.756) [-914.129] * [-912.164] (-914.387) (-913.560) (-914.123) -- 0:00:04
921500 -- (-916.397) (-910.886) [-913.261] (-910.567) * [-911.359] (-912.342) (-913.000) (-915.066) -- 0:00:04
922000 -- (-912.417) (-912.477) [-914.438] (-911.903) * (-911.107) (-916.743) (-912.485) [-911.560] -- 0:00:04
922500 -- [-911.596] (-911.668) (-910.491) (-915.830) * (-910.767) (-911.007) (-913.004) [-912.372] -- 0:00:04
923000 -- [-910.948] (-912.035) (-910.165) (-912.882) * (-911.752) (-909.989) [-910.774] (-916.717) -- 0:00:04
923500 -- [-910.806] (-911.874) (-911.744) (-914.053) * (-912.862) (-910.305) [-910.524] (-910.567) -- 0:00:04
924000 -- (-913.085) [-910.239] (-911.608) (-913.327) * (-915.301) (-910.120) [-912.043] (-911.502) -- 0:00:04
924500 -- (-913.162) (-912.950) [-913.909] (-911.170) * [-910.176] (-910.267) (-910.226) (-919.223) -- 0:00:04
925000 -- (-911.193) [-910.808] (-912.309) (-910.252) * (-912.477) (-911.108) (-913.236) [-911.325] -- 0:00:04
Average standard deviation of split frequencies: 0.009291
925500 -- (-913.319) [-910.530] (-910.898) (-909.776) * [-911.886] (-912.246) (-912.620) (-911.298) -- 0:00:04
926000 -- (-914.211) (-910.068) [-910.687] (-913.238) * (-910.790) (-912.462) [-911.216] (-911.771) -- 0:00:04
926500 -- (-913.400) (-911.053) (-911.914) [-911.201] * (-912.330) [-911.246] (-912.496) (-912.540) -- 0:00:04
927000 -- [-914.951] (-911.179) (-912.864) (-910.181) * (-914.006) (-911.563) [-910.211] (-911.736) -- 0:00:04
927500 -- [-910.795] (-912.050) (-912.842) (-909.918) * (-910.343) (-911.006) [-909.769] (-910.474) -- 0:00:04
928000 -- (-911.061) (-911.508) (-911.607) [-912.449] * (-910.372) (-912.867) (-909.987) [-909.664] -- 0:00:04
928500 -- (-913.206) [-911.468] (-910.746) (-913.489) * (-910.205) (-913.265) (-910.187) [-910.119] -- 0:00:04
929000 -- (-910.397) (-912.140) (-914.508) [-912.093] * (-913.498) (-911.316) [-912.034] (-915.350) -- 0:00:04
929500 -- (-913.533) [-912.975] (-912.431) (-911.793) * (-910.017) (-910.623) (-914.935) [-910.838] -- 0:00:04
930000 -- (-914.411) (-910.800) (-911.756) [-913.805] * [-911.445] (-916.806) (-915.035) (-910.441) -- 0:00:04
Average standard deviation of split frequencies: 0.009434
930500 -- [-912.195] (-910.681) (-912.108) (-910.001) * (-910.457) (-915.276) (-912.819) [-910.363] -- 0:00:04
931000 -- (-911.938) (-910.343) [-912.964] (-912.649) * (-911.627) [-912.934] (-915.353) (-912.843) -- 0:00:04
931500 -- [-912.717] (-910.562) (-912.931) (-911.909) * (-912.362) (-912.533) (-918.835) [-911.811] -- 0:00:04
932000 -- [-913.419] (-912.091) (-910.932) (-914.163) * (-912.739) (-911.823) (-911.052) [-913.448] -- 0:00:04
932500 -- (-910.970) (-916.498) [-912.502] (-913.296) * (-912.455) (-910.682) (-911.189) [-912.250] -- 0:00:04
933000 -- (-911.777) (-912.775) [-910.373] (-912.233) * (-912.658) [-910.852] (-917.218) (-913.096) -- 0:00:04
933500 -- (-914.370) (-910.897) [-912.594] (-912.334) * (-911.636) (-912.796) (-914.686) [-913.391] -- 0:00:04
934000 -- [-914.764] (-910.930) (-910.824) (-911.859) * (-911.715) [-910.635] (-916.454) (-911.516) -- 0:00:04
934500 -- (-909.831) (-911.206) (-914.843) [-911.050] * [-913.992] (-915.211) (-910.815) (-910.568) -- 0:00:03
935000 -- (-909.841) (-911.113) (-910.157) [-911.772] * (-911.299) (-911.710) (-910.787) [-910.012] -- 0:00:03
Average standard deviation of split frequencies: 0.009160
935500 -- [-911.341] (-914.865) (-915.940) (-911.437) * (-912.356) [-910.421] (-910.806) (-912.674) -- 0:00:03
936000 -- (-912.129) (-911.063) (-918.163) [-916.085] * (-910.455) (-910.686) [-912.408] (-914.943) -- 0:00:03
936500 -- [-910.600] (-914.723) (-913.920) (-910.701) * (-910.884) (-910.138) [-911.926] (-912.415) -- 0:00:03
937000 -- (-910.940) (-912.063) [-910.148] (-910.701) * (-924.078) [-911.490] (-911.308) (-912.603) -- 0:00:03
937500 -- (-914.167) (-913.209) (-911.167) [-910.933] * [-912.897] (-912.586) (-911.846) (-912.035) -- 0:00:03
938000 -- [-911.569] (-910.299) (-913.881) (-912.871) * [-914.514] (-914.750) (-911.017) (-911.580) -- 0:00:03
938500 -- (-910.812) (-914.289) [-910.685] (-911.076) * (-910.596) [-911.891] (-910.636) (-915.109) -- 0:00:03
939000 -- (-910.803) (-910.729) (-913.436) [-912.318] * (-914.032) [-911.388] (-910.954) (-910.751) -- 0:00:03
939500 -- (-912.982) (-916.037) [-912.105] (-911.348) * [-916.431] (-913.030) (-911.132) (-910.955) -- 0:00:03
940000 -- [-909.707] (-913.511) (-913.543) (-911.971) * (-914.958) [-910.843] (-910.108) (-911.790) -- 0:00:03
Average standard deviation of split frequencies: 0.009428
940500 -- (-910.214) (-914.519) [-913.459] (-912.276) * (-911.958) (-913.499) (-912.746) [-912.258] -- 0:00:03
941000 -- (-910.649) (-914.130) [-916.298] (-916.947) * (-910.150) (-911.733) [-912.729] (-911.543) -- 0:00:03
941500 -- (-912.462) [-911.983] (-915.864) (-911.991) * [-910.816] (-915.507) (-915.753) (-912.461) -- 0:00:03
942000 -- [-911.604] (-911.411) (-913.838) (-914.176) * (-916.964) (-912.351) (-912.478) [-911.047] -- 0:00:03
942500 -- (-911.358) [-912.322] (-913.081) (-911.718) * (-912.264) [-913.110] (-910.331) (-910.680) -- 0:00:03
943000 -- (-911.564) (-911.553) [-913.807] (-913.256) * [-910.544] (-915.465) (-911.225) (-912.747) -- 0:00:03
943500 -- (-914.211) (-914.111) (-912.134) [-912.783] * (-911.496) [-911.907] (-914.931) (-915.315) -- 0:00:03
