--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:05:12 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0284/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -551.53 -554.31
2 -551.50 -555.13
--------------------------------------
TOTAL -551.51 -554.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891099 0.085157 0.354771 1.461019 0.859373 1401.74 1433.31 1.001
r(A<->C){all} 0.152921 0.017405 0.000056 0.417120 0.118443 157.04 300.20 1.000
r(A<->G){all} 0.171165 0.020419 0.000083 0.454439 0.135067 235.37 272.74 1.004
r(A<->T){all} 0.168221 0.018735 0.000027 0.438747 0.131900 221.56 254.43 1.000
r(C<->G){all} 0.169653 0.018371 0.000064 0.425878 0.140459 192.48 216.55 1.007
r(C<->T){all} 0.173672 0.021382 0.000072 0.472730 0.134667 192.13 209.08 1.001
r(G<->T){all} 0.164369 0.019750 0.000082 0.442822 0.125588 123.42 199.08 1.002
pi(A){all} 0.168229 0.000325 0.132373 0.201489 0.167631 1311.35 1406.17 1.000
pi(C){all} 0.327690 0.000538 0.278631 0.369461 0.327444 1143.03 1264.62 1.000
pi(G){all} 0.326469 0.000519 0.281070 0.369079 0.326103 1328.99 1415.00 1.000
pi(T){all} 0.177611 0.000332 0.143029 0.212975 0.176994 1037.69 1228.21 1.000
alpha{1,2} 0.396958 0.199618 0.000232 1.356336 0.229981 1170.45 1335.73 1.000
alpha{3} 0.463562 0.245638 0.000175 1.490978 0.300774 1197.90 1211.78 1.000
pinvar{all} 0.996079 0.000022 0.987309 0.999994 0.997570 1233.56 1244.90 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -531.169624
Model 2: PositiveSelection -531.169576
Model 0: one-ratio -531.169617
Model 7: beta -531.169661
Model 8: beta&w>1 -531.169651
Model 0 vs 1 1.3999999964653398E-5
Model 2 vs 1 9.599999998499698E-5
Model 8 vs 7 1.9999999949504854E-5
>C1
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C2
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C3
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C4
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C5
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C6
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=137
C1 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C2 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C3 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C4 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C5 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C6 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
**************************************************
C1 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C2 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C3 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C4 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C5 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C6 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
**************************************************
C1 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C2 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C3 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C4 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C5 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C6 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
*************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4110]--->[4110]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.668 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C2 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C3 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C4 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C5 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C6 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
**************************************************
C1 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C2 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C3 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C4 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C5 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C6 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
**************************************************
C1 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C2 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C3 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C4 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C5 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C6 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
*************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C2 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C3 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C4 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C5 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C6 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
**************************************************
C1 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C2 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C3 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C4 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C5 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C6 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
**************************************************
C1 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C2 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C3 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C4 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C5 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C6 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
**************************************************
C1 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C2 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C3 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C4 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C5 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C6 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
**************************************************
C1 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C2 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C3 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C4 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C5 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C6 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
**************************************************
C1 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C2 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C3 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C4 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C5 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C6 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
**************************************************
C1 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C2 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C3 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C4 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C5 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C6 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
**************************************************
C1 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C2 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C3 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C4 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C5 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C6 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
**************************************************
C1 AGCTCGGGCTC
C2 AGCTCGGGCTC
C3 AGCTCGGGCTC
C4 AGCTCGGGCTC
C5 AGCTCGGGCTC
C6 AGCTCGGGCTC
***********
>C1
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C2
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C3
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C4
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C5
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C6
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C1
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C2
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C3
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C4
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C5
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C6
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 411 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579799035
Setting output file names to "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1073304123
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0788522640
Seed = 622211566
Swapseed = 1579799035
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -919.837651 -- -24.965149
Chain 2 -- -919.837704 -- -24.965149
Chain 3 -- -919.837564 -- -24.965149
Chain 4 -- -919.837651 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -919.837564 -- -24.965149
Chain 2 -- -919.837704 -- -24.965149
Chain 3 -- -919.837704 -- -24.965149
Chain 4 -- -919.837564 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-919.838] (-919.838) (-919.838) (-919.838) * [-919.838] (-919.838) (-919.838) (-919.838)
500 -- [-556.797] (-562.316) (-576.878) (-579.463) * (-564.325) [-563.707] (-560.074) (-578.208) -- 0:00:00
1000 -- [-562.937] (-564.284) (-566.979) (-561.061) * (-557.505) (-561.600) (-564.505) [-562.852] -- 0:00:00
1500 -- (-559.052) [-558.422] (-562.793) (-572.413) * (-559.875) [-564.741] (-557.683) (-561.867) -- 0:00:00
2000 -- [-560.491] (-559.298) (-563.361) (-568.315) * (-556.172) (-557.141) (-557.384) [-559.495] -- 0:00:00
2500 -- (-563.028) (-560.302) [-560.014] (-556.252) * (-562.197) (-568.468) (-564.651) [-562.147] -- 0:00:00
3000 -- [-563.860] (-566.848) (-559.748) (-560.894) * (-569.420) (-560.824) (-557.168) [-559.767] -- 0:00:00
3500 -- (-565.092) (-557.406) [-556.763] (-558.726) * (-561.162) (-565.214) [-560.909] (-561.881) -- 0:00:00
4000 -- (-556.542) (-569.656) [-555.716] (-565.589) * (-556.986) (-568.727) [-563.284] (-560.454) -- 0:00:00