944000 -- (-910.776) (-914.135) (-913.183) [-912.169] * (-914.098) [-911.581] (-910.478) (-912.364) -- 0:00:03
944500 -- (-911.198) (-913.282) (-910.225) [-910.863] * (-912.840) (-913.810) [-911.724] (-914.657) -- 0:00:03
945000 -- (-912.737) (-917.116) (-912.212) [-910.851] * [-911.216] (-913.027) (-912.219) (-916.907) -- 0:00:03
Average standard deviation of split frequencies: 0.008876
945500 -- (-911.505) (-912.317) (-911.823) [-913.321] * (-914.423) (-913.936) [-911.273] (-914.968) -- 0:00:03
946000 -- (-911.562) [-911.726] (-911.823) (-914.947) * (-910.018) [-918.200] (-912.555) (-913.246) -- 0:00:03
946500 -- (-911.472) (-914.033) [-909.768] (-912.273) * (-910.207) (-919.382) [-911.576] (-915.502) -- 0:00:03
947000 -- (-911.350) (-913.471) [-910.092] (-912.273) * (-912.720) (-911.720) [-911.874] (-912.554) -- 0:00:03
947500 -- (-912.639) [-910.836] (-910.265) (-912.534) * (-912.794) [-914.955] (-910.719) (-912.577) -- 0:00:03
948000 -- (-910.472) [-911.318] (-911.527) (-912.153) * (-919.167) [-911.821] (-911.965) (-915.255) -- 0:00:03
948500 -- (-910.295) (-915.348) (-913.690) [-910.543] * (-912.508) [-910.952] (-910.339) (-917.656) -- 0:00:03
949000 -- (-910.298) [-913.386] (-913.752) (-911.148) * (-911.301) (-914.709) (-910.130) [-912.028] -- 0:00:03
949500 -- (-910.354) [-913.257] (-913.615) (-911.058) * (-911.442) [-910.587] (-910.160) (-912.620) -- 0:00:03
950000 -- (-914.771) (-912.708) [-915.194] (-910.376) * (-912.898) (-914.573) [-911.338] (-911.625) -- 0:00:03
Average standard deviation of split frequencies: 0.008895
950500 -- (-911.691) [-910.162] (-910.829) (-910.887) * (-910.836) (-913.909) (-912.572) [-911.859] -- 0:00:03
951000 -- (-910.232) (-913.563) (-915.719) [-914.332] * (-910.512) (-912.026) (-911.884) [-912.071] -- 0:00:02
951500 -- [-912.372] (-914.109) (-911.071) (-910.076) * (-912.087) [-911.024] (-912.677) (-913.164) -- 0:00:02
952000 -- [-911.931] (-912.110) (-910.432) (-910.008) * (-910.976) [-914.459] (-910.921) (-917.838) -- 0:00:02
952500 -- [-910.936] (-910.754) (-911.691) (-910.008) * (-910.999) (-912.441) [-911.929] (-913.268) -- 0:00:02
953000 -- (-910.418) (-910.704) [-912.800] (-910.210) * [-911.511] (-913.120) (-912.426) (-913.276) -- 0:00:02
953500 -- (-913.920) (-913.247) [-911.671] (-911.383) * (-912.963) (-910.370) [-912.287] (-910.042) -- 0:00:02
954000 -- [-914.618] (-912.757) (-913.911) (-915.645) * (-913.813) (-911.290) (-912.755) [-909.999] -- 0:00:02
954500 -- (-912.109) (-913.054) (-909.907) [-913.576] * (-912.573) (-911.220) [-910.737] (-911.715) -- 0:00:02
955000 -- (-910.925) (-914.768) [-909.912] (-910.651) * [-911.159] (-912.347) (-912.386) (-913.641) -- 0:00:02
Average standard deviation of split frequencies: 0.009215
955500 -- (-910.900) [-913.181] (-913.784) (-913.713) * [-911.314] (-911.907) (-913.467) (-912.653) -- 0:00:02
956000 -- [-910.735] (-910.717) (-913.525) (-910.042) * (-911.296) (-913.065) (-916.199) [-910.376] -- 0:00:02
956500 -- (-910.889) (-913.688) (-912.692) [-910.571] * [-911.181] (-912.188) (-912.460) (-913.485) -- 0:00:02
957000 -- [-911.481] (-912.913) (-915.216) (-912.268) * (-910.844) (-912.882) [-912.840] (-910.491) -- 0:00:02
957500 -- (-910.856) (-912.622) [-913.714] (-910.285) * (-912.161) (-916.145) [-911.369] (-910.311) -- 0:00:02
958000 -- (-912.515) (-913.647) [-910.099] (-910.540) * (-916.795) [-912.483] (-913.099) (-917.479) -- 0:00:02
958500 -- (-910.701) [-913.595] (-911.363) (-911.780) * (-913.196) [-911.542] (-911.091) (-911.630) -- 0:00:02
959000 -- [-913.729] (-911.672) (-914.649) (-915.640) * (-917.917) (-910.985) [-911.257] (-915.258) -- 0:00:02
959500 -- (-911.170) (-914.790) [-912.339] (-910.296) * (-912.154) (-911.007) (-911.961) [-910.719] -- 0:00:02
960000 -- (-912.089) (-910.592) [-915.165] (-910.251) * (-912.478) [-910.246] (-911.599) (-911.866) -- 0:00:02
Average standard deviation of split frequencies: 0.009139
960500 -- (-910.564) (-909.865) (-916.880) [-911.836] * (-911.151) (-913.037) [-912.019] (-915.046) -- 0:00:02
961000 -- [-910.475] (-912.201) (-914.427) (-911.020) * [-911.124] (-911.810) (-911.029) (-914.290) -- 0:00:02
961500 -- (-912.277) (-912.191) (-912.461) [-910.579] * (-913.049) (-911.198) [-911.626] (-915.794) -- 0:00:02
962000 -- [-914.982] (-913.947) (-912.464) (-910.502) * (-909.808) (-911.349) [-916.249] (-910.181) -- 0:00:02
962500 -- (-913.299) [-916.381] (-914.197) (-910.546) * (-911.771) (-912.541) [-917.780] (-911.144) -- 0:00:02
963000 -- [-910.276] (-914.052) (-915.034) (-912.606) * [-912.411] (-911.877) (-910.568) (-911.497) -- 0:00:02
963500 -- (-910.640) (-911.587) [-913.053] (-911.097) * (-910.443) (-912.942) (-912.164) [-914.013] -- 0:00:02
964000 -- [-913.344] (-912.178) (-911.360) (-914.979) * (-912.375) (-910.726) [-910.988] (-915.083) -- 0:00:02
964500 -- (-912.308) (-915.704) (-914.881) [-910.224] * (-910.842) (-915.666) (-911.888) [-913.437] -- 0:00:02
965000 -- [-915.615] (-913.625) (-915.156) (-909.884) * (-912.548) [-913.791] (-910.327) (-916.639) -- 0:00:02
Average standard deviation of split frequencies: 0.008845
965500 -- (-910.018) (-913.637) (-914.732) [-910.278] * (-910.992) (-911.268) [-912.673] (-917.255) -- 0:00:02
966000 -- (-914.734) (-911.825) (-910.151) [-910.860] * (-910.093) (-915.175) (-910.374) [-914.793] -- 0:00:02
966500 -- (-912.289) (-911.570) [-910.518] (-909.815) * (-913.897) (-911.536) (-910.995) [-910.374] -- 0:00:02
967000 -- [-910.450] (-914.985) (-917.130) (-910.058) * (-910.039) (-910.676) (-912.408) [-912.416] -- 0:00:02
967500 -- (-912.416) [-910.514] (-913.810) (-911.091) * [-911.214] (-915.557) (-911.972) (-913.477) -- 0:00:01
968000 -- (-912.336) (-909.949) (-912.806) [-912.185] * (-913.411) (-913.639) [-912.524] (-917.264) -- 0:00:01
968500 -- [-910.992] (-910.497) (-912.290) (-917.568) * (-915.941) [-912.544] (-913.539) (-917.109) -- 0:00:01
969000 -- (-913.186) [-910.229] (-911.019) (-913.917) * (-912.250) [-910.772] (-917.106) (-911.419) -- 0:00:01
969500 -- (-917.307) (-910.378) (-910.200) [-909.905] * (-915.588) [-912.073] (-912.149) (-913.107) -- 0:00:01
970000 -- (-911.930) [-911.231] (-910.915) (-912.885) * (-910.568) (-911.827) [-911.823] (-909.785) -- 0:00:01
Average standard deviation of split frequencies: 0.008711
970500 -- (-912.942) (-911.553) [-911.419] (-911.114) * (-913.068) (-911.547) (-914.450) [-915.598] -- 0:00:01
971000 -- (-911.450) (-914.190) [-911.473] (-912.723) * (-911.271) (-912.191) [-910.919] (-913.493) -- 0:00:01
971500 -- [-910.647] (-911.867) (-911.098) (-913.661) * (-914.642) (-912.302) (-909.867) [-912.870] -- 0:00:01
972000 -- (-911.428) (-912.054) [-913.071] (-912.113) * (-911.553) [-911.931] (-910.564) (-911.555) -- 0:00:01
972500 -- (-910.634) (-911.696) (-913.269) [-911.945] * [-911.279] (-913.209) (-910.740) (-912.845) -- 0:00:01
973000 -- (-912.901) [-916.136] (-912.241) (-913.906) * (-912.052) (-910.529) [-911.581] (-911.626) -- 0:00:01
973500 -- (-911.052) (-911.487) (-911.080) [-913.237] * [-911.734] (-911.591) (-910.810) (-910.148) -- 0:00:01
974000 -- [-915.503] (-914.363) (-910.488) (-910.495) * [-912.515] (-915.692) (-912.468) (-911.800) -- 0:00:01
974500 -- (-914.965) [-911.889] (-911.162) (-911.107) * [-911.958] (-913.954) (-910.567) (-910.801) -- 0:00:01
975000 -- (-910.184) (-912.350) [-914.191] (-913.113) * (-912.134) (-914.060) (-910.862) [-914.524] -- 0:00:01
Average standard deviation of split frequencies: 0.008332
975500 -- (-909.651) (-912.050) [-911.665] (-914.980) * (-910.682) (-911.270) [-917.002] (-911.103) -- 0:00:01
976000 -- (-911.882) (-914.440) (-911.927) [-909.771] * (-912.084) (-912.584) (-912.585) [-912.350] -- 0:00:01
976500 -- (-912.044) [-913.841] (-910.145) (-911.910) * (-909.852) [-911.355] (-913.594) (-911.887) -- 0:00:01
977000 -- (-912.577) [-911.228] (-911.718) (-910.463) * (-913.543) [-910.646] (-913.530) (-919.621) -- 0:00:01
977500 -- [-911.293] (-911.861) (-912.799) (-910.479) * (-912.442) [-910.661] (-914.109) (-915.263) -- 0:00:01
978000 -- (-910.396) [-914.002] (-911.169) (-913.497) * [-910.105] (-909.927) (-912.286) (-914.954) -- 0:00:01
978500 -- (-910.268) (-915.002) [-911.138] (-919.993) * (-911.296) (-914.988) (-911.611) [-912.146] -- 0:00:01
979000 -- (-914.681) (-910.589) [-910.631] (-914.652) * [-910.840] (-915.149) (-912.784) (-911.859) -- 0:00:01
979500 -- (-919.683) (-912.871) (-918.001) [-915.779] * [-911.984] (-912.467) (-912.307) (-910.871) -- 0:00:01
980000 -- [-911.206] (-915.114) (-916.444) (-914.584) * (-914.538) (-912.614) (-915.487) [-911.281] -- 0:00:01
Average standard deviation of split frequencies: 0.008076
980500 -- (-911.655) (-915.183) (-914.262) [-913.536] * (-917.749) (-912.157) [-914.921] (-910.648) -- 0:00:01
981000 -- (-912.604) (-912.892) [-910.876] (-912.997) * (-912.148) (-912.516) [-910.850] (-911.296) -- 0:00:01
981500 -- (-910.406) (-911.631) [-911.717] (-913.925) * [-915.780] (-910.954) (-910.494) (-911.414) -- 0:00:01
982000 -- [-912.809] (-912.684) (-915.853) (-912.329) * (-915.656) (-914.003) [-915.735] (-910.999) -- 0:00:01
982500 -- [-913.070] (-912.033) (-910.961) (-913.586) * (-911.435) (-914.870) [-911.153] (-912.865) -- 0:00:01
983000 -- (-913.161) (-909.803) (-912.966) [-912.514] * (-911.269) (-911.126) (-909.907) [-913.427] -- 0:00:01
983500 -- (-913.131) (-913.018) (-912.275) [-915.857] * (-910.784) [-911.577] (-910.298) (-913.299) -- 0:00:01
984000 -- (-910.460) (-909.733) (-911.922) [-912.569] * [-910.789] (-911.864) (-913.375) (-911.658) -- 0:00:00
984500 -- (-910.050) [-911.003] (-912.036) (-912.708) * (-910.514) (-912.018) (-912.271) [-911.812] -- 0:00:00
985000 -- [-910.644] (-912.536) (-911.425) (-914.371) * (-912.728) (-912.952) [-912.252] (-913.025) -- 0:00:00
Average standard deviation of split frequencies: 0.007936
985500 -- (-914.191) (-914.185) (-911.540) [-912.395] * (-911.549) (-911.694) (-912.983) [-911.540] -- 0:00:00
986000 -- (-913.462) [-914.296] (-910.865) (-912.580) * (-911.365) (-912.136) (-912.154) [-911.918] -- 0:00:00
986500 -- [-911.982] (-912.402) (-910.180) (-915.968) * (-911.652) [-910.468] (-913.091) (-914.185) -- 0:00:00
987000 -- (-911.710) (-911.405) [-913.559] (-912.634) * (-913.194) (-912.514) [-911.425] (-909.866) -- 0:00:00
987500 -- (-911.306) [-911.419] (-910.913) (-916.365) * (-911.736) (-912.321) [-911.637] (-914.854) -- 0:00:00
988000 -- (-912.096) [-910.799] (-911.857) (-914.257) * (-915.240) (-911.018) [-911.023] (-912.116) -- 0:00:00
988500 -- (-910.118) [-914.970] (-913.667) (-918.795) * [-913.573] (-911.297) (-911.193) (-910.511) -- 0:00:00
989000 -- (-910.148) [-912.238] (-911.552) (-912.042) * (-911.190) [-913.401] (-910.638) (-917.180) -- 0:00:00
989500 -- [-909.650] (-912.710) (-912.855) (-911.072) * [-910.355] (-911.577) (-912.336) (-910.559) -- 0:00:00