4500 -- (-563.519) (-567.618) [-564.778] (-564.421) * [-561.781] (-564.043) (-564.602) (-561.648) -- 0:00:00
5000 -- (-558.904) (-558.567) [-558.364] (-558.883) * (-561.689) [-560.132] (-561.459) (-567.667) -- 0:00:00
Average standard deviation of split frequencies: 0.070711
5500 -- (-559.646) (-565.076) (-557.437) [-563.341] * (-565.204) [-564.535] (-559.803) (-562.084) -- 0:00:00
6000 -- [-559.207] (-560.009) (-562.127) (-561.880) * (-558.481) (-567.381) (-559.449) [-556.472] -- 0:02:45
6500 -- (-559.483) (-564.394) (-563.007) [-562.388] * [-564.023] (-576.144) (-562.300) (-563.822) -- 0:02:32
7000 -- [-559.162] (-558.806) (-566.753) (-565.480) * (-560.891) (-564.606) [-564.060] (-570.963) -- 0:02:21
7500 -- (-554.655) (-560.769) [-562.802] (-561.236) * (-559.419) (-555.394) [-560.648] (-559.550) -- 0:02:12
8000 -- [-559.411] (-566.959) (-561.133) (-560.609) * (-567.253) (-551.667) (-562.864) [-561.697] -- 0:02:04
8500 -- (-558.922) (-561.260) (-554.027) [-560.808] * (-560.274) (-549.968) [-555.581] (-557.504) -- 0:01:56
9000 -- [-557.615] (-564.638) (-561.015) (-564.344) * [-556.379] (-551.747) (-564.055) (-557.920) -- 0:01:50
9500 -- (-556.455) (-564.224) [-558.680] (-568.173) * (-559.863) (-551.451) [-558.922] (-568.851) -- 0:01:44
10000 -- [-560.606] (-559.590) (-556.013) (-561.083) * [-566.102] (-553.183) (-566.295) (-557.369) -- 0:01:39
Average standard deviation of split frequencies: 0.069173
10500 -- (-561.111) (-557.384) (-571.485) [-565.286] * [-561.646] (-553.444) (-573.950) (-560.545) -- 0:01:34
11000 -- (-559.147) (-556.814) (-575.274) [-567.374] * (-563.099) [-550.608] (-563.963) (-561.513) -- 0:01:29
11500 -- (-567.932) (-559.820) (-558.858) [-558.841] * [-566.465] (-551.746) (-559.097) (-565.418) -- 0:01:25
12000 -- (-561.104) [-559.626] (-561.062) (-567.408) * [-565.511] (-550.762) (-557.315) (-572.834) -- 0:01:22
12500 -- (-564.543) (-564.176) (-555.649) [-560.419] * [-562.167] (-550.706) (-554.647) (-556.294) -- 0:01:19
13000 -- (-564.765) (-565.082) (-574.502) [-555.830] * (-570.021) (-551.460) (-552.928) [-560.448] -- 0:01:15
13500 -- (-557.595) (-564.305) [-561.557] (-561.342) * (-574.884) [-551.615] (-551.594) (-557.667) -- 0:01:13
14000 -- (-560.699) [-558.870] (-566.319) (-563.314) * (-564.527) [-555.051] (-552.838) (-560.086) -- 0:01:10
14500 -- [-556.099] (-561.985) (-570.997) (-562.721) * (-554.751) (-553.996) [-552.752] (-561.066) -- 0:01:07
15000 -- [-555.735] (-574.621) (-563.472) (-562.305) * (-553.915) (-552.774) (-552.178) [-560.252] -- 0:01:05
Average standard deviation of split frequencies: 0.053314
15500 -- (-562.168) [-560.155] (-557.363) (-569.827) * (-552.925) (-550.171) (-551.159) [-557.465] -- 0:01:03
16000 -- (-565.317) (-567.363) [-559.760] (-555.978) * (-552.852) (-550.181) (-551.859) [-563.690] -- 0:01:01
16500 -- [-565.092] (-575.717) (-558.095) (-567.749) * (-551.597) [-552.124] (-553.737) (-560.923) -- 0:00:59
17000 -- (-565.890) (-580.486) (-566.741) [-563.534] * (-552.658) (-551.952) (-552.501) [-560.563] -- 0:00:57
17500 -- (-568.414) (-571.891) (-560.972) [-558.563] * (-553.879) (-552.069) (-553.712) [-565.602] -- 0:00:56
18000 -- (-561.584) (-560.374) [-562.980] (-566.896) * [-551.310] (-554.420) (-553.916) (-571.997) -- 0:00:54
18500 -- (-575.183) [-551.089] (-560.690) (-565.809) * [-552.236] (-552.758) (-552.271) (-564.815) -- 0:00:53
19000 -- (-556.471) (-551.619) (-562.633) [-559.672] * (-553.265) (-552.666) (-553.306) [-559.321] -- 0:00:51
19500 -- (-565.651) (-552.662) (-562.555) [-558.768] * (-554.108) [-552.199] (-553.345) (-565.502) -- 0:00:50
20000 -- (-556.562) (-552.404) [-558.914] (-567.992) * (-552.648) [-550.741] (-552.578) (-560.588) -- 0:00:49
Average standard deviation of split frequencies: 0.058165
20500 -- (-568.406) [-552.315] (-559.385) (-564.552) * (-551.405) [-551.531] (-552.222) (-561.508) -- 0:00:47
21000 -- (-558.361) [-552.299] (-556.585) (-567.454) * [-551.537] (-558.539) (-550.828) (-571.076) -- 0:00:46
21500 -- (-564.279) (-551.515) [-556.286] (-558.808) * (-552.746) [-552.233] (-550.599) (-579.959) -- 0:00:45
22000 -- (-558.138) [-551.009] (-562.473) (-561.108) * (-551.944) [-553.964] (-550.980) (-565.468) -- 0:00:44
22500 -- (-566.328) (-554.800) (-568.017) [-557.501] * [-551.040] (-553.645) (-552.802) (-552.735) -- 0:00:43
23000 -- (-560.473) [-551.899] (-563.553) (-557.123) * (-552.835) [-551.232] (-551.548) (-554.851) -- 0:01:24
23500 -- (-555.044) (-554.394) (-560.638) [-556.138] * [-557.597] (-550.745) (-550.853) (-553.030) -- 0:01:23
24000 -- (-560.000) [-550.841] (-557.750) (-556.491) * (-550.790) (-554.270) (-550.953) [-552.350] -- 0:01:21
24500 -- (-563.221) [-551.946] (-562.067) (-565.483) * (-551.037) (-556.379) [-550.610] (-550.593) -- 0:01:19
25000 -- (-568.906) (-553.460) (-562.722) [-556.875] * (-556.459) [-554.431] (-554.915) (-553.228) -- 0:01:18
Average standard deviation of split frequencies: 0.046622
25500 -- (-566.656) (-550.000) [-565.998] (-559.168) * [-557.902] (-551.662) (-551.374) (-552.209) -- 0:01:16
26000 -- (-565.100) [-550.642] (-558.827) (-565.544) * (-554.114) (-553.096) (-554.338) [-551.077] -- 0:01:14
26500 -- (-558.208) (-552.415) (-561.236) [-558.452] * (-552.177) [-550.934] (-551.395) (-552.645) -- 0:01:13
27000 -- (-561.249) (-553.592) [-557.997] (-562.395) * (-551.558) [-553.680] (-551.383) (-552.920) -- 0:01:12
27500 -- (-561.868) (-553.034) (-560.688) [-560.629] * (-551.247) (-554.158) [-552.291] (-553.015) -- 0:01:10
28000 -- (-562.392) (-551.204) (-570.151) [-562.166] * (-551.866) (-554.295) (-554.254) [-552.953] -- 0:01:09
28500 -- (-562.461) (-551.505) (-563.122) [-560.199] * (-552.730) (-550.358) (-551.726) [-551.201] -- 0:01:08
29000 -- (-557.382) (-551.422) (-563.808) [-556.904] * [-552.229] (-551.427) (-553.292) (-551.557) -- 0:01:06
29500 -- (-567.375) (-555.533) [-561.422] (-560.450) * (-552.486) (-550.976) (-552.605) [-553.913] -- 0:01:05
30000 -- [-563.327] (-555.906) (-564.172) (-573.608) * (-552.315) (-550.259) (-550.594) [-552.009] -- 0:01:04
Average standard deviation of split frequencies: 0.039284
30500 -- (-561.930) [-553.463] (-560.489) (-565.646) * (-552.249) [-550.518] (-551.041) (-550.202) -- 0:01:03
31000 -- (-555.865) [-551.200] (-561.378) (-554.842) * [-550.493] (-550.759) (-555.569) (-550.234) -- 0:01:02
31500 -- (-569.718) [-553.866] (-563.010) (-556.292) * [-551.975] (-551.793) (-550.915) (-552.873) -- 0:01:01
32000 -- [-560.322] (-551.037) (-564.621) (-551.774) * [-552.910] (-552.535) (-550.147) (-551.182) -- 0:01:00
32500 -- (-564.007) (-551.392) (-559.385) [-551.045] * (-553.161) (-555.394) [-550.943] (-550.688) -- 0:00:59
33000 -- (-560.524) (-552.803) [-556.675] (-550.475) * (-553.297) (-556.771) [-552.419] (-553.527) -- 0:00:58
33500 -- (-563.724) (-550.989) (-556.794) [-551.449] * (-551.814) (-552.893) (-553.782) [-551.837] -- 0:00:57
34000 -- (-562.227) (-551.318) [-568.548] (-558.692) * (-554.059) (-553.204) (-553.159) [-550.828] -- 0:00:56
34500 -- (-565.823) [-553.972] (-561.755) (-551.308) * (-553.396) (-553.299) (-552.070) [-552.107] -- 0:00:55
35000 -- [-559.889] (-555.287) (-564.285) (-554.261) * (-553.895) (-552.165) [-554.845] (-552.443) -- 0:00:55
Average standard deviation of split frequencies: 0.037101
35500 -- [-559.228] (-554.624) (-563.003) (-557.889) * [-550.565] (-552.968) (-554.728) (-551.564) -- 0:00:54
36000 -- [-558.708] (-553.122) (-567.307) (-557.053) * (-550.879) (-553.757) (-552.847) [-551.809] -- 0:00:53
36500 -- [-562.726] (-552.286) (-560.468) (-553.957) * (-553.293) (-554.457) [-554.784] (-551.724) -- 0:00:52
37000 -- (-572.990) (-551.341) (-563.137) [-551.209] * (-552.926) [-553.127] (-553.586) (-551.313) -- 0:00:52
37500 -- (-568.708) [-556.912] (-572.870) (-554.467) * (-551.329) (-552.469) [-552.844] (-554.564) -- 0:00:51
38000 -- [-567.206] (-557.305) (-570.201) (-555.121) * [-550.867] (-558.057) (-552.522) (-552.203) -- 0:00:50
38500 -- (-565.901) (-551.485) [-560.044] (-551.840) * (-552.365) [-550.844] (-552.085) (-551.898) -- 0:00:49
39000 -- (-566.064) (-550.721) (-567.052) [-552.602] * [-552.799] (-550.830) (-551.816) (-554.186) -- 0:00:49
39500 -- (-570.727) (-551.161) [-556.699] (-553.567) * (-551.763) (-554.472) (-551.566) [-550.649] -- 0:00:48
40000 -- [-568.059] (-550.986) (-564.614) (-553.504) * (-553.822) (-552.104) (-552.709) [-553.674] -- 0:01:12
Average standard deviation of split frequencies: 0.034776
40500 -- (-570.216) (-551.580) (-565.104) [-550.918] * (-551.988) (-552.004) [-552.061] (-554.019) -- 0:01:11
41000 -- (-560.552) (-550.781) (-560.024) [-551.830] * (-552.164) (-551.761) [-555.668] (-551.915) -- 0:01:10
41500 -- (-552.925) (-551.488) [-558.857] (-553.411) * (-550.801) [-558.233] (-555.117) (-550.609) -- 0:01:09
42000 -- (-551.485) (-553.270) (-557.751) [-552.295] * (-552.960) [-551.283] (-552.236) (-550.445) -- 0:01:08
42500 -- (-553.837) (-553.672) (-565.777) [-551.844] * [-551.384] (-555.447) (-552.371) (-551.725) -- 0:01:07
43000 -- (-553.559) [-551.881] (-559.452) (-551.641) * [-550.238] (-553.941) (-551.505) (-554.624) -- 0:01:06
43500 -- (-551.307) (-555.292) [-558.541] (-552.149) * (-551.023) [-554.867] (-552.129) (-552.380) -- 0:01:05
44000 -- [-550.974] (-553.165) (-555.043) (-551.511) * (-556.721) (-559.647) [-552.997] (-551.706) -- 0:01:05
44500 -- (-552.258) (-552.567) (-565.818) [-550.609] * [-551.637] (-551.341) (-554.149) (-551.156) -- 0:01:04
45000 -- (-551.725) (-555.276) [-559.303] (-557.742) * (-552.161) (-550.967) (-554.022) [-551.863] -- 0:01:03
Average standard deviation of split frequencies: 0.028881
45500 -- [-554.189] (-550.405) (-568.541) (-557.741) * (-555.971) (-556.114) [-551.770] (-553.975) -- 0:01:02
46000 -- (-553.951) (-551.345) (-564.134) [-553.484] * [-553.862] (-555.162) (-552.006) (-551.576) -- 0:01:02
46500 -- [-551.244] (-551.343) (-563.645) (-557.155) * [-550.154] (-554.191) (-551.872) (-553.823) -- 0:01:01
47000 -- [-552.045] (-550.900) (-556.921) (-553.336) * [-551.334] (-550.355) (-553.642) (-553.332) -- 0:01:00
47500 -- (-554.588) (-550.635) [-558.879] (-556.240) * [-551.004] (-551.277) (-551.338) (-551.823) -- 0:01:00
48000 -- (-551.739) [-552.482] (-559.409) (-558.104) * (-552.116) [-552.538] (-551.425) (-553.741) -- 0:00:59
48500 -- (-553.151) (-550.323) (-561.281) [-550.915] * (-554.974) (-552.036) [-550.790] (-559.382) -- 0:00:58
49000 -- [-550.642] (-551.109) (-559.179) (-551.479) * (-555.095) [-551.272] (-552.121) (-556.177) -- 0:00:58
49500 -- (-552.896) (-553.099) (-556.141) [-552.240] * (-557.693) (-556.387) [-551.975] (-558.493) -- 0:00:57
50000 -- (-554.762) (-558.833) [-558.940] (-551.894) * [-552.138] (-554.005) (-558.424) (-552.388) -- 0:00:57
Average standard deviation of split frequencies: 0.026517
50500 -- (-553.337) [-552.478] (-563.087) (-551.120) * (-553.011) [-552.521] (-553.281) (-552.814) -- 0:00:56
51000 -- (-552.032) (-552.098) [-556.944] (-551.981) * (-550.207) (-553.556) [-551.511] (-551.939) -- 0:00:55
51500 -- [-553.746] (-551.178) (-559.485) (-551.209) * (-551.229) (-550.641) [-550.162] (-550.189) -- 0:00:55
52000 -- [-550.899] (-552.461) (-560.030) (-550.115) * (-551.660) (-551.965) (-552.160) [-551.199] -- 0:00:54
52500 -- [-550.899] (-550.939) (-564.783) (-552.075) * (-552.485) (-550.321) (-551.145) [-550.100] -- 0:00:54
53000 -- (-556.401) (-555.050) (-559.132) [-553.722] * (-556.472) (-551.595) (-550.385) [-551.634] -- 0:00:53
53500 -- [-553.675] (-558.482) (-560.799) (-557.466) * (-551.849) (-550.727) [-552.059] (-551.400) -- 0:00:53
54000 -- (-553.779) (-551.654) (-564.787) [-551.349] * [-552.974] (-554.028) (-554.312) (-550.666) -- 0:00:52
54500 -- (-551.833) (-550.933) (-570.427) [-551.584] * (-552.423) (-553.577) [-553.894] (-554.204) -- 0:00:52
55000 -- (-554.855) (-554.787) (-556.325) [-552.559] * (-552.158) (-550.312) [-553.535] (-551.281) -- 0:00:51
Average standard deviation of split frequencies: 0.022448
55500 -- [-551.942] (-554.629) (-559.837) (-551.916) * (-552.651) (-551.574) (-551.811) [-552.667] -- 0:00:51
56000 -- (-551.986) (-553.282) [-563.599] (-550.277) * (-554.928) (-551.468) (-552.203) [-554.347] -- 0:00:50
56500 -- (-552.828) [-551.050] (-552.354) (-550.657) * (-552.210) [-553.558] (-554.954) (-551.787) -- 0:00:50
57000 -- [-550.742] (-552.353) (-555.614) (-550.685) * (-552.592) (-555.706) [-552.595] (-553.615) -- 0:01:06
57500 -- (-550.331) (-551.390) [-552.270] (-551.340) * (-552.514) (-550.240) [-552.209] (-556.338) -- 0:01:05
58000 -- (-551.318) (-550.909) (-552.751) [-556.114] * (-552.485) (-550.559) [-554.850] (-552.778) -- 0:01:04
58500 -- (-550.451) [-550.924] (-551.622) (-551.240) * [-549.977] (-553.828) (-558.684) (-553.671) -- 0:01:04
59000 -- (-554.908) (-551.920) (-554.914) [-550.915] * (-555.288) (-551.760) [-553.700] (-551.300) -- 0:01:03
59500 -- (-553.149) [-552.460] (-551.396) (-554.933) * (-551.396) (-552.177) (-550.942) [-553.816] -- 0:01:03
60000 -- (-554.986) (-552.324) (-550.165) [-552.997] * (-552.186) (-552.614) [-554.658] (-551.154) -- 0:01:02
Average standard deviation of split frequencies: 0.022923
60500 -- (-558.363) (-551.945) [-552.356] (-551.386) * (-552.086) (-551.620) (-553.006) [-550.357] -- 0:01:02
61000 -- (-552.415) (-553.289) (-551.783) [-553.066] * (-550.274) (-556.787) (-552.946) [-553.116] -- 0:01:01
61500 -- (-549.842) (-552.100) (-553.446) [-556.115] * [-556.140] (-553.785) (-550.344) (-552.433) -- 0:01:01
62000 -- (-552.877) (-553.528) (-558.573) [-551.887] * [-555.615] (-551.424) (-553.375) (-555.887) -- 0:01:00
62500 -- [-550.410] (-554.838) (-553.376) (-554.447) * [-551.728] (-554.430) (-551.672) (-554.506) -- 0:01:00
63000 -- (-552.973) (-551.657) [-552.201] (-552.933) * (-550.547) [-550.480] (-551.772) (-553.790) -- 0:00:59
63500 -- (-551.261) (-558.293) (-553.084) [-553.007] * [-551.916] (-553.751) (-552.582) (-551.064) -- 0:00:58
64000 -- (-553.439) [-553.584] (-551.223) (-552.932) * (-550.328) (-550.321) [-551.530] (-557.768) -- 0:00:58
64500 -- (-554.656) [-556.106] (-553.663) (-554.656) * (-552.979) (-556.620) [-551.115] (-553.644) -- 0:00:58
65000 -- (-551.461) (-553.999) (-551.910) [-551.087] * (-550.922) (-553.145) (-550.960) [-552.746] -- 0:00:57
Average standard deviation of split frequencies: 0.020496
65500 -- (-551.499) (-553.576) (-554.135) [-551.257] * (-556.313) (-552.300) [-552.782] (-551.843) -- 0:00:57
66000 -- (-553.956) [-553.517] (-552.952) (-550.752) * (-555.088) (-553.090) (-554.029) [-550.786] -- 0:00:56
66500 -- (-552.923) [-550.289] (-552.133) (-555.095) * [-553.925] (-551.016) (-552.925) (-554.557) -- 0:00:56
67000 -- (-550.931) (-552.775) [-554.903] (-552.792) * (-554.578) (-550.783) (-551.507) [-552.623] -- 0:00:55
67500 -- (-551.013) (-555.097) (-552.952) [-551.671] * (-558.349) (-552.505) (-552.032) [-550.314] -- 0:00:55
68000 -- (-551.212) (-554.649) (-555.369) [-558.145] * (-552.763) [-552.228] (-552.113) (-553.230) -- 0:00:54
68500 -- (-551.051) (-553.985) (-557.425) [-551.740] * (-552.910) [-551.048] (-552.357) (-555.605) -- 0:00:54
69000 -- (-554.431) (-556.824) (-554.455) [-552.883] * (-551.351) (-550.602) (-554.668) [-552.139] -- 0:00:53
69500 -- (-552.004) (-552.813) [-550.607] (-551.387) * (-554.535) [-550.975] (-552.077) (-553.804) -- 0:00:53
70000 -- (-552.723) (-552.070) [-550.899] (-551.785) * (-556.049) (-552.439) (-552.082) [-550.114] -- 0:00:53
Average standard deviation of split frequencies: 0.025167
70500 -- (-553.262) (-550.569) (-550.983) [-550.811] * (-552.950) [-553.039] (-551.115) (-550.921) -- 0:00:52
71000 -- (-551.066) (-553.894) [-551.764] (-550.879) * [-550.793] (-553.795) (-554.308) (-551.070) -- 0:00:52
71500 -- (-553.762) [-554.171] (-558.708) (-551.930) * (-553.430) (-553.125) [-550.145] (-550.977) -- 0:00:51
72000 -- [-550.390] (-551.773) (-553.474) (-553.332) * (-550.734) (-555.002) [-552.839] (-551.678) -- 0:00:51
72500 -- [-550.741] (-553.505) (-557.252) (-552.270) * (-553.133) (-555.120) [-552.825] (-551.143) -- 0:00:51
73000 -- (-551.410) (-554.793) [-553.282] (-553.218) * (-553.028) (-551.063) (-550.990) [-552.045] -- 0:00:50
73500 -- (-553.208) [-553.654] (-553.095) (-552.643) * [-553.517] (-554.326) (-553.151) (-552.235) -- 0:00:50
74000 -- (-555.667) (-553.057) [-554.025] (-551.003) * (-553.602) (-549.867) [-551.077] (-551.910) -- 0:01:02
74500 -- (-552.939) (-554.218) (-551.791) [-552.827] * (-553.911) [-550.334] (-552.006) (-550.648) -- 0:01:02
75000 -- [-552.275] (-554.457) (-550.431) (-552.711) * (-551.397) (-551.055) [-551.669] (-551.147) -- 0:01:01
Average standard deviation of split frequencies: 0.024811
75500 -- (-551.786) (-555.101) (-550.612) [-553.514] * (-552.317) (-550.390) [-552.507] (-551.545) -- 0:01:01
76000 -- (-552.826) (-551.860) (-550.346) [-555.004] * (-551.724) (-553.066) (-551.744) [-551.054] -- 0:01:00
76500 -- (-552.297) (-556.316) [-551.230] (-552.032) * (-551.066) (-554.170) [-554.340] (-551.493) -- 0:01:00
77000 -- [-553.758] (-552.698) (-551.570) (-554.689) * [-553.200] (-550.855) (-552.062) (-555.324) -- 0:00:59
77500 -- (-553.490) [-550.840] (-551.068) (-552.622) * [-551.808] (-558.049) (-551.793) (-551.575) -- 0:00:59
78000 -- (-554.055) (-554.481) [-552.018] (-551.390) * (-554.076) (-559.177) (-552.173) [-552.367] -- 0:00:59
78500 -- (-551.878) [-551.721] (-552.816) (-550.262) * (-551.994) (-555.952) (-555.326) [-556.595] -- 0:00:58
79000 -- (-550.736) (-550.515) [-552.545] (-551.445) * (-551.318) (-551.869) (-553.479) [-551.344] -- 0:00:58
79500 -- (-550.274) [-553.448] (-552.234) (-552.795) * [-551.367] (-554.646) (-550.120) (-550.675) -- 0:00:57
80000 -- (-550.910) (-552.343) (-553.557) [-554.649] * (-550.910) (-555.108) [-553.156] (-550.820) -- 0:00:57
Average standard deviation of split frequencies: 0.026759
80500 -- [-550.431] (-552.118) (-551.692) (-555.277) * (-550.838) (-554.065) (-551.361) [-550.652] -- 0:00:57
81000 -- (-550.734) (-552.692) [-551.993] (-552.787) * (-551.710) (-553.921) (-551.057) [-551.102] -- 0:00:56
81500 -- (-553.656) (-552.560) (-552.673) [-552.433] * [-552.689] (-555.345) (-554.166) (-552.077) -- 0:00:56
82000 -- (-552.913) [-552.235] (-555.066) (-550.331) * [-553.258] (-550.888) (-554.163) (-551.305) -- 0:00:55
82500 -- (-552.444) (-550.626) (-551.357) [-551.332] * (-553.241) (-552.282) (-551.183) [-552.606] -- 0:00:55
83000 -- (-551.014) (-550.242) [-551.313] (-554.208) * (-551.325) (-550.401) [-552.408] (-554.834) -- 0:00:55
83500 -- (-554.560) (-551.778) [-551.302] (-556.531) * [-551.330] (-552.923) (-554.453) (-552.544) -- 0:00:54
84000 -- (-555.419) [-552.140] (-551.025) (-557.114) * (-550.941) (-550.694) (-552.068) [-554.082] -- 0:00:54
84500 -- (-554.109) (-553.566) [-552.203] (-550.610) * (-550.949) (-554.372) [-551.863] (-556.351) -- 0:00:54
85000 -- (-552.564) (-556.191) (-550.242) [-552.644] * (-551.710) (-558.544) (-551.124) [-551.176] -- 0:00:53
Average standard deviation of split frequencies: 0.024536
85500 -- (-553.143) (-559.382) [-550.487] (-550.383) * (-554.189) [-550.279] (-550.738) (-550.542) -- 0:00:53
86000 -- [-552.677] (-554.603) (-550.476) (-555.769) * [-551.538] (-550.945) (-552.805) (-552.958) -- 0:00:53
86500 -- (-550.960) (-559.449) (-553.202) [-553.127] * (-552.907) (-553.613) (-554.266) [-556.474] -- 0:00:52
87000 -- (-551.694) [-552.023] (-553.262) (-551.617) * (-555.618) [-553.492] (-552.215) (-552.822) -- 0:00:52
87500 -- (-551.694) (-552.235) (-552.704) [-553.185] * (-551.226) (-549.884) (-550.969) [-552.177] -- 0:00:52
88000 -- (-557.277) [-552.907] (-552.010) (-550.074) * (-552.430) (-550.460) [-553.399] (-550.985) -- 0:00:51
88500 -- (-552.637) (-550.853) [-551.318] (-555.897) * (-551.214) (-551.661) [-551.542] (-554.046) -- 0:00:51
89000 -- [-555.858] (-553.983) (-551.121) (-555.875) * [-550.992] (-558.155) (-550.934) (-552.616) -- 0:00:51
89500 -- [-553.904] (-556.370) (-550.352) (-551.336) * (-551.293) [-554.032] (-550.707) (-553.561) -- 0:00:50