990000 -- [-910.731] (-914.883) (-914.887) (-911.440) * (-912.143) [-912.009] (-912.526) (-913.609) -- 0:00:00
Average standard deviation of split frequencies: 0.007645
990500 -- (-911.146) [-911.832] (-912.512) (-911.942) * (-911.439) (-910.329) (-914.034) [-914.971] -- 0:00:00
991000 -- [-912.291] (-911.879) (-914.000) (-913.218) * (-913.014) [-915.677] (-911.753) (-912.021) -- 0:00:00
991500 -- (-912.251) (-910.777) [-912.132] (-912.415) * (-912.805) (-916.998) [-910.015] (-913.292) -- 0:00:00
992000 -- [-911.891] (-912.867) (-914.256) (-910.282) * [-912.396] (-918.342) (-910.708) (-921.387) -- 0:00:00
992500 -- (-910.863) (-910.902) [-915.697] (-911.530) * (-912.098) (-913.622) (-911.756) [-916.949] -- 0:00:00
993000 -- (-913.801) [-911.168] (-913.303) (-910.648) * (-911.593) (-913.223) (-910.726) [-912.359] -- 0:00:00
993500 -- (-913.146) [-912.221] (-918.236) (-911.586) * (-911.644) [-912.368] (-914.465) (-913.695) -- 0:00:00
994000 -- (-913.447) [-910.768] (-911.647) (-915.594) * [-911.146] (-911.674) (-912.499) (-912.371) -- 0:00:00
994500 -- (-912.147) (-910.399) [-911.700] (-913.315) * [-910.826] (-912.406) (-911.446) (-912.837) -- 0:00:00
995000 -- (-911.639) (-910.545) (-913.376) [-913.879] * (-912.167) (-913.166) (-913.077) [-913.401] -- 0:00:00
Average standard deviation of split frequencies: 0.008046
995500 -- (-911.629) (-910.738) [-910.527] (-911.100) * (-912.541) (-912.186) (-911.960) [-913.831] -- 0:00:00
996000 -- (-916.366) (-912.701) (-910.716) [-912.297] * (-911.042) (-915.082) [-910.736] (-912.005) -- 0:00:00
996500 -- (-911.887) [-911.562] (-917.059) (-914.145) * (-911.209) (-914.855) (-914.423) [-910.898] -- 0:00:00
997000 -- [-911.491] (-911.594) (-918.220) (-914.373) * (-911.205) (-913.346) [-912.629] (-912.334) -- 0:00:00
997500 -- (-910.976) (-912.527) [-914.752] (-909.617) * (-910.155) (-911.070) [-910.260] (-913.739) -- 0:00:00
998000 -- (-910.455) (-913.076) [-915.838] (-910.261) * [-913.504] (-913.466) (-910.357) (-910.925) -- 0:00:00
998500 -- (-911.047) (-914.128) (-911.167) [-910.106] * (-912.674) (-913.141) [-911.275] (-910.949) -- 0:00:00
999000 -- [-913.704] (-911.988) (-912.174) (-909.663) * [-915.404] (-911.660) (-910.865) (-911.300) -- 0:00:00
999500 -- (-910.317) [-911.017] (-913.055) (-914.074) * (-918.534) (-916.499) [-910.749] (-912.086) -- 0:00:00
1000000 -- (-911.488) [-910.419] (-910.404) (-915.220) * (-913.620) (-909.763) [-913.224] (-912.183) -- 0:00:00
Average standard deviation of split frequencies: 0.008009
Analysis completed in 1 mins 1 seconds
Analysis used 59.95 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -909.52
Likelihood of best state for "cold" chain of run 2 was -909.52
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.1 % ( 25 %) Dirichlet(Pi{all})
29.9 % ( 25 %) Slider(Pi{all})
79.2 % ( 53 %) Multiplier(Alpha{1,2})
78.4 % ( 63 %) Multiplier(Alpha{3})
21.3 % ( 17 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.4 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.8 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.6 % ( 31 %) Dirichlet(Pi{all})
29.8 % ( 27 %) Slider(Pi{all})
78.3 % ( 61 %) Multiplier(Alpha{1,2})
77.8 % ( 53 %) Multiplier(Alpha{3})
21.2 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 33 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166390 0.82 0.66
3 | 167233 166517 0.84
4 | 166377 167438 166045
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166794 0.83 0.67
3 | 166234 166342 0.83
4 | 166638 167057 166935
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -911.20
| 2 1 |
| 1 1 1 1 1 |
|1 1 2 2 |
| 1 *2 2 |
| 2 2 2 1 1 1 2 |
| *1 1 1 2 1 2 2 2 |
| 1 2 11 1 2 |
| 2 2 2* 2 2 2 12 2 1 1 |
|2 1 22 * 2 1 2 2 12 1 1 1 1 |
| 1 2 21 2 22 1 1 *1 11 1|
| 1 2 2 2 1 1 2 2 2 2 1 2 |
| 2 21 1 1 1 2 2 2 |
| 1 1 2 1 2 1 1 |
| 1 1 2 1 2 2|
| 1 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -912.68
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -911.20 -914.43
2 -911.28 -916.00
--------------------------------------
TOTAL -911.23 -915.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902984 0.093183 0.377322 1.472407 0.870641 1286.03 1319.25 1.000
r(A<->C){all} 0.170021 0.020927 0.000062 0.465713 0.134141 195.34 211.60 1.002
r(A<->G){all} 0.163324 0.019721 0.000071 0.449213 0.124156 239.43 268.40 1.003
r(A<->T){all} 0.157597 0.017391 0.000083 0.424753 0.121688 258.46 283.24 1.003
r(C<->G){all} 0.176440 0.022759 0.000095 0.492436 0.135039 111.43 144.83 1.000
r(C<->T){all} 0.173828 0.020621 0.000029 0.466342 0.134784 111.46 175.48 1.002
r(G<->T){all} 0.158791 0.018534 0.000020 0.433757 0.125554 147.05 215.97 1.000
pi(A){all} 0.159018 0.000187 0.130953 0.185129 0.158636 915.80 1129.90 1.000
pi(C){all} 0.323201 0.000314 0.287969 0.356461 0.323524 1081.58 1275.35 1.000
pi(G){all} 0.349612 0.000328 0.311799 0.382806 0.349183 1215.05 1291.80 1.001
pi(T){all} 0.168169 0.000205 0.140139 0.195731 0.167742 1251.74 1321.15 1.000
alpha{1,2} 0.438181 0.243597 0.000109 1.481592 0.259960 1188.72 1210.77 1.003
alpha{3} 0.448864 0.227720 0.000256 1.455069 0.293928 1138.68 1282.38 1.000
pinvar{all} 0.997726 0.000007 0.992220 1.000000 0.998601 1088.49 1154.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- .**...
9 -- .****.
10 -- ..****
11 -- ..*..*
12 -- .*.*..
13 -- ...*.*
14 -- .*..*.
15 -- ....**
16 -- ...**.
17 -- .*.***
18 -- ..*.*.
19 -- ..**..