90000 -- (-556.550) [-552.100] (-551.609) (-552.082) * (-552.296) [-555.036] (-555.841) (-556.370) -- 0:00:50
Average standard deviation of split frequencies: 0.024437
90500 -- (-553.677) [-551.347] (-550.830) (-552.971) * (-552.684) (-556.447) (-551.591) [-553.569] -- 0:00:50
91000 -- (-550.426) (-551.307) (-555.917) [-554.133] * [-550.446] (-554.981) (-550.691) (-551.294) -- 0:00:59
91500 -- (-550.281) (-552.182) [-553.982] (-551.974) * [-551.840] (-551.418) (-552.515) (-552.741) -- 0:00:59
92000 -- (-549.954) (-553.864) [-554.486] (-553.079) * (-552.304) (-552.340) (-552.743) [-552.215] -- 0:00:59
92500 -- (-551.862) (-550.583) [-550.566] (-553.004) * (-551.993) (-553.036) (-557.859) [-554.222] -- 0:00:58
93000 -- [-552.604] (-552.153) (-552.091) (-552.771) * (-550.744) (-551.678) (-555.221) [-551.104] -- 0:00:58
93500 -- (-561.934) [-552.164] (-551.315) (-552.696) * (-553.737) [-550.962] (-553.075) (-550.942) -- 0:00:58
94000 -- [-553.871] (-550.401) (-553.811) (-551.988) * (-553.156) (-552.283) (-555.426) [-554.235] -- 0:00:57
94500 -- (-552.564) [-551.915] (-550.085) (-553.738) * (-551.311) (-552.418) (-552.518) [-553.690] -- 0:00:57
95000 -- (-554.423) (-553.397) [-551.363] (-551.858) * [-553.037] (-551.414) (-552.591) (-554.666) -- 0:00:57
Average standard deviation of split frequencies: 0.023325
95500 -- (-553.310) [-550.121] (-552.114) (-561.008) * (-554.173) [-552.788] (-554.671) (-552.211) -- 0:00:56
96000 -- [-553.366] (-551.872) (-551.467) (-552.532) * (-552.531) (-553.759) (-554.923) [-550.416] -- 0:00:56
96500 -- (-551.287) (-553.282) (-553.548) [-553.466] * [-550.588] (-552.649) (-553.682) (-550.881) -- 0:00:56
97000 -- (-550.616) (-557.141) (-554.552) [-552.078] * (-553.168) (-552.369) [-552.007] (-549.894) -- 0:00:55
97500 -- (-555.359) (-554.571) [-551.191] (-555.571) * [-551.834] (-551.063) (-551.257) (-553.778) -- 0:00:55
98000 -- [-550.851] (-551.058) (-553.655) (-553.305) * (-550.085) (-552.909) (-553.902) [-552.471] -- 0:00:55
98500 -- [-551.373] (-552.251) (-551.242) (-555.234) * (-553.189) (-556.095) (-552.018) [-551.236] -- 0:00:54
99000 -- (-550.928) (-550.908) (-551.297) [-552.314] * [-552.387] (-554.495) (-551.866) (-551.410) -- 0:00:54
99500 -- (-551.277) (-552.042) [-551.033] (-549.831) * (-552.849) (-553.385) (-550.556) [-553.001] -- 0:00:54
100000 -- (-553.873) (-554.034) [-553.051] (-551.647) * (-553.216) (-553.849) [-550.749] (-551.030) -- 0:00:54
Average standard deviation of split frequencies: 0.023414
100500 -- [-553.285] (-555.042) (-554.007) (-551.651) * (-552.611) (-553.516) (-550.730) [-550.671] -- 0:00:53
101000 -- (-556.054) [-551.956] (-553.440) (-552.895) * (-552.300) (-553.368) (-555.463) [-550.890] -- 0:00:53
101500 -- (-552.937) [-551.129] (-555.708) (-551.796) * (-550.598) (-553.990) (-550.949) [-551.104] -- 0:00:53
102000 -- (-552.148) (-551.244) (-554.969) [-552.238] * (-553.355) [-552.357] (-552.702) (-554.108) -- 0:00:52
102500 -- (-554.541) (-554.197) (-556.667) [-554.533] * (-551.317) (-554.667) [-551.284] (-552.117) -- 0:00:52
103000 -- (-551.995) (-556.974) [-551.807] (-552.713) * (-553.148) (-552.141) [-550.575] (-554.092) -- 0:00:52
103500 -- (-551.275) (-553.965) (-554.533) [-550.506] * (-552.532) (-552.304) [-551.766] (-554.080) -- 0:00:51
104000 -- (-551.184) [-552.465] (-553.097) (-551.132) * [-554.857] (-553.503) (-550.338) (-553.061) -- 0:00:51
104500 -- (-550.931) [-550.846] (-551.793) (-550.521) * (-559.233) (-555.656) (-550.401) [-556.839] -- 0:00:51
105000 -- (-551.574) (-550.798) [-550.844] (-552.188) * (-553.358) (-559.662) (-554.706) [-551.336] -- 0:00:51
Average standard deviation of split frequencies: 0.026260
105500 -- [-550.417] (-550.513) (-552.373) (-553.002) * [-550.671] (-556.265) (-550.883) (-550.407) -- 0:00:50
106000 -- (-551.861) (-550.931) (-559.159) [-551.695] * (-551.000) (-552.879) (-553.224) [-551.199] -- 0:00:50
106500 -- (-553.201) (-552.985) [-552.241] (-552.690) * [-552.956] (-553.216) (-551.390) (-554.208) -- 0:00:50
107000 -- (-551.476) (-552.234) [-551.389] (-552.997) * (-551.775) (-554.077) [-551.445] (-557.728) -- 0:00:50
107500 -- (-555.109) [-552.835] (-551.386) (-551.161) * [-552.214] (-553.976) (-551.300) (-558.048) -- 0:00:49
108000 -- (-551.934) (-554.324) [-551.789] (-557.336) * (-552.597) [-551.183] (-552.324) (-552.375) -- 0:00:57
108500 -- (-553.219) (-550.898) [-554.071] (-555.760) * (-553.501) [-551.890] (-551.905) (-550.627) -- 0:00:57
109000 -- (-553.521) (-552.427) [-551.186] (-550.982) * (-551.479) (-551.864) (-555.250) [-551.335] -- 0:00:57
109500 -- (-556.949) (-553.460) (-551.262) [-553.114] * (-551.692) (-551.564) (-552.533) [-551.256] -- 0:00:56
110000 -- (-553.866) (-553.708) (-552.515) [-551.819] * (-551.052) (-551.216) [-553.678] (-550.211) -- 0:00:56
Average standard deviation of split frequencies: 0.025752
110500 -- [-552.822] (-553.618) (-553.115) (-554.010) * [-550.696] (-551.733) (-552.806) (-552.156) -- 0:00:56
111000 -- (-552.448) (-551.548) (-551.375) [-552.413] * (-552.098) [-550.542] (-554.049) (-550.717) -- 0:00:56
111500 -- [-552.373] (-550.539) (-552.699) (-552.341) * (-554.599) [-551.762] (-558.423) (-551.253) -- 0:00:55
112000 -- (-552.879) (-551.123) [-551.451] (-552.367) * (-552.144) (-551.367) [-553.592] (-550.428) -- 0:00:55
112500 -- (-551.400) (-551.935) (-554.974) [-550.463] * [-551.078] (-552.120) (-555.350) (-551.358) -- 0:00:55
113000 -- (-552.538) [-551.395] (-555.880) (-553.229) * (-552.088) (-554.783) [-552.241] (-552.135) -- 0:00:54
113500 -- (-554.836) [-551.075] (-554.155) (-551.929) * [-553.356] (-554.854) (-555.991) (-551.394) -- 0:00:54
114000 -- (-553.435) (-551.256) (-553.119) [-550.350] * (-554.618) (-557.520) (-554.762) [-553.159] -- 0:00:54
114500 -- (-553.746) (-552.429) (-552.034) [-552.119] * [-550.349] (-556.782) (-551.440) (-551.914) -- 0:00:54
115000 -- (-554.425) (-550.637) (-551.991) [-552.773] * (-553.512) [-554.319] (-553.354) (-551.855) -- 0:00:53
Average standard deviation of split frequencies: 0.022672
115500 -- (-554.389) (-554.441) (-550.895) [-551.734] * (-553.106) (-553.734) (-552.426) [-551.614] -- 0:00:53
116000 -- (-551.861) [-551.926] (-551.435) (-551.237) * (-553.876) (-551.548) (-552.932) [-551.918] -- 0:00:53
116500 -- (-551.536) [-557.205] (-556.726) (-551.518) * (-553.269) (-553.990) [-551.690] (-552.252) -- 0:00:53
117000 -- (-551.234) [-558.582] (-554.514) (-552.226) * (-551.048) (-553.006) [-550.078] (-551.462) -- 0:00:52
117500 -- (-552.130) (-551.370) [-554.553] (-553.172) * [-550.367] (-553.027) (-553.333) (-552.197) -- 0:00:52
118000 -- (-553.700) (-552.054) [-551.626] (-555.358) * (-550.008) [-553.344] (-554.015) (-550.820) -- 0:00:52
118500 -- [-550.685] (-551.413) (-554.264) (-555.889) * (-550.011) (-552.274) (-554.800) [-552.493] -- 0:00:52
119000 -- (-550.563) (-550.054) [-553.650] (-555.730) * (-550.009) (-555.763) (-552.100) [-551.403] -- 0:00:51
119500 -- (-551.225) (-549.820) (-552.261) [-553.061] * (-550.463) (-554.696) (-552.427) [-551.322] -- 0:00:51
120000 -- (-553.667) (-550.300) [-551.152] (-550.243) * (-551.263) (-551.720) (-553.313) [-551.965] -- 0:00:51
Average standard deviation of split frequencies: 0.021487
120500 -- (-551.047) (-552.198) [-552.219] (-554.265) * (-552.290) (-553.053) (-551.662) [-550.327] -- 0:00:51
121000 -- (-553.019) (-551.925) (-555.966) [-551.706] * (-552.082) (-551.757) [-552.802] (-550.656) -- 0:00:50
121500 -- (-553.417) (-553.292) [-552.281] (-550.719) * (-552.362) [-553.793] (-551.965) (-552.384) -- 0:00:50
122000 -- (-550.125) (-554.783) (-551.812) [-554.043] * (-551.233) (-557.845) (-550.399) [-550.263] -- 0:00:50
122500 -- (-550.528) (-559.522) (-559.576) [-553.385] * (-550.897) [-553.769] (-551.554) (-552.153) -- 0:00:50
123000 -- [-553.104] (-559.381) (-552.616) (-552.908) * (-550.686) [-553.042] (-550.903) (-552.372) -- 0:00:49
123500 -- (-551.282) (-553.457) [-550.823] (-551.409) * [-554.090] (-556.992) (-550.533) (-556.599) -- 0:00:49
124000 -- (-551.587) [-551.206] (-550.843) (-551.678) * (-553.971) (-561.430) [-554.165] (-552.564) -- 0:00:49
124500 -- (-551.070) (-550.648) [-550.816] (-551.942) * (-553.704) (-552.972) (-551.529) [-552.592] -- 0:00:49
125000 -- (-550.746) (-553.881) [-551.427] (-551.978) * (-553.002) (-554.880) [-551.640] (-550.840) -- 0:00:49
Average standard deviation of split frequencies: 0.019691
125500 -- (-550.806) [-551.604] (-553.631) (-552.178) * (-553.881) (-553.438) [-554.182] (-550.390) -- 0:00:55
126000 -- (-550.854) [-554.182] (-553.068) (-552.800) * (-550.885) [-551.768] (-552.481) (-553.599) -- 0:00:55
126500 -- (-555.643) [-551.744] (-552.403) (-552.791) * (-550.103) [-551.987] (-551.269) (-554.135) -- 0:00:55
127000 -- (-553.449) (-554.254) (-551.651) [-552.151] * [-552.312] (-554.161) (-552.976) (-553.280) -- 0:00:54
127500 -- [-551.536] (-556.127) (-553.005) (-555.070) * (-551.664) (-552.400) (-555.375) [-550.848] -- 0:00:54
128000 -- (-553.031) [-553.057] (-551.447) (-551.803) * [-552.274] (-553.811) (-555.270) (-552.242) -- 0:00:54
128500 -- (-552.264) (-551.481) (-557.430) [-553.705] * [-552.271] (-556.237) (-553.918) (-550.987) -- 0:00:54
129000 -- (-552.970) (-554.303) (-553.898) [-551.764] * [-552.363] (-553.199) (-553.857) (-552.733) -- 0:00:54
129500 -- (-553.529) (-552.901) (-550.377) [-551.370] * (-552.532) [-552.256] (-551.218) (-550.481) -- 0:00:53
130000 -- (-553.842) (-552.743) [-552.391] (-555.995) * (-550.586) [-550.880] (-551.568) (-552.432) -- 0:00:53
Average standard deviation of split frequencies: 0.021827
130500 -- (-550.950) (-552.143) (-554.051) [-552.640] * (-551.022) [-551.538] (-550.653) (-552.966) -- 0:00:53
131000 -- [-555.446] (-550.145) (-553.169) (-552.040) * (-553.644) (-553.568) (-552.790) [-551.903] -- 0:00:53
131500 -- (-553.453) (-550.218) (-550.785) [-552.781] * (-552.230) [-550.829] (-551.669) (-551.904) -- 0:00:52
132000 -- (-552.667) [-550.640] (-558.289) (-553.717) * (-550.578) [-551.580] (-553.183) (-555.295) -- 0:00:52
132500 -- (-553.492) (-552.657) (-553.474) [-551.846] * (-553.975) (-552.419) (-556.063) [-552.661] -- 0:00:52
133000 -- (-550.566) [-552.393] (-555.657) (-550.944) * [-550.579] (-550.063) (-551.746) (-551.240) -- 0:00:52
133500 -- (-550.566) (-552.000) [-551.040] (-552.038) * (-552.712) [-551.253] (-555.409) (-551.696) -- 0:00:51
134000 -- (-551.773) (-554.509) [-550.878] (-550.876) * (-551.093) (-553.426) [-552.787] (-552.198) -- 0:00:51
134500 -- [-550.531] (-554.118) (-551.898) (-552.073) * (-552.051) (-552.508) (-550.351) [-550.353] -- 0:00:51
135000 -- (-551.878) (-554.585) (-555.849) [-551.460] * (-552.252) (-550.556) [-550.794] (-552.071) -- 0:00:51
Average standard deviation of split frequencies: 0.020068
135500 -- (-554.759) (-554.035) (-555.450) [-550.905] * [-552.729] (-550.635) (-550.921) (-552.254) -- 0:00:51
136000 -- [-550.549] (-554.780) (-557.020) (-551.947) * (-553.076) (-551.158) [-550.260] (-552.071) -- 0:00:50
136500 -- (-551.520) (-552.734) (-553.247) [-550.393] * (-553.360) [-551.170] (-551.684) (-554.639) -- 0:00:50
137000 -- [-551.031] (-555.343) (-551.808) (-552.464) * [-553.215] (-550.874) (-551.036) (-552.524) -- 0:00:50
137500 -- (-553.250) (-552.050) (-550.972) [-551.991] * [-553.257] (-551.750) (-553.969) (-557.129) -- 0:00:50
138000 -- (-554.511) (-550.826) (-551.996) [-556.259] * (-551.943) [-550.986] (-551.096) (-552.357) -- 0:00:49
138500 -- [-554.636] (-552.865) (-551.177) (-551.729) * (-553.711) [-551.724] (-551.863) (-551.011) -- 0:00:49
139000 -- (-556.595) (-551.856) [-552.067] (-552.717) * [-552.298] (-551.622) (-550.868) (-551.630) -- 0:00:49
139500 -- [-553.517] (-552.536) (-550.430) (-552.892) * (-551.803) (-552.258) [-552.630] (-552.233) -- 0:00:49
140000 -- (-553.933) (-553.884) [-550.426] (-553.202) * (-552.691) (-552.345) (-551.231) [-552.037] -- 0:00:49
Average standard deviation of split frequencies: 0.017991
140500 -- (-551.315) (-552.498) (-550.998) [-554.835] * [-552.646] (-550.559) (-551.536) (-553.133) -- 0:00:48
141000 -- (-550.152) (-552.582) [-550.661] (-554.949) * (-554.019) (-552.843) [-551.845] (-556.715) -- 0:00:48
141500 -- [-554.094] (-553.376) (-552.981) (-552.174) * (-551.530) (-554.805) (-551.724) [-550.253] -- 0:00:48
142000 -- (-556.440) (-554.069) (-555.378) [-553.375] * (-550.185) (-553.884) (-554.154) [-550.260] -- 0:00:48
142500 -- [-552.003] (-552.932) (-554.561) (-558.394) * (-550.123) (-550.635) [-552.357] (-550.474) -- 0:00:54
143000 -- (-551.146) [-556.641] (-552.790) (-552.361) * (-554.270) (-552.824) (-550.269) [-550.895] -- 0:00:53
143500 -- [-550.159] (-558.294) (-553.118) (-550.686) * (-552.909) [-553.447] (-553.958) (-551.492) -- 0:00:53
144000 -- (-550.330) [-551.889] (-554.107) (-553.131) * [-550.680] (-552.614) (-552.618) (-551.827) -- 0:00:53
144500 -- [-552.612] (-551.204) (-556.277) (-551.095) * (-551.477) (-552.379) (-552.276) [-550.361] -- 0:00:53
145000 -- (-553.186) (-551.589) [-553.497] (-552.314) * (-551.649) [-550.415] (-552.287) (-552.065) -- 0:00:53
Average standard deviation of split frequencies: 0.016314
145500 -- [-551.556] (-551.447) (-552.499) (-552.716) * (-550.482) (-551.702) [-554.495] (-552.750) -- 0:00:52
146000 -- (-551.726) [-555.098] (-553.279) (-550.903) * (-551.652) (-551.074) (-552.541) [-552.047] -- 0:00:52
146500 -- [-552.311] (-553.704) (-553.082) (-552.391) * (-550.673) [-550.949] (-555.639) (-551.403) -- 0:00:52
147000 -- (-551.501) [-553.064] (-557.591) (-550.452) * [-552.404] (-551.989) (-552.155) (-551.148) -- 0:00:52
147500 -- (-551.974) (-551.657) (-552.622) [-551.522] * (-553.931) [-552.041] (-552.746) (-551.677) -- 0:00:52
148000 -- [-552.814] (-556.400) (-556.715) (-552.811) * (-552.743) (-549.887) [-551.528] (-552.983) -- 0:00:51
148500 -- (-550.557) (-555.158) [-552.834] (-552.088) * (-551.246) (-553.774) (-554.913) [-550.803] -- 0:00:51
149000 -- (-551.030) [-550.486] (-553.177) (-556.911) * [-550.811] (-556.955) (-552.377) (-551.016) -- 0:00:51
149500 -- (-551.474) [-552.022] (-552.052) (-555.020) * [-551.903] (-552.054) (-554.632) (-551.722) -- 0:00:51
150000 -- (-553.094) (-550.465) [-553.098] (-549.974) * [-551.896] (-551.802) (-554.976) (-554.317) -- 0:00:51
Average standard deviation of split frequencies: 0.016632
150500 -- [-552.478] (-556.472) (-552.171) (-552.727) * (-553.330) [-551.416] (-554.356) (-551.901) -- 0:00:50
151000 -- (-551.665) [-556.457] (-553.157) (-552.684) * (-550.949) [-553.918] (-552.529) (-551.207) -- 0:00:50
151500 -- (-552.595) [-552.437] (-551.791) (-552.314) * [-552.233] (-553.467) (-552.256) (-551.113) -- 0:00:50
152000 -- (-551.531) (-552.766) [-552.048] (-550.248) * [-552.711] (-550.059) (-550.877) (-551.383) -- 0:00:50
152500 -- (-556.496) (-554.740) (-552.465) [-551.845] * [-555.037] (-550.231) (-555.667) (-554.415) -- 0:00:50
153000 -- (-552.719) [-553.316] (-551.854) (-550.167) * [-553.540] (-551.268) (-558.287) (-554.230) -- 0:00:49
153500 -- (-552.925) (-556.717) [-551.773] (-554.691) * (-553.102) (-551.540) (-557.885) [-551.033] -- 0:00:49
154000 -- (-551.793) (-554.575) [-551.037] (-552.471) * (-555.138) [-550.779] (-551.691) (-552.359) -- 0:00:49
154500 -- [-551.764] (-551.216) (-551.582) (-554.825) * (-554.633) [-553.162] (-552.511) (-552.612) -- 0:00:49
155000 -- (-552.016) (-552.380) [-550.291] (-555.617) * [-550.526] (-552.834) (-555.618) (-550.026) -- 0:00:49
Average standard deviation of split frequencies: 0.018449
155500 -- (-552.547) (-553.554) (-550.227) [-553.179] * (-552.665) (-552.004) (-550.633) [-555.226] -- 0:00:48
156000 -- (-551.409) [-554.560] (-559.462) (-551.544) * (-550.573) (-552.820) [-550.723] (-550.813) -- 0:00:48
156500 -- [-551.884] (-552.142) (-553.444) (-550.680) * (-551.381) (-551.386) [-550.561] (-552.704) -- 0:00:48
157000 -- [-554.899] (-554.828) (-553.284) (-550.782) * (-551.604) (-552.033) [-552.313] (-552.514) -- 0:00:48
157500 -- (-552.144) (-553.374) (-553.349) [-550.065] * (-551.370) (-551.184) [-552.338] (-555.084) -- 0:00:48
158000 -- [-555.613] (-552.672) (-551.937) (-551.060) * (-551.617) (-552.608) (-552.028) [-551.912] -- 0:00:47
158500 -- [-555.751] (-553.990) (-551.840) (-554.428) * (-552.376) (-551.955) [-553.208] (-553.317) -- 0:00:47
159000 -- [-553.200] (-553.859) (-555.590) (-556.812) * (-555.018) (-553.226) (-553.431) [-552.613] -- 0:00:47
159500 -- [-550.717] (-554.715) (-555.758) (-551.885) * (-553.684) [-552.133] (-554.416) (-551.368) -- 0:00:52
160000 -- (-551.169) (-553.326) (-553.250) [-551.141] * (-555.858) [-551.649] (-553.656) (-551.977) -- 0:00:52
Average standard deviation of split frequencies: 0.016766
160500 -- (-551.812) (-555.097) [-554.033] (-551.670) * (-555.121) (-550.467) [-550.255] (-556.667) -- 0:00:52
161000 -- (-552.497) (-553.621) (-551.974) [-552.615] * (-554.460) [-550.536] (-550.985) (-550.640) -- 0:00:52
161500 -- [-550.810] (-551.919) (-552.079) (-551.858) * (-552.725) (-553.692) (-554.434) [-550.071] -- 0:00:51
162000 -- (-552.465) (-552.825) [-552.655] (-555.289) * (-554.697) (-552.311) (-554.891) [-550.615] -- 0:00:51
162500 -- (-551.459) (-552.167) [-550.715] (-555.955) * (-550.265) (-551.105) (-555.040) [-551.245] -- 0:00:51
163000 -- (-552.513) (-552.480) [-550.302] (-551.187) * (-555.177) (-550.980) (-550.777) [-550.628] -- 0:00:51
163500 -- (-553.303) [-552.050] (-552.810) (-552.179) * (-552.739) (-552.336) (-555.105) [-550.605] -- 0:00:51
164000 -- (-553.450) [-550.279] (-551.351) (-554.864) * (-556.089) (-555.187) [-552.548] (-550.979) -- 0:00:50
164500 -- (-553.534) [-550.361] (-553.012) (-551.242) * (-553.737) (-553.922) [-552.058] (-552.271) -- 0:00:50
165000 -- (-552.891) [-551.874] (-553.140) (-550.286) * [-552.178] (-554.058) (-551.198) (-553.570) -- 0:00:50
Average standard deviation of split frequencies: 0.015551
165500 -- (-552.814) (-551.052) [-557.542] (-552.273) * [-552.589] (-555.444) (-552.361) (-553.944) -- 0:00:50
166000 -- (-552.496) (-551.623) [-550.974] (-550.614) * (-552.050) (-553.004) (-551.858) [-552.193] -- 0:00:50
166500 -- (-551.734) (-554.215) [-550.522] (-552.648) * (-550.832) [-553.582] (-552.553) (-551.341) -- 0:00:50
167000 -- [-552.558] (-551.731) (-553.949) (-552.433) * (-552.086) (-552.454) (-556.552) [-551.436] -- 0:00:49
167500 -- (-553.001) [-551.965] (-554.611) (-551.938) * (-554.367) (-554.375) (-553.115) [-550.747] -- 0:00:49
168000 -- (-551.178) (-554.523) (-553.320) [-552.373] * (-553.106) (-555.805) [-551.908] (-550.262) -- 0:00:49
168500 -- [-552.747] (-551.023) (-554.227) (-555.098) * (-555.322) [-552.068] (-552.371) (-551.475) -- 0:00:49
169000 -- (-552.280) [-551.056] (-553.600) (-555.727) * (-551.585) (-550.917) [-550.947] (-551.228) -- 0:00:49
169500 -- (-551.029) (-557.352) [-555.364] (-557.234) * (-550.239) (-555.273) [-550.377] (-558.348) -- 0:00:48
170000 -- [-550.010] (-555.234) (-553.541) (-552.050) * (-553.854) (-555.245) [-550.292] (-553.785) -- 0:00:48
Average standard deviation of split frequencies: 0.014683
170500 -- (-551.092) (-554.073) (-552.939) [-553.084] * [-553.104] (-556.960) (-552.780) (-559.418) -- 0:00:48
171000 -- (-550.038) (-551.343) (-550.650) [-553.507] * (-557.367) (-556.526) [-551.931] (-550.997) -- 0:00:48
171500 -- [-552.832] (-552.011) (-555.028) (-551.324) * (-552.261) [-554.997] (-551.038) (-552.668) -- 0:00:48
172000 -- [-550.598] (-553.220) (-554.985) (-552.110) * [-556.365] (-550.325) (-550.854) (-554.306) -- 0:00:48
172500 -- (-550.506) [-553.573] (-555.949) (-556.419) * [-556.811] (-554.897) (-550.712) (-552.196) -- 0:00:47
173000 -- (-550.571) (-553.388) (-550.860) [-552.874] * (-550.692) [-551.223] (-551.253) (-555.420) -- 0:00:47
173500 -- [-551.814] (-552.735) (-552.705) (-550.920) * (-551.607) [-551.186] (-552.936) (-553.470) -- 0:00:47
174000 -- (-552.168) (-552.894) (-552.838) [-552.207] * [-552.068] (-551.453) (-551.460) (-552.367) -- 0:00:47
174500 -- (-552.228) (-551.204) [-555.044] (-551.723) * (-551.762) (-552.943) [-552.644] (-552.662) -- 0:00:47