20 -- .**.**
21 -- .*...*
22 -- ...***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 486 0.161892 0.015075 0.151233 0.172552 2
8 484 0.161226 0.010364 0.153897 0.168554 2
9 445 0.148235 0.005182 0.144570 0.151899 2
10 443 0.147568 0.007066 0.142572 0.152565 2
11 442 0.147235 0.001884 0.145903 0.148568 2
12 435 0.144903 0.000471 0.144570 0.145237 2
13 425 0.141572 0.012719 0.132578 0.150566 2
14 422 0.140573 0.006595 0.135909 0.145237 2
15 422 0.140573 0.000000 0.140573 0.140573 2
16 419 0.139574 0.011777 0.131246 0.147901 2
17 418 0.139241 0.009422 0.132578 0.145903 2
18 409 0.136243 0.011777 0.127915 0.144570 2
19 401 0.133578 0.004240 0.130580 0.136576 2
20 394 0.131246 0.013191 0.121919 0.140573 2
21 387 0.128914 0.006124 0.124584 0.133245 2
22 276 0.091939 0.012248 0.083278 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101063 0.010827 0.000033 0.302309 0.069854 1.002 2
length{all}[2] 0.098945 0.009804 0.000007 0.302747 0.067912 1.002 2
length{all}[3] 0.102869 0.010370 0.000079 0.308556 0.072574 1.001 2
length{all}[4] 0.097346 0.009565 0.000033 0.296460 0.066102 1.000 2
length{all}[5] 0.099439 0.009625 0.000004 0.296404 0.069007 1.000 2
length{all}[6] 0.100864 0.010445 0.000007 0.302043 0.069678 1.000 2
length{all}[7] 0.092047 0.007881 0.000032 0.261501 0.066195 1.003 2
length{all}[8] 0.101826 0.011152 0.000262 0.317364 0.068450 1.000 2
length{all}[9] 0.101928 0.009250 0.000099 0.300586 0.074407 0.999 2
length{all}[10] 0.101739 0.010314 0.000035 0.292388 0.069669 0.999 2
length{all}[11] 0.105552 0.012891 0.000032 0.321013 0.067960 1.005 2
length{all}[12] 0.104043 0.012452 0.000404 0.320247 0.069964 0.998 2
length{all}[13] 0.091125 0.008213 0.000314 0.257463 0.063881 0.998 2
length{all}[14] 0.093933 0.009546 0.000425 0.302341 0.065362 1.000 2
length{all}[15] 0.097245 0.010240 0.000114 0.305860 0.063123 0.998 2
length{all}[16] 0.103605 0.010476 0.000203 0.292677 0.071357 0.998 2
length{all}[17] 0.096793 0.009089 0.000015 0.299524 0.065368 1.004 2
length{all}[18] 0.096595 0.011305 0.000209 0.314229 0.057770 0.998 2
length{all}[19] 0.105214 0.012863 0.000031 0.334601 0.067013 1.001 2
length{all}[20] 0.093865 0.009746 0.000526 0.280639 0.062771 1.005 2
length{all}[21] 0.105591 0.010934 0.000061 0.304773 0.076102 0.998 2
length{all}[22] 0.109066 0.009973 0.000376 0.309394 0.079148 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008009
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 687
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 229 / 229 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 229 / 229 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082296 0.100058 0.092066 0.052684 0.079947 0.072044 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -995.543680
Iterating by ming2
Initial: fx= 995.543680
x= 0.08230 0.10006 0.09207 0.05268 0.07995 0.07204 0.30000 1.30000
1 h-m-p 0.0000 0.0002 545.7159 +++ 925.137783 m 0.0002 14 | 1/8
2 h-m-p 0.0010 0.0049 66.1624 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 502.6704 ++ 903.172102 m 0.0001 45 | 2/8
4 h-m-p 0.0010 0.0089 39.3085 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 450.9798 ++ 895.951965 m 0.0000 76 | 3/8
6 h-m-p 0.0005 0.0135 27.5059 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 390.9340 ++ 894.339508 m 0.0000 107 | 4/8
8 h-m-p 0.0002 0.0190 20.1751 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 319.0590 ++ 889.859967 m 0.0000 137 | 5/8
10 h-m-p 0.0007 0.0294 13.2901 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 225.8577 ++ 888.021536 m 0.0000 168 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 --C 888.021536 0 0.0250 181 | 6/8
13 h-m-p 1.3684 8.0000 0.0000 -C 888.021536 0 0.0855 195
Out..
lnL = -888.021536
196 lfun, 196 eigenQcodon, 1176 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.055532 0.059394 0.108870 0.076288 0.088099 0.016544 0.299791 0.782494 0.556652
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.225421
np = 9
lnL0 = -978.454054
Iterating by ming2
Initial: fx= 978.454054
x= 0.05553 0.05939 0.10887 0.07629 0.08810 0.01654 0.29979 0.78249 0.55665
1 h-m-p 0.0000 0.0001 540.5827 ++ 956.706633 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0006 316.9342 ++ 913.096158 m 0.0006 26 | 2/9
3 h-m-p 0.0000 0.0000 78337932996516.8594
h-m-p: 4.60765958e-17 2.30382979e-16 7.83379330e+13 913.096158
.. | 2/9
4 h-m-p 0.0000 0.0000 446.6676 ++ 909.628128 m 0.0000 47 | 3/9
5 h-m-p 0.0001 0.0029 73.2746 +++ 897.874706 m 0.0029 60 | 4/9
6 h-m-p 0.0000 0.0001 923.4514 ++ 893.140746 m 0.0001 72 | 5/9
7 h-m-p 0.0000 0.0001 1397.6233 ++ 889.412579 m 0.0001 84 | 5/9
8 h-m-p 0.0047 0.0274 37.7871 ------------.. | 5/9
9 h-m-p 0.0000 0.0000 226.1898 ++ 888.021563 m 0.0000 118 | 6/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 888.021563 m 8.0000 133 | 6/9
11 h-m-p 0.0303 8.0000 0.0111 +++++ 888.021560 m 8.0000 151 | 6/9
12 h-m-p 0.2571 2.9427 0.3456 ++ 888.021547 m 2.9427 166 | 7/9
13 h-m-p 0.3223 1.6114 0.4345 ++ 888.021535 m 1.6114 181 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 888.021535 0 1.6000 195 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 C 888.021535 0 0.0160 208
Out..
lnL = -888.021535
209 lfun, 627 eigenQcodon, 2508 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015408 0.057786 0.037829 0.063311 0.047899 0.080588 0.000100 1.262451 0.130358 0.335063 1.536745
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.159936
np = 11
lnL0 = -953.698374
Iterating by ming2
Initial: fx= 953.698374
x= 0.01541 0.05779 0.03783 0.06331 0.04790 0.08059 0.00011 1.26245 0.13036 0.33506 1.53675
1 h-m-p 0.0000 0.0000 510.7073 ++ 952.300271 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 209.0802 +++ 932.816661 m 0.0005 31 | 2/11
3 h-m-p 0.0001 0.0003 204.1022 ++ 911.603688 m 0.0003 45 | 3/11
4 h-m-p 0.0005 0.0027 57.0371 ++ 898.347110 m 0.0027 59 | 4/11
5 h-m-p 0.0000 0.0000 6751.2423 ++ 895.248616 m 0.0000 73 | 5/11
6 h-m-p 0.0004 0.0021 8.5132 ----------.. | 5/11
7 h-m-p 0.0000 0.0000 382.4434 ++ 892.563936 m 0.0000 109 | 6/11
8 h-m-p 0.0160 8.0000 3.7552 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 314.9794 ++ 890.801501 m 0.0000 148 | 7/11
10 h-m-p 0.0160 8.0000 2.2890 -------------.. | 7/11
11 h-m-p 0.0000 0.0001 223.7135 ++ 888.021553 m 0.0001 187 | 8/11
12 h-m-p 0.0400 8.0000 0.0000 ++++ 888.021553 m 8.0000 203 | 8/11
13 h-m-p 0.0160 8.0000 0.0122 -------C 888.021553 0 0.0000 227 | 8/11
14 h-m-p 0.0160 8.0000 0.0108 +++++ 888.021551 m 8.0000 247 | 8/11
15 h-m-p 0.0449 8.0000 1.9315 +++Y 888.021534 0 2.8712 267 | 8/11
16 h-m-p 1.6000 8.0000 0.1396 ++ 888.021533 m 8.0000 281 | 8/11
17 h-m-p 0.6891 8.0000 1.6202 Y 888.021533 0 0.6891 298 | 8/11
18 h-m-p 1.6000 8.0000 0.4523 C 888.021533 0 0.6001 312 | 8/11
19 h-m-p 1.6000 8.0000 0.0223 C 888.021533 0 1.3670 329 | 8/11
20 h-m-p 1.6000 8.0000 0.0003 C 888.021533 0 0.6250 346 | 8/11
21 h-m-p 1.0643 8.0000 0.0002 --Y 888.021533 0 0.0166 365 | 8/11
22 h-m-p 1.6000 8.0000 0.0000 N 888.021533 0 0.4000 382 | 8/11
23 h-m-p 0.0296 8.0000 0.0000 Y 888.021533 0 0.0296 399 | 8/11
24 h-m-p 0.0388 8.0000 0.0000 N 888.021533 0 0.0097 416 | 8/11
25 h-m-p 0.0160 8.0000 0.0592 +C 888.021533 0 0.0824 434 | 8/11
26 h-m-p 1.6000 8.0000 0.0007 Y 888.021533 0 0.4000 451 | 8/11
27 h-m-p 1.6000 8.0000 0.0002 N 888.021533 0 0.8000 468 | 8/11
28 h-m-p 0.9205 8.0000 0.0002 ----C 888.021533 0 0.0009 489 | 8/11
29 h-m-p 0.9048 8.0000 0.0000 ---Y 888.021533 0 0.0035 509
Out..