175000 -- (-551.029) (-550.771) [-556.459] (-554.563) * (-554.131) (-557.395) [-554.599] (-554.998) -- 0:00:47
Average standard deviation of split frequencies: 0.014330
175500 -- (-555.213) (-551.554) (-552.611) [-553.162] * [-549.882] (-551.728) (-555.518) (-552.899) -- 0:00:46
176000 -- (-555.239) (-550.543) (-552.399) [-552.474] * (-550.879) (-551.586) [-551.559] (-552.057) -- 0:00:46
176500 -- (-552.472) (-552.367) (-553.661) [-551.991] * [-551.479] (-551.810) (-552.539) (-553.265) -- 0:00:51
177000 -- [-550.669] (-554.816) (-557.876) (-551.467) * (-550.279) (-552.813) (-552.057) [-554.368] -- 0:00:51
177500 -- [-552.080] (-554.001) (-555.044) (-554.569) * (-555.007) (-551.519) (-551.063) [-551.312] -- 0:00:50
178000 -- [-553.453] (-550.671) (-551.055) (-551.649) * (-551.933) (-555.225) (-550.950) [-552.390] -- 0:00:50
178500 -- (-553.750) [-551.838] (-554.921) (-551.585) * [-550.986] (-551.206) (-551.489) (-553.984) -- 0:00:50
179000 -- (-555.877) (-552.132) (-551.891) [-551.210] * (-553.132) (-552.527) [-551.532] (-556.534) -- 0:00:50
179500 -- (-552.223) (-554.610) (-552.911) [-553.709] * (-551.507) (-550.862) [-551.978] (-552.445) -- 0:00:50
180000 -- (-555.234) (-556.294) [-552.294] (-557.606) * (-555.159) (-552.017) (-555.499) [-551.361] -- 0:00:50
Average standard deviation of split frequencies: 0.014090
180500 -- (-555.776) [-550.326] (-551.443) (-556.005) * (-550.400) [-551.999] (-556.089) (-551.661) -- 0:00:49
181000 -- (-552.369) [-557.170] (-551.737) (-555.948) * (-550.719) [-551.569] (-555.962) (-552.292) -- 0:00:49
181500 -- (-550.312) (-553.236) [-553.551] (-554.863) * (-552.198) [-552.760] (-551.626) (-553.279) -- 0:00:49
182000 -- (-550.560) [-552.689] (-555.045) (-553.558) * (-555.576) (-550.966) [-551.785] (-551.679) -- 0:00:49
182500 -- (-550.808) [-553.167] (-556.041) (-551.926) * (-552.544) [-551.503] (-552.042) (-553.812) -- 0:00:49
183000 -- [-553.018] (-553.921) (-557.099) (-552.394) * (-552.357) (-551.459) [-550.402] (-552.583) -- 0:00:49
183500 -- (-551.494) (-556.749) [-555.014] (-550.030) * (-555.564) (-550.986) (-552.146) [-551.967] -- 0:00:48
184000 -- (-551.556) (-552.643) [-555.468] (-552.240) * [-558.282] (-553.517) (-550.186) (-550.804) -- 0:00:48
184500 -- (-554.035) [-552.684] (-553.295) (-552.507) * (-550.649) [-552.731] (-551.505) (-550.992) -- 0:00:48
185000 -- (-552.674) (-555.548) (-555.325) [-551.533] * (-549.915) (-555.145) [-555.709] (-553.340) -- 0:00:48
Average standard deviation of split frequencies: 0.013306
185500 -- (-552.397) (-551.986) [-553.071] (-556.627) * (-553.208) (-552.649) [-553.418] (-551.408) -- 0:00:48
186000 -- (-555.013) [-550.753] (-552.995) (-553.003) * (-551.948) (-556.058) [-553.978] (-554.582) -- 0:00:48
186500 -- (-556.951) (-550.793) [-552.980] (-555.836) * (-552.277) (-552.848) (-553.368) [-554.596] -- 0:00:47
187000 -- (-553.847) (-552.783) (-550.770) [-551.465] * [-550.943] (-552.971) (-553.704) (-553.572) -- 0:00:47
187500 -- [-550.305] (-554.556) (-553.558) (-552.083) * (-552.637) [-551.507] (-553.565) (-551.024) -- 0:00:47
188000 -- (-553.709) (-552.308) [-553.607] (-553.330) * (-551.741) [-552.823] (-553.566) (-552.918) -- 0:00:47
188500 -- (-552.237) [-552.469] (-554.479) (-551.305) * (-551.548) (-554.617) (-551.794) [-551.382] -- 0:00:47
189000 -- [-553.572] (-552.369) (-556.663) (-551.526) * (-553.113) [-552.687] (-553.366) (-552.424) -- 0:00:47
189500 -- (-553.916) (-551.155) (-550.687) [-550.518] * (-554.364) [-552.776] (-550.490) (-555.076) -- 0:00:47
190000 -- [-555.197] (-553.256) (-552.216) (-552.621) * (-553.234) [-553.872] (-551.698) (-553.417) -- 0:00:46
Average standard deviation of split frequencies: 0.013013
190500 -- (-555.228) [-550.140] (-555.115) (-552.560) * (-554.750) (-552.316) [-551.253] (-555.580) -- 0:00:46
191000 -- [-550.575] (-552.344) (-556.120) (-552.915) * (-551.918) (-553.149) [-552.873] (-553.665) -- 0:00:46
191500 -- (-552.678) (-550.961) [-553.671] (-552.524) * (-553.194) [-551.016] (-552.664) (-551.545) -- 0:00:46
192000 -- (-552.351) [-555.716] (-551.342) (-553.312) * (-554.490) (-552.608) (-553.122) [-555.598] -- 0:00:46
192500 -- [-551.106] (-552.896) (-550.879) (-553.476) * (-550.961) [-552.384] (-555.376) (-550.982) -- 0:00:46
193000 -- [-552.342] (-553.195) (-551.854) (-550.122) * (-555.892) (-554.632) [-552.890] (-559.051) -- 0:00:45
193500 -- (-550.886) (-550.319) (-554.110) [-551.398] * (-551.377) (-551.183) [-551.159] (-551.579) -- 0:00:50
194000 -- [-551.563] (-550.976) (-553.027) (-553.776) * (-554.485) (-551.656) [-554.300] (-551.017) -- 0:00:49
194500 -- [-552.557] (-551.629) (-554.692) (-552.244) * (-552.897) (-552.499) [-553.833] (-553.620) -- 0:00:49
195000 -- [-551.873] (-550.613) (-558.629) (-551.885) * (-551.823) [-552.495] (-552.048) (-552.026) -- 0:00:49
Average standard deviation of split frequencies: 0.013589
195500 -- (-550.565) [-552.809] (-555.801) (-554.498) * (-552.249) (-552.336) (-553.114) [-551.126] -- 0:00:49
196000 -- (-552.837) (-551.488) (-554.423) [-551.473] * (-552.238) (-554.226) (-550.445) [-552.199] -- 0:00:49
196500 -- (-552.060) (-553.866) [-555.576] (-550.119) * [-550.669] (-552.884) (-552.142) (-551.848) -- 0:00:49
197000 -- (-554.366) (-551.548) [-552.963] (-552.874) * (-552.620) (-552.781) (-551.925) [-551.122] -- 0:00:48
197500 -- (-553.062) [-553.074] (-557.492) (-553.275) * (-552.615) (-555.561) (-552.841) [-550.515] -- 0:00:48
198000 -- [-551.398] (-551.903) (-554.558) (-554.493) * (-550.804) [-553.913] (-553.625) (-550.517) -- 0:00:48
198500 -- (-557.239) (-553.055) [-552.665] (-551.681) * [-550.734] (-552.597) (-553.614) (-553.094) -- 0:00:48
199000 -- (-552.893) [-550.719] (-554.803) (-550.910) * [-550.824] (-551.912) (-551.768) (-550.827) -- 0:00:48
199500 -- (-553.232) (-550.654) (-554.470) [-552.163] * (-557.639) [-553.215] (-552.874) (-551.562) -- 0:00:48
200000 -- (-555.949) [-550.615] (-553.728) (-551.366) * (-557.805) [-551.780] (-554.123) (-552.356) -- 0:00:48
Average standard deviation of split frequencies: 0.013273
200500 -- [-555.668] (-552.178) (-551.404) (-553.800) * (-551.961) (-556.684) (-551.421) [-551.715] -- 0:00:47
201000 -- (-552.385) [-550.968] (-550.805) (-551.639) * (-553.610) [-553.650] (-551.603) (-551.305) -- 0:00:47
201500 -- [-554.471] (-550.755) (-554.988) (-553.109) * (-553.564) [-556.066] (-550.930) (-550.504) -- 0:00:47
202000 -- [-553.712] (-552.218) (-550.554) (-552.725) * (-555.179) (-553.056) [-550.859] (-550.125) -- 0:00:47
202500 -- [-550.621] (-550.401) (-552.394) (-551.288) * (-552.794) (-554.431) [-550.472] (-551.761) -- 0:00:47
203000 -- (-555.063) (-553.452) [-553.891] (-552.171) * (-552.071) [-550.662] (-550.798) (-552.803) -- 0:00:47
203500 -- (-552.473) [-550.191] (-558.182) (-551.516) * (-552.061) (-551.735) (-552.292) [-550.189] -- 0:00:46
204000 -- [-551.403] (-550.612) (-556.124) (-550.916) * (-550.950) (-550.626) (-556.817) [-550.743] -- 0:00:46
204500 -- (-551.288) [-553.372] (-557.766) (-550.500) * (-551.433) (-551.240) (-552.400) [-552.088] -- 0:00:46
205000 -- [-551.551] (-560.193) (-552.021) (-551.480) * [-550.976] (-553.851) (-551.442) (-551.641) -- 0:00:46
Average standard deviation of split frequencies: 0.013489
205500 -- [-550.897] (-553.149) (-552.451) (-550.969) * [-553.408] (-554.382) (-552.248) (-552.083) -- 0:00:46
206000 -- (-551.529) (-550.888) [-550.954] (-550.632) * (-552.430) [-551.221] (-552.413) (-552.470) -- 0:00:46
206500 -- (-553.534) (-552.087) (-551.226) [-551.576] * [-553.452] (-552.939) (-554.634) (-551.508) -- 0:00:46
207000 -- (-554.488) (-550.190) [-552.481] (-551.756) * (-550.765) (-552.698) (-551.504) [-551.251] -- 0:00:45
207500 -- (-555.447) (-552.466) [-550.871] (-552.006) * (-551.517) (-553.869) [-550.209] (-551.165) -- 0:00:45
208000 -- (-555.580) (-558.311) (-552.203) [-552.730] * (-552.576) (-550.791) [-549.977] (-554.951) -- 0:00:45
208500 -- (-551.893) [-552.879] (-555.484) (-552.190) * [-552.476] (-551.490) (-550.432) (-555.256) -- 0:00:45
209000 -- [-551.978] (-554.456) (-552.147) (-553.661) * (-552.474) [-552.975] (-553.339) (-554.630) -- 0:00:45
209500 -- (-552.768) [-552.401] (-553.695) (-553.504) * (-550.994) (-552.187) (-551.693) [-551.750] -- 0:00:45
210000 -- [-555.552] (-553.476) (-553.934) (-553.130) * (-550.362) [-554.062] (-551.552) (-553.319) -- 0:00:45
Average standard deviation of split frequencies: 0.014421
210500 -- (-554.155) (-554.148) [-552.592] (-552.876) * (-552.120) (-552.873) [-551.163] (-550.897) -- 0:00:48
211000 -- (-550.625) (-553.363) [-551.068] (-554.772) * (-553.356) (-552.961) [-550.243] (-552.650) -- 0:00:48
211500 -- [-549.896] (-553.826) (-555.775) (-551.839) * (-552.256) (-551.158) (-552.605) [-555.192] -- 0:00:48
212000 -- (-550.354) (-550.828) [-552.887] (-552.108) * [-551.154] (-553.481) (-551.371) (-557.437) -- 0:00:48
212500 -- (-550.145) [-552.081] (-553.009) (-552.522) * (-555.277) [-554.167] (-551.277) (-553.622) -- 0:00:48
213000 -- (-551.590) (-551.495) [-550.920] (-556.156) * [-553.008] (-551.309) (-550.585) (-557.344) -- 0:00:48
213500 -- [-552.679] (-552.662) (-551.281) (-554.136) * [-552.778] (-551.835) (-550.697) (-551.475) -- 0:00:47
214000 -- (-552.894) (-560.145) (-551.346) [-551.007] * (-551.436) [-554.236] (-551.359) (-555.936) -- 0:00:47
214500 -- (-552.161) (-555.246) (-551.867) [-551.010] * [-550.994] (-550.491) (-552.048) (-553.868) -- 0:00:47
215000 -- [-549.900] (-551.838) (-550.627) (-552.427) * (-553.539) (-555.078) (-553.848) [-550.984] -- 0:00:47
Average standard deviation of split frequencies: 0.013943
215500 -- (-553.309) (-550.897) [-551.281] (-551.494) * [-552.376] (-552.800) (-550.867) (-553.923) -- 0:00:47
216000 -- (-554.846) (-551.839) [-550.621] (-554.426) * [-550.895] (-552.703) (-551.288) (-554.265) -- 0:00:47
216500 -- [-551.307] (-554.232) (-553.122) (-552.884) * [-553.875] (-554.858) (-550.999) (-554.800) -- 0:00:47
217000 -- (-551.957) [-551.268] (-555.544) (-553.480) * (-551.822) (-551.914) [-550.732] (-551.089) -- 0:00:46
217500 -- (-552.550) (-551.427) (-560.757) [-550.909] * [-551.142] (-552.282) (-550.374) (-551.791) -- 0:00:46
218000 -- (-551.644) (-554.956) [-554.523] (-551.829) * (-552.117) (-550.488) [-554.222] (-552.626) -- 0:00:46
218500 -- (-555.812) (-551.266) (-551.206) [-553.396] * (-554.286) (-553.775) [-551.004] (-552.868) -- 0:00:46
219000 -- (-557.563) [-551.981] (-557.626) (-551.773) * (-552.698) [-551.812] (-550.559) (-550.790) -- 0:00:46
219500 -- (-557.278) [-551.978] (-552.474) (-552.932) * [-553.965] (-551.348) (-551.648) (-551.168) -- 0:00:46
220000 -- (-556.642) (-552.980) (-553.132) [-552.822] * [-551.648] (-554.158) (-551.130) (-553.769) -- 0:00:46
Average standard deviation of split frequencies: 0.013320
220500 -- (-553.152) (-551.534) (-552.716) [-552.738] * (-553.021) (-553.589) (-551.195) [-553.875] -- 0:00:45
221000 -- (-555.743) (-551.800) (-552.499) [-553.340] * (-553.589) [-554.357] (-550.791) (-552.675) -- 0:00:45
221500 -- [-551.402] (-552.604) (-552.087) (-553.279) * [-550.487] (-552.215) (-552.778) (-550.627) -- 0:00:45
222000 -- (-551.149) [-554.919] (-554.906) (-550.686) * (-550.277) [-552.455] (-555.112) (-554.087) -- 0:00:45
222500 -- (-550.588) [-550.476] (-551.888) (-555.022) * [-555.471] (-551.497) (-551.521) (-553.080) -- 0:00:45
223000 -- (-553.258) (-552.465) [-551.142] (-552.551) * (-551.648) [-553.884] (-551.650) (-552.418) -- 0:00:45
223500 -- (-551.430) (-550.506) (-550.588) [-552.446] * [-551.330] (-553.144) (-554.541) (-553.498) -- 0:00:45
224000 -- (-555.627) [-555.521] (-555.209) (-552.656) * (-553.978) (-551.485) [-551.628] (-556.026) -- 0:00:45
224500 -- [-552.121] (-551.725) (-553.943) (-551.353) * (-552.267) [-550.718] (-553.283) (-553.502) -- 0:00:44
225000 -- [-551.019] (-550.930) (-554.319) (-552.084) * (-552.986) (-551.221) (-551.623) [-550.849] -- 0:00:44
Average standard deviation of split frequencies: 0.012399
225500 -- (-553.431) (-554.547) [-554.730] (-553.266) * (-554.795) (-552.200) (-552.637) [-552.074] -- 0:00:44
226000 -- (-551.825) (-551.890) [-552.635] (-556.295) * [-552.908] (-553.742) (-552.804) (-553.145) -- 0:00:44
226500 -- (-554.738) (-551.361) (-552.806) [-551.113] * (-551.123) (-553.435) [-551.583] (-551.741) -- 0:00:44
227000 -- (-550.067) (-551.361) (-552.141) [-551.477] * (-552.305) [-551.153] (-551.394) (-552.643) -- 0:00:44
227500 -- [-552.157] (-550.507) (-552.777) (-552.200) * (-552.445) [-550.595] (-552.579) (-553.415) -- 0:00:47
228000 -- (-551.975) (-551.921) [-551.013] (-551.182) * [-550.456] (-554.064) (-551.058) (-554.553) -- 0:00:47
228500 -- (-551.211) (-550.214) [-553.934] (-555.416) * [-550.723] (-554.054) (-551.191) (-553.289) -- 0:00:47
229000 -- (-553.587) [-550.939] (-551.383) (-554.261) * [-550.612] (-553.591) (-552.200) (-553.502) -- 0:00:47
229500 -- [-551.935] (-550.771) (-551.653) (-551.407) * (-551.667) (-553.088) (-551.825) [-550.917] -- 0:00:47
230000 -- [-550.966] (-553.096) (-554.640) (-551.705) * (-551.357) (-551.258) [-550.946] (-555.805) -- 0:00:46
Average standard deviation of split frequencies: 0.013464
230500 -- [-551.923] (-552.668) (-551.976) (-557.309) * (-557.214) (-550.953) [-553.399] (-552.277) -- 0:00:46
231000 -- [-551.934] (-552.088) (-555.403) (-554.813) * (-557.815) [-550.721] (-551.953) (-553.545) -- 0:00:46
231500 -- (-551.657) [-551.591] (-551.022) (-552.015) * (-553.357) (-550.543) [-551.577] (-550.523) -- 0:00:46
232000 -- (-553.780) [-553.486] (-551.054) (-551.577) * (-552.338) (-557.228) (-556.387) [-550.431] -- 0:00:46
232500 -- (-556.540) (-558.142) [-553.542] (-555.205) * (-551.107) [-552.475] (-551.652) (-550.187) -- 0:00:46
233000 -- (-556.647) (-556.134) [-551.291] (-552.011) * (-557.719) (-552.446) [-552.565] (-552.103) -- 0:00:46
233500 -- (-552.413) [-551.794] (-552.455) (-550.498) * (-556.700) [-551.941] (-550.848) (-554.917) -- 0:00:45
234000 -- (-553.003) (-554.329) (-553.203) [-552.838] * (-554.867) [-553.731] (-555.821) (-553.569) -- 0:00:45
234500 -- (-553.229) [-550.261] (-557.807) (-550.894) * (-552.588) (-551.826) [-552.530] (-552.349) -- 0:00:45
235000 -- (-553.854) [-551.565] (-551.734) (-552.026) * (-555.597) [-554.707] (-552.862) (-553.839) -- 0:00:45
Average standard deviation of split frequencies: 0.012220
235500 -- (-553.170) [-552.946] (-550.265) (-551.203) * [-552.445] (-555.327) (-550.168) (-553.214) -- 0:00:45
236000 -- (-551.121) (-552.038) [-550.446] (-552.566) * (-553.639) (-554.463) (-551.684) [-552.856] -- 0:00:45
236500 -- [-551.099] (-552.495) (-550.094) (-553.021) * (-552.823) [-552.039] (-550.646) (-555.289) -- 0:00:45
237000 -- (-554.764) (-555.642) (-554.464) [-552.968] * [-552.875] (-552.009) (-552.396) (-553.448) -- 0:00:45
237500 -- (-554.132) [-553.299] (-552.237) (-555.621) * (-550.437) (-558.912) (-551.214) [-551.589] -- 0:00:44
238000 -- (-554.617) (-551.515) (-555.507) [-550.335] * (-550.741) [-551.347] (-553.055) (-551.118) -- 0:00:44
238500 -- (-554.312) (-557.241) (-555.867) [-551.072] * (-552.838) [-554.213] (-550.105) (-553.831) -- 0:00:44
239000 -- [-557.343] (-550.341) (-553.443) (-553.098) * (-553.661) (-553.273) [-551.693] (-550.710) -- 0:00:44
239500 -- (-550.798) [-550.461] (-550.949) (-550.722) * [-553.257] (-551.286) (-550.408) (-555.540) -- 0:00:44
240000 -- (-553.502) (-551.541) (-556.232) [-552.529] * (-551.458) (-551.313) [-550.761] (-552.072) -- 0:00:44
Average standard deviation of split frequencies: 0.012098
240500 -- (-552.708) (-550.940) (-553.094) [-551.793] * (-555.109) (-553.119) (-552.759) [-554.840] -- 0:00:44
241000 -- [-553.604] (-552.960) (-552.961) (-550.459) * (-550.909) (-552.282) (-553.426) [-554.364] -- 0:00:44
241500 -- (-554.790) (-553.066) [-550.567] (-550.880) * [-554.698] (-558.900) (-550.976) (-552.403) -- 0:00:43
242000 -- (-554.515) (-552.056) (-551.923) [-550.837] * (-551.682) (-555.038) [-551.175] (-551.266) -- 0:00:43
242500 -- (-554.739) (-553.568) [-552.478] (-551.423) * [-550.416] (-552.622) (-551.739) (-553.555) -- 0:00:43
243000 -- (-552.752) (-552.907) [-551.972] (-550.891) * (-552.075) (-551.565) (-550.787) [-553.960] -- 0:00:43
243500 -- [-550.354] (-550.563) (-551.030) (-553.377) * (-550.635) [-550.773] (-552.024) (-556.564) -- 0:00:43
244000 -- (-550.888) (-554.499) [-552.703] (-550.375) * (-550.703) [-550.548] (-550.718) (-556.776) -- 0:00:46
244500 -- [-551.269] (-551.252) (-552.759) (-555.751) * (-551.707) (-551.827) [-550.587] (-551.093) -- 0:00:46
245000 -- (-551.032) (-555.142) [-550.987] (-551.415) * (-551.999) (-550.456) [-550.918] (-551.396) -- 0:00:46
Average standard deviation of split frequencies: 0.011610
245500 -- (-553.177) (-553.897) [-552.844] (-552.709) * (-552.750) (-552.659) (-551.770) [-551.240] -- 0:00:46
246000 -- (-550.783) (-552.301) [-552.929] (-553.061) * (-554.134) (-552.463) (-551.844) [-551.621] -- 0:00:45
246500 -- [-550.528] (-551.506) (-549.842) (-550.177) * [-552.866] (-550.760) (-554.544) (-552.011) -- 0:00:45
247000 -- (-551.231) (-552.206) (-550.072) [-554.071] * [-551.012] (-551.579) (-551.460) (-554.512) -- 0:00:45
247500 -- (-558.198) (-554.091) [-552.573] (-553.467) * (-552.124) (-551.824) (-551.505) [-552.363] -- 0:00:45
248000 -- [-552.743] (-550.654) (-550.717) (-550.927) * (-554.651) (-552.762) (-551.224) [-553.398] -- 0:00:45
248500 -- (-552.646) (-551.073) [-550.246] (-550.954) * (-563.043) [-552.108] (-552.423) (-550.255) -- 0:00:45
249000 -- (-550.939) (-550.468) [-550.365] (-551.434) * (-558.388) [-550.435] (-552.408) (-552.729) -- 0:00:45
249500 -- (-555.415) (-553.549) (-553.851) [-552.513] * [-551.224] (-553.963) (-552.148) (-551.848) -- 0:00:45
250000 -- (-552.504) [-553.310] (-555.163) (-552.878) * (-551.898) (-550.623) (-551.417) [-550.287] -- 0:00:45
Average standard deviation of split frequencies: 0.011394
250500 -- (-553.030) [-551.474] (-550.159) (-550.407) * (-550.283) [-550.204] (-550.261) (-552.276) -- 0:00:44
251000 -- (-551.859) [-551.965] (-552.296) (-550.557) * (-554.501) [-550.795] (-551.663) (-551.805) -- 0:00:44
251500 -- (-552.027) [-554.467] (-550.054) (-551.055) * (-554.117) (-554.778) (-549.975) [-550.212] -- 0:00:44
252000 -- (-554.123) [-552.017] (-551.255) (-552.717) * (-552.994) [-552.946] (-550.315) (-550.242) -- 0:00:44
252500 -- (-556.303) (-552.016) (-550.605) [-551.898] * (-552.201) (-552.077) [-550.083] (-550.740) -- 0:00:44
253000 -- (-550.866) (-551.574) (-552.452) [-551.788] * [-551.594] (-550.805) (-553.384) (-551.626) -- 0:00:44
253500 -- (-551.403) [-552.180] (-555.412) (-551.937) * (-552.751) (-550.845) (-552.409) [-551.415] -- 0:00:44
254000 -- [-551.509] (-551.447) (-550.763) (-551.256) * (-551.012) [-553.916] (-552.418) (-551.177) -- 0:00:44
254500 -- (-551.725) [-551.451] (-555.107) (-551.014) * (-551.146) (-551.861) [-554.051] (-554.932) -- 0:00:43
255000 -- (-551.356) [-551.974] (-551.193) (-553.316) * (-550.782) [-553.864] (-559.681) (-551.558) -- 0:00:43
Average standard deviation of split frequencies: 0.012240
255500 -- (-552.393) (-552.016) (-550.775) [-552.379] * (-551.290) (-551.680) (-552.422) [-550.799] -- 0:00:43
256000 -- (-554.053) (-551.938) (-551.261) [-550.934] * [-550.482] (-552.163) (-554.427) (-552.995) -- 0:00:43
256500 -- (-552.239) [-552.921] (-553.305) (-552.473) * (-553.573) (-555.062) (-556.812) [-551.324] -- 0:00:43
257000 -- [-551.891] (-550.938) (-551.149) (-555.926) * (-552.212) (-555.662) [-550.982] (-554.151) -- 0:00:43
257500 -- [-553.086] (-551.361) (-552.066) (-555.214) * (-552.486) [-555.956] (-551.516) (-550.728) -- 0:00:43
258000 -- [-551.077] (-550.529) (-550.878) (-556.732) * (-550.748) (-552.987) (-552.162) [-552.272] -- 0:00:43
258500 -- (-550.807) (-551.604) (-551.518) [-553.523] * (-552.935) [-552.888] (-551.735) (-551.218) -- 0:00:43
259000 -- (-553.264) (-550.855) (-551.350) [-552.554] * (-553.369) [-556.091] (-556.695) (-554.898) -- 0:00:42
259500 -- (-555.591) [-550.481] (-550.907) (-551.277) * [-552.647] (-555.631) (-556.042) (-556.076) -- 0:00:42