lnL = -888.021533
510 lfun, 2040 eigenQcodon, 9180 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -888.026966 S = -888.017653 -0.003562
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:03
did 20 / 49 patterns 0:03
did 30 / 49 patterns 0:03
did 40 / 49 patterns 0:03
did 49 / 49 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079155 0.062721 0.097207 0.018549 0.088775 0.029604 0.000100 0.291601 1.794594
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.559682
np = 9
lnL0 = -969.692265
Iterating by ming2
Initial: fx= 969.692265
x= 0.07915 0.06272 0.09721 0.01855 0.08878 0.02960 0.00011 0.29160 1.79459
1 h-m-p 0.0000 0.0000 511.1085 ++ 969.164272 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0116 42.6378 +++++ 959.896693 m 0.0116 29 | 2/9
3 h-m-p 0.0001 0.0004 202.7488 ++ 945.025691 m 0.0004 41 | 3/9
4 h-m-p 0.0012 0.0062 19.8753 -----------.. | 3/9
5 h-m-p 0.0000 0.0002 425.8549 +++ 909.073529 m 0.0002 75 | 4/9
6 h-m-p 0.0035 0.0357 20.5611 ------------.. | 4/9
7 h-m-p 0.0000 0.0001 383.2778 ++ 895.575140 m 0.0001 109 | 5/9
8 h-m-p 0.0048 0.1357 5.8695 ------------.. | 5/9
9 h-m-p 0.0000 0.0001 317.7131 ++ 890.317115 m 0.0001 143 | 6/9
10 h-m-p 0.0059 1.0901 1.9674 ------------.. | 6/9
11 h-m-p 0.0000 0.0000 226.0547 ++ 888.021561 m 0.0000 177 | 7/9
12 h-m-p 0.0972 8.0000 0.0000 ++++ 888.021561 m 8.0000 191 | 7/9
13 h-m-p 0.0302 8.0000 0.0010 +++++ 888.021561 m 8.0000 208 | 7/9
14 h-m-p 0.0160 8.0000 0.7714 +++++ 888.021557 m 8.0000 225 | 7/9
15 h-m-p 1.6000 8.0000 0.2385 ++ 888.021556 m 8.0000 239 | 7/9
16 h-m-p 0.5702 8.0000 3.3458 ++ 888.021556 m 8.0000 253 | 7/9
17 h-m-p 1.6000 8.0000 1.9779 ++ 888.021556 m 8.0000 265 | 7/9
18 h-m-p 0.7473 3.7365 13.9042 --------Y 888.021556 0 0.0000 285 | 7/9
19 h-m-p 0.0993 8.0000 0.0004 ++++ 888.021556 m 8.0000 299 | 7/9
20 h-m-p 1.6000 8.0000 0.0002 C 888.021556 0 0.4000 313 | 7/9
21 h-m-p 0.2185 8.0000 0.0003 ----Y 888.021556 0 0.0002 331
Out..
lnL = -888.021556
332 lfun, 3652 eigenQcodon, 19920 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.094360 0.038608 0.052697 0.082033 0.091689 0.088753 0.000100 0.900000 1.002828 1.522335 1.300098
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.517343
np = 11
lnL0 = -983.929208
Iterating by ming2
Initial: fx= 983.929208
x= 0.09436 0.03861 0.05270 0.08203 0.09169 0.08875 0.00011 0.90000 1.00283 1.52233 1.30010
1 h-m-p 0.0000 0.0000 496.5792 ++ 983.255271 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0010 241.7561 ++++ 934.633931 m 0.0010 32 | 2/11
3 h-m-p 0.0000 0.0001 1208.0002 ++ 919.458179 m 0.0001 46 | 3/11
4 h-m-p 0.0010 0.0103 60.5414 ++ 896.606164 m 0.0103 60 | 4/11
5 h-m-p 0.0000 0.0000 1040632.9449 ++ 890.840014 m 0.0000 74 | 5/11
6 h-m-p 0.0002 0.0010 654.8636 ++ 888.478540 m 0.0010 88 | 6/11
7 h-m-p 0.0000 0.0000 47657.9307 ++ 888.326675 m 0.0000 102 | 6/11
8 h-m-p 0.0003 0.0062 337.1769 ----------.. | 6/11
9 h-m-p 0.0000 0.0000 225.5841 ++ 888.021529 m 0.0000 138 | 7/11
10 h-m-p 0.0000 0.0002 0.0000 Y 888.021529 0 0.0000 152
Out..
lnL = -888.021529
153 lfun, 1836 eigenQcodon, 10098 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -888.027495 S = -888.017391 -0.004432
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:11
did 20 / 49 patterns 0:11
did 30 / 49 patterns 0:12
did 40 / 49 patterns 0:12
did 49 / 49 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=229
NC_011896_1_WP_010907646_1_291_MLBR_RS01420 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
NC_002677_1_NP_301322_1_194_ML0281 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP
**************************************************
NC_011896_1_WP_010907646_1_291_MLBR_RS01420 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
NC_002677_1_NP_301322_1_194_ML0281 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR
**************************************************
NC_011896_1_WP_010907646_1_291_MLBR_RS01420 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
NC_002677_1_NP_301322_1_194_ML0281 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP
**************************************************
NC_011896_1_WP_010907646_1_291_MLBR_RS01420 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
NC_002677_1_NP_301322_1_194_ML0281 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV
**************************************************
NC_011896_1_WP_010907646_1_291_MLBR_RS01420 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
NC_002677_1_NP_301322_1_194_ML0281 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 AVVRDGVPTRRRERRSTFYRNVEGWMLVR
*****************************
>NC_011896_1_WP_010907646_1_291_MLBR_RS01420 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NC_002677_1_NP_301322_1_194_ML0281 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG >NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 TTGAACACGTCCGATAGCGCCCCCGGCGTGGCGGTGTTGCTGTTTGGCGA CGACCGAACCCGACAACGATGGAACACCCTAACCGCGCTGTCCACCTACC GGGCCGGCGGTCCCGACGACATCGACTCCATTGACGCGACGATCGGCCCG TACAGGCGACTGGTGGTCGTTGGCGGCGACGGCGACCTGGCAGCGGTGCT GGGACGGCTGTTACGTGCCGACCGGCTCGACATTGAGGTGGCTTATGTAC CGCACCAACGCACCGCGGCGACTCGGGTCTATCGCCTTCCGACCGGGCGC CGAGCGGCGCGACGCGCCCGGCGCGGTTACGCCACGCGGGTACCGCTGAT CCGCGACGAGACCGGGTCGGTGATCGTAGGCAGGGCAGACTGGCTTCCGG TTGTCGACCGACAGCCGTTGCACGGTGAGGCAATAGTTGATGACATCCCG CTGTTCGACGGCGATGTCGCCGGCGTGCGCATCGCACCGACGCTGGCCAT GCCGGGCTTACGGGCCAGGTTGCATACCTCCCGAACTGGCATAGGCATCT GGAGCCGATGGCTCACCGGCCGAGCGGTGCAGCTAGGCAGCACCGGTGTC GCTGTGGTACGTGATGGTGTCCCGACGCGCCGTCGGGAGCGGCGATCGAC GTTCTACCGCAACGTCGAAGGCTGGATGCTGGTCCGG
>NC_011896_1_WP_010907646_1_291_MLBR_RS01420 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NC_002677_1_NP_301322_1_194_ML0281 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR >NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560 LNTSDSAPGVAVLLFGDDRTRQRWNTLTALSTYRAGGPDDIDSIDATIGP YRRLVVVGGDGDLAAVLGRLLRADRLDIEVAYVPHQRTAATRVYRLPTGR RAARRARRGYATRVPLIRDETGSVIVGRADWLPVVDRQPLHGEAIVDDIP LFDGDVAGVRIAPTLAMPGLRARLHTSRTGIGIWSRWLTGRAVQLGSTGV AVVRDGVPTRRRERRSTFYRNVEGWMLVR
#NEXUS
[ID: 0409461546]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907646_1_291_MLBR_RS01420
NC_002677_1_NP_301322_1_194_ML0281
NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380
NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505
NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510
NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907646_1_291_MLBR_RS01420,
2 NC_002677_1_NP_301322_1_194_ML0281,
3 NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380,
4 NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505,
5 NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510,
6 NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06985367,2:0.06791181,3:0.07257429,4:0.06610218,5:0.06900685,6:0.06967838);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06985367,2:0.06791181,3:0.07257429,4:0.06610218,5:0.06900685,6:0.06967838);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -911.20 -914.43
2 -911.28 -916.00
--------------------------------------
TOTAL -911.23 -915.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0281/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902984 0.093183 0.377322 1.472407 0.870641 1286.03 1319.25 1.000
r(A<->C){all} 0.170021 0.020927 0.000062 0.465713 0.134141 195.34 211.60 1.002
r(A<->G){all} 0.163324 0.019721 0.000071 0.449213 0.124156 239.43 268.40 1.003
r(A<->T){all} 0.157597 0.017391 0.000083 0.424753 0.121688 258.46 283.24 1.003
r(C<->G){all} 0.176440 0.022759 0.000095 0.492436 0.135039 111.43 144.83 1.000
r(C<->T){all} 0.173828 0.020621 0.000029 0.466342 0.134784 111.46 175.48 1.002
r(G<->T){all} 0.158791 0.018534 0.000020 0.433757 0.125554 147.05 215.97 1.000
pi(A){all} 0.159018 0.000187 0.130953 0.185129 0.158636 915.80 1129.90 1.000
pi(C){all} 0.323201 0.000314 0.287969 0.356461 0.323524 1081.58 1275.35 1.000
pi(G){all} 0.349612 0.000328 0.311799 0.382806 0.349183 1215.05 1291.80 1.001
pi(T){all} 0.168169 0.000205 0.140139 0.195731 0.167742 1251.74 1321.15 1.000
alpha{1,2} 0.438181 0.243597 0.000109 1.481592 0.259960 1188.72 1210.77 1.003
alpha{3} 0.448864 0.227720 0.000256 1.455069 0.293928 1138.68 1282.38 1.000
pinvar{all} 0.997726 0.000007 0.992220 1.000000 0.998601 1088.49 1154.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0281/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 229
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 4 4 4 4 4 4 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 2 2 2 2 2 2 | CGC 9 9 9 9 9 9
CTA 2 2 2 2 2 2 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 11 11 11 11 11 11
CTG 10 10 10 10 10 10 | CCG 10 10 10 10 10 10 | CAG 2 2 2 2 2 2 | CGG 10 10 10 10 10 10
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 7 7 7 7 7 7 | ACC 10 10 10 10 10 10 | AAC 3 3 3 3 3 3 | AGC 3 3 3 3 3 3
ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 6 6 6 6 6 6 | AAG 0 0 0 0 0 0 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 4 4 4 4 4 4 | Gly GGT 5 5 5 5 5 5
GTC 8 8 8 8 8 8 | GCC 8 8 8 8 8 8 | GAC 15 15 15 15 15 15 | GGC 16 16 16 16 16 16
GTA 4 4 4 4 4 4 | GCA 4 4 4 4 4 4 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 9 9 9 9 9 9 | GCG 9 9 9 9 9 9 | GAG 4 4 4 4 4 4 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907646_1_291_MLBR_RS01420
position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485
position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694
position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061
Average T:0.16739 C:0.32314 A:0.15866 G:0.35080
#2: NC_002677_1_NP_301322_1_194_ML0281
position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485
position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694
position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061
Average T:0.16739 C:0.32314 A:0.15866 G:0.35080
#3: NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380
position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485
position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694
position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061
Average T:0.16739 C:0.32314 A:0.15866 G:0.35080
#4: NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505
position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485
position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694
position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061
Average T:0.16739 C:0.32314 A:0.15866 G:0.35080
#5: NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510
position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485
position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694
position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061
Average T:0.16739 C:0.32314 A:0.15866 G:0.35080
#6: NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560
position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485
position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694
position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061
Average T:0.16739 C:0.32314 A:0.15866 G:0.35080
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 12 | TCC 24 | TAC 24 | TGC 0
Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 12 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 18
CTC 12 | CCC 12 | CAC 12 | CGC 54
CTA 12 | CCA 0 | Gln Q CAA 12 | CGA 66
CTG 60 | CCG 60 | CAG 12 | CGG 60
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 0
ATC 42 | ACC 60 | AAC 18 | AGC 18
ATA 12 | ACA 0 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 12 | ACG 36 | AAG 0 | AGG 18
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 24 | Gly G GGT 30
GTC 48 | GCC 48 | GAC 90 | GGC 96
GTA 24 | GCA 24 | Glu E GAA 6 | GGA 6
GTG 54 | GCG 54 | GAG 24 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11354 C:0.29694 A:0.17467 G:0.41485
position 2: T:0.27074 C:0.25764 A:0.17467 G:0.29694
position 3: T:0.11790 C:0.41485 A:0.12664 G:0.34061
Average T:0.16739 C:0.32314 A:0.15866 G:0.35080
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -888.021536 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299791 1.300098
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29979
omega (dN/dS) = 1.30010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 508.4 178.6 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -888.021535 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.706270 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.70627 0.29373
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 509.3 177.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -888.021533 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.023251 0.796345 0.000001 1.508825
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.02325 0.79635 0.18040
w: 0.00000 1.00000 1.50883
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0
7..2 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0
7..3 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0
7..4 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0
7..5 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0
7..6 0.000 509.3 177.7 1.0685 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907646_1_291_MLBR_RS01420)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907646_1_291_MLBR_RS01420)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -888.021556 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 29.512351 43.166096
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 29.51235 q = 43.16610
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.31338 0.34647 0.36669 0.38308 0.39795 0.41248 0.42758 0.44451 0.46581 0.50172
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0
7..2 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0
7..3 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0
7..4 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0
7..5 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0
7..6 0.000 509.3 177.7 0.4060 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -888.021529 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.479420 0.005000 1.957401 2.606790
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907646_1_291_MLBR_RS01420: 0.000004, NC_002677_1_NP_301322_1_194_ML0281: 0.000004, NZ_LVXE01000050_1_WP_010907646_1_2104_A3216_RS11380: 0.000004, NZ_LYPH01000059_1_WP_010907646_1_2198_A8144_RS10505: 0.000004, NZ_CP029543_1_WP_010907646_1_292_DIJ64_RS01510: 0.000004, NZ_AP014567_1_WP_010907646_1_302_JK2ML_RS01560: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.47942 p = 0.00500 q = 1.95740
(p1 = 0.52058) w = 2.60679
MLEs of dN/dS (w) for site classes (K=11)
p: 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.04794 0.52058
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.60679
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0
7..2 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0
7..3 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0
7..4 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0
7..5 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0
7..6 0.000 509.3 177.7 1.3570 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907646_1_291_MLBR_RS01420)
Pr(w>1) post mean +- SE for w
1 L 0.521 1.357
2 N 0.521 1.357
3 T 0.521 1.357
4 S 0.521 1.357
5 D 0.521 1.357
6 S 0.521 1.357
7 A 0.521 1.357
8 P 0.521 1.357
9 G 0.521 1.357
10 V 0.521 1.357
11 A 0.521 1.357
12 V 0.521 1.357
13 L 0.521 1.357
14 L 0.521 1.357
15 F 0.521 1.357
16 G 0.521 1.357
17 D 0.521 1.357
18 D 0.521 1.357
19 R 0.521 1.357
20 T 0.521 1.357
21 R 0.521 1.357
22 Q 0.521 1.357
23 R 0.521 1.357
24 W 0.521 1.357
25 N 0.521 1.357
26 T 0.521 1.357
27 L 0.521 1.357
28 T 0.521 1.357
29 A 0.521 1.357
30 L 0.521 1.357
31 S 0.521 1.357
32 T 0.521 1.357
33 Y 0.521 1.357
34 R 0.521 1.357
35 A 0.521 1.357
36 G 0.521 1.357
37 G 0.521 1.357
38 P 0.521 1.357
39 D 0.521 1.357
40 D 0.521 1.357
41 I 0.521 1.357
42 D 0.521 1.357
43 S 0.521 1.357
44 I 0.521 1.357
45 D 0.521 1.357
46 A 0.521 1.357
47 T 0.521 1.357
48 I 0.521 1.357
49 G 0.521 1.357
50 P 0.521 1.357
51 Y 0.521 1.357
52 R 0.521 1.357
53 R 0.521 1.357
54 L 0.521 1.357
55 V 0.521 1.357
56 V 0.521 1.357
57 V 0.521 1.357
58 G 0.521 1.357
59 G 0.521 1.357
60 D 0.521 1.357
61 G 0.521 1.357
62 D 0.521 1.357
63 L 0.521 1.357
64 A 0.521 1.357
65 A 0.521 1.357
66 V 0.521 1.357
67 L 0.521 1.357
68 G 0.521 1.357
69 R 0.521 1.357
70 L 0.521 1.357
71 L 0.521 1.357
72 R 0.521 1.357
73 A 0.521 1.357
74 D 0.521 1.357
75 R 0.521 1.357
76 L 0.521 1.357
77 D 0.521 1.357
78 I 0.521 1.357
79 E 0.521 1.357
80 V 0.521 1.357
81 A 0.521 1.357
82 Y 0.521 1.357
83 V 0.521 1.357
84 P 0.521 1.357
85 H 0.521 1.357
86 Q 0.521 1.357
87 R 0.521 1.357
88 T 0.521 1.357
89 A 0.521 1.357
90 A 0.521 1.357
91 T 0.521 1.357
92 R 0.521 1.357
93 V 0.521 1.357
94 Y 0.521 1.357
95 R 0.521 1.357
96 L 0.521 1.357
97 P 0.521 1.357
98 T 0.521 1.357
99 G 0.521 1.357
100 R 0.521 1.357
101 R 0.521 1.357
102 A 0.521 1.357
103 A 0.521 1.357
104 R 0.521 1.357
105 R 0.521 1.357
106 A 0.521 1.357
107 R 0.521 1.357
108 R 0.521 1.357
109 G 0.521 1.357
110 Y 0.521 1.357
111 A 0.521 1.357
112 T 0.521 1.357
113 R 0.521 1.357
114 V 0.521 1.357
115 P 0.521 1.357
116 L 0.521 1.357
117 I 0.521 1.357
118 R 0.521 1.357
119 D 0.521 1.357
120 E 0.521 1.357
121 T 0.521 1.357
122 G 0.521 1.357
123 S 0.521 1.357
124 V 0.521 1.357
125 I 0.521 1.357
126 V 0.521 1.357
127 G 0.521 1.357
128 R 0.521 1.357
129 A 0.521 1.357
130 D 0.521 1.357
131 W 0.521 1.357
132 L 0.521 1.357
133 P 0.521 1.357
134 V 0.521 1.357
135 V 0.521 1.357
136 D 0.521 1.357
137 R 0.521 1.357
138 Q 0.521 1.357
139 P 0.521 1.357
140 L 0.521 1.357
141 H 0.521 1.357
142 G 0.521 1.357
143 E 0.521 1.357
144 A 0.521 1.357
145 I 0.521 1.357
146 V 0.521 1.357
147 D 0.521 1.357
148 D 0.521 1.357
149 I 0.521 1.357
150 P 0.521 1.357
151 L 0.521 1.357
152 F 0.521 1.357
153 D 0.521 1.357
154 G 0.521 1.357
155 D 0.521 1.357
156 V 0.521 1.357
157 A 0.521 1.357
158 G 0.521 1.357
159 V 0.521 1.357
160 R 0.521 1.357
161 I 0.521 1.357
162 A 0.521 1.357
163 P 0.521 1.357
164 T 0.521 1.357
165 L 0.521 1.357
166 A 0.521 1.357
167 M 0.521 1.357
168 P 0.521 1.357
169 G 0.521 1.357
170 L 0.521 1.357
171 R 0.521 1.357
172 A 0.521 1.357
173 R 0.521 1.357
174 L 0.521 1.357
175 H 0.521 1.357
176 T 0.521 1.357
177 S 0.521 1.357
178 R 0.521 1.357
179 T 0.521 1.357
180 G 0.521 1.357
181 I 0.521 1.357
182 G 0.521 1.357
183 I 0.521 1.357
184 W 0.521 1.357
185 S 0.521 1.357
186 R 0.521 1.357
187 W 0.521 1.357
188 L 0.521 1.357
189 T 0.521 1.357
190 G 0.521 1.357
191 R 0.521 1.357
192 A 0.521 1.357
193 V 0.521 1.357
194 Q 0.521 1.357
195 L 0.521 1.357
196 G 0.521 1.357
197 S 0.521 1.357
198 T 0.521 1.357
199 G 0.521 1.357
200 V 0.521 1.357
201 A 0.521 1.357
202 V 0.521 1.357
203 V 0.521 1.357
204 R 0.521 1.357
205 D 0.521 1.357
206 G 0.521 1.357
207 V 0.521 1.357
208 P 0.521 1.357
209 T 0.521 1.357
210 R 0.521 1.357
211 R 0.521 1.357
212 R 0.521 1.357
213 E 0.521 1.357
214 R 0.521 1.357
215 R 0.521 1.357
216 S 0.521 1.357
217 T 0.521 1.357
218 F 0.521 1.357
219 Y 0.521 1.357
220 R 0.521 1.357
221 N 0.521 1.357
222 V 0.521 1.357
223 E 0.521 1.357
224 G 0.521 1.357
225 W 0.521 1.357
226 M 0.521 1.357
227 L 0.521 1.357
228 V 0.521 1.357
229 R 0.521 1.357
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907646_1_291_MLBR_RS01420)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:12
Model 1: NearlyNeutral -888.021535 Model 2: PositiveSelection -888.021533 Model 0: one-ratio -888.021536 Model 7: beta -888.021556 Model 8: beta&w>1 -888.021529 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 5.400000009103678E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