260000 -- (-552.342) (-550.734) [-551.710] (-552.489) * (-552.515) [-553.097] (-551.332) (-552.401) -- 0:00:42
Average standard deviation of split frequencies: 0.012127
260500 -- (-554.242) [-552.817] (-554.684) (-553.231) * (-553.566) [-551.226] (-554.785) (-550.955) -- 0:00:42
261000 -- (-555.915) (-552.389) (-551.651) [-552.363] * [-552.694] (-552.820) (-553.780) (-553.358) -- 0:00:45
261500 -- (-552.123) [-551.905] (-551.108) (-555.740) * (-551.512) (-551.520) [-550.374] (-552.414) -- 0:00:45
262000 -- (-553.121) (-552.044) [-551.356] (-550.928) * (-551.853) (-555.411) [-556.270] (-554.953) -- 0:00:45
262500 -- (-552.001) (-552.561) (-550.908) [-552.275] * (-551.859) [-554.407] (-553.610) (-553.349) -- 0:00:44
263000 -- (-552.176) (-551.839) [-551.768] (-551.642) * (-550.638) [-551.777] (-554.915) (-552.836) -- 0:00:44
263500 -- (-550.369) (-551.868) (-550.719) [-552.114] * [-550.759] (-554.908) (-550.887) (-551.782) -- 0:00:44
264000 -- (-554.240) [-552.817] (-551.236) (-554.571) * (-553.022) (-555.029) [-552.627] (-553.317) -- 0:00:44
264500 -- (-553.032) (-553.006) (-550.657) [-556.787] * (-553.112) (-553.682) (-551.962) [-556.543] -- 0:00:44
265000 -- (-554.094) (-550.800) [-553.514] (-552.287) * (-551.225) [-551.667] (-550.473) (-556.310) -- 0:00:44
Average standard deviation of split frequencies: 0.011363
265500 -- (-551.580) (-553.656) [-551.816] (-554.309) * (-553.452) [-551.974] (-551.496) (-555.465) -- 0:00:44
266000 -- (-551.457) (-552.286) [-551.964] (-554.089) * (-553.950) [-552.584] (-550.954) (-552.077) -- 0:00:44
266500 -- [-559.090] (-551.771) (-555.106) (-550.717) * (-555.215) (-553.221) (-555.525) [-550.169] -- 0:00:44
267000 -- (-552.287) (-550.475) (-553.424) [-550.215] * (-551.367) (-551.771) (-551.244) [-550.861] -- 0:00:43
267500 -- (-551.000) (-551.544) [-550.135] (-550.344) * (-551.246) [-552.321] (-553.314) (-551.949) -- 0:00:43
268000 -- [-553.253] (-553.617) (-552.094) (-550.440) * (-550.525) (-556.179) [-550.223] (-552.102) -- 0:00:43
268500 -- (-554.456) [-552.721] (-554.623) (-558.242) * [-551.709] (-553.696) (-552.494) (-553.624) -- 0:00:43
269000 -- (-553.442) (-553.505) (-557.231) [-552.510] * (-551.841) (-552.806) [-553.068] (-551.323) -- 0:00:43
269500 -- (-550.244) [-555.784] (-554.311) (-551.185) * (-554.158) (-551.287) [-551.037] (-551.851) -- 0:00:43
270000 -- (-550.268) (-550.554) [-551.060] (-554.393) * (-551.358) [-554.677] (-550.978) (-553.744) -- 0:00:43
Average standard deviation of split frequencies: 0.011065
270500 -- (-550.869) (-550.927) [-554.213] (-551.110) * [-555.144] (-550.669) (-552.052) (-552.101) -- 0:00:43
271000 -- (-550.351) [-551.140] (-551.212) (-553.271) * (-551.134) (-551.932) [-550.594] (-550.923) -- 0:00:43
271500 -- (-550.680) (-553.793) [-552.747] (-550.893) * [-551.250] (-550.933) (-551.017) (-550.923) -- 0:00:42
272000 -- (-550.912) [-552.550] (-552.248) (-551.243) * (-553.387) [-553.692] (-551.089) (-551.446) -- 0:00:42
272500 -- (-552.868) [-553.648] (-550.497) (-550.424) * (-560.400) (-552.363) [-553.449] (-550.261) -- 0:00:42
273000 -- (-550.259) [-552.078] (-551.180) (-551.346) * (-552.490) (-555.004) (-552.889) [-550.256] -- 0:00:42
273500 -- (-552.171) (-552.521) [-554.492] (-551.007) * (-551.866) (-552.932) [-552.457] (-551.194) -- 0:00:42
274000 -- [-551.181] (-551.788) (-553.980) (-551.496) * (-551.809) [-551.009] (-551.713) (-551.734) -- 0:00:42
274500 -- [-551.021] (-550.944) (-553.062) (-552.641) * [-551.768] (-551.077) (-553.312) (-550.402) -- 0:00:42
275000 -- (-551.225) (-550.567) [-555.448] (-553.237) * (-556.009) [-551.558] (-550.857) (-553.586) -- 0:00:42
Average standard deviation of split frequencies: 0.010650
275500 -- (-551.419) (-552.135) [-558.274] (-552.774) * (-552.150) [-552.471] (-551.561) (-551.944) -- 0:00:42
276000 -- (-552.617) (-553.178) (-554.023) [-553.723] * (-551.788) (-550.548) [-550.706] (-555.039) -- 0:00:41
276500 -- (-550.990) [-551.181] (-552.830) (-551.268) * (-550.452) (-551.763) (-549.943) [-553.637] -- 0:00:41
277000 -- (-552.578) (-552.168) [-551.772] (-554.512) * [-552.048] (-550.197) (-553.285) (-552.106) -- 0:00:41
277500 -- (-554.719) (-552.236) (-550.448) [-552.129] * [-550.703] (-551.215) (-553.482) (-550.920) -- 0:00:44
278000 -- [-551.075] (-550.345) (-552.240) (-551.452) * [-552.344] (-551.491) (-550.043) (-550.527) -- 0:00:44
278500 -- [-551.381] (-551.375) (-552.376) (-551.479) * (-556.661) (-550.307) [-551.574] (-554.778) -- 0:00:44
279000 -- (-554.008) [-551.067] (-552.334) (-551.259) * [-550.955] (-552.445) (-552.906) (-550.154) -- 0:00:43
279500 -- [-558.260] (-550.063) (-551.923) (-552.807) * (-554.306) (-551.534) [-551.738] (-550.825) -- 0:00:43
280000 -- (-559.545) [-550.674] (-553.148) (-554.742) * (-555.094) [-551.028] (-550.928) (-551.646) -- 0:00:43
Average standard deviation of split frequencies: 0.010967
280500 -- (-552.426) (-551.955) [-552.962] (-553.238) * (-551.950) (-555.045) (-550.280) [-550.827] -- 0:00:43
281000 -- (-550.585) (-554.238) (-550.092) [-552.254] * [-551.551] (-554.939) (-551.831) (-552.238) -- 0:00:43
281500 -- (-551.142) [-551.745] (-551.386) (-556.514) * (-550.723) [-550.380] (-553.930) (-553.721) -- 0:00:43
282000 -- [-555.390] (-550.621) (-552.537) (-552.983) * [-553.903] (-554.168) (-556.334) (-554.758) -- 0:00:43
282500 -- [-551.313] (-553.668) (-550.828) (-559.725) * (-550.597) (-553.126) [-556.033] (-552.071) -- 0:00:43
283000 -- [-551.103] (-552.646) (-552.012) (-553.713) * (-551.327) (-551.732) [-552.020] (-550.658) -- 0:00:43
283500 -- (-550.709) [-552.202] (-553.222) (-551.798) * [-551.968] (-550.771) (-552.379) (-553.487) -- 0:00:42
284000 -- [-551.184] (-554.836) (-554.944) (-553.025) * (-553.114) (-556.253) [-552.656] (-554.091) -- 0:00:42
284500 -- (-552.421) [-551.540] (-552.163) (-553.968) * (-554.006) (-560.852) [-553.430] (-552.753) -- 0:00:42
285000 -- [-553.473] (-552.932) (-551.525) (-553.720) * (-555.330) [-551.493] (-552.977) (-551.303) -- 0:00:42
Average standard deviation of split frequencies: 0.010256
285500 -- (-553.269) (-553.878) [-550.917] (-551.511) * (-553.232) [-551.183] (-553.115) (-552.315) -- 0:00:42
286000 -- (-551.644) (-552.035) (-553.221) [-550.908] * (-551.190) [-553.346] (-553.392) (-552.823) -- 0:00:42
286500 -- (-552.730) [-551.555] (-553.109) (-551.725) * (-549.955) (-552.228) (-551.004) [-550.247] -- 0:00:42
287000 -- (-552.843) [-551.941] (-556.117) (-557.194) * (-550.755) (-550.879) [-554.611] (-549.934) -- 0:00:42
287500 -- [-555.245] (-553.518) (-554.014) (-554.827) * (-554.829) (-552.212) [-551.805] (-550.595) -- 0:00:42
288000 -- (-550.384) (-553.352) (-551.440) [-550.987] * (-552.627) (-554.688) [-551.559] (-550.469) -- 0:00:42
288500 -- (-551.574) (-554.268) (-551.059) [-550.320] * (-551.579) (-553.155) [-553.309] (-553.334) -- 0:00:41
289000 -- [-551.534] (-554.101) (-552.542) (-552.122) * (-551.764) (-551.440) [-551.171] (-550.371) -- 0:00:41
289500 -- (-552.411) [-551.546] (-550.493) (-553.624) * (-553.860) (-553.656) [-551.462] (-550.554) -- 0:00:41
290000 -- [-550.591] (-553.211) (-554.254) (-554.818) * [-551.766] (-550.022) (-553.528) (-550.550) -- 0:00:41
Average standard deviation of split frequencies: 0.009540
290500 -- (-552.632) (-553.702) [-552.119] (-552.193) * (-551.749) [-550.652] (-554.882) (-550.911) -- 0:00:41
291000 -- (-555.311) [-554.325] (-551.185) (-551.276) * (-553.309) [-551.756] (-552.948) (-551.853) -- 0:00:41
291500 -- (-552.191) [-551.548] (-550.703) (-552.925) * (-552.890) [-551.256] (-552.635) (-553.598) -- 0:00:41
292000 -- (-554.079) (-550.602) (-553.784) [-552.073] * (-553.489) (-551.689) (-551.085) [-551.436] -- 0:00:41
292500 -- [-553.265] (-554.859) (-553.292) (-551.745) * (-551.263) (-552.728) [-551.030] (-552.584) -- 0:00:41
293000 -- (-554.245) (-554.654) [-552.105] (-551.491) * [-552.791] (-552.934) (-551.943) (-551.956) -- 0:00:41
293500 -- (-550.539) [-554.760] (-552.996) (-551.669) * (-559.183) (-550.467) (-553.408) [-552.240] -- 0:00:40
294000 -- [-552.804] (-550.817) (-550.855) (-550.556) * (-552.352) [-551.337] (-553.849) (-552.742) -- 0:00:40
294500 -- (-551.050) (-552.947) (-557.910) [-552.665] * (-551.326) (-551.337) [-550.389] (-554.976) -- 0:00:43
295000 -- (-551.674) (-552.838) [-552.382] (-553.450) * [-550.310] (-553.820) (-551.667) (-553.660) -- 0:00:43
Average standard deviation of split frequencies: 0.008712
295500 -- (-552.684) (-552.603) [-550.800] (-555.237) * (-554.672) [-553.476] (-555.623) (-551.851) -- 0:00:42
296000 -- (-552.980) [-552.049] (-552.108) (-553.640) * (-555.652) (-551.583) [-553.023] (-555.240) -- 0:00:42
296500 -- (-552.376) (-552.781) [-550.534] (-553.750) * (-552.727) (-553.475) (-550.881) [-550.847] -- 0:00:42
297000 -- (-551.752) (-555.720) (-552.113) [-550.294] * [-552.448] (-552.038) (-552.149) (-552.163) -- 0:00:42
297500 -- (-552.652) (-555.035) [-552.402] (-555.305) * (-553.072) (-551.385) (-552.675) [-551.961] -- 0:00:42
298000 -- (-551.241) (-552.399) [-552.688] (-550.210) * (-553.557) (-550.275) [-551.734] (-551.775) -- 0:00:42
298500 -- (-557.827) (-552.288) (-551.869) [-552.182] * (-553.360) (-551.808) [-552.283] (-550.534) -- 0:00:42
299000 -- (-552.143) (-551.692) (-550.795) [-552.398] * (-552.787) (-550.244) (-550.810) [-550.595] -- 0:00:42
299500 -- (-550.544) [-553.186] (-550.936) (-551.924) * [-552.122] (-552.464) (-553.278) (-551.789) -- 0:00:42
300000 -- (-550.480) (-555.025) [-550.221] (-553.902) * (-555.802) (-551.605) [-552.591] (-552.210) -- 0:00:42
Average standard deviation of split frequencies: 0.008485
300500 -- (-552.848) (-552.039) (-552.025) [-553.083] * (-553.368) (-550.681) [-551.022] (-553.297) -- 0:00:41
301000 -- (-552.060) (-553.325) [-550.534] (-551.006) * (-554.627) (-551.801) [-553.617] (-554.168) -- 0:00:41
301500 -- (-555.245) [-550.978] (-552.971) (-553.380) * (-552.317) [-550.590] (-554.033) (-553.748) -- 0:00:41
302000 -- (-551.688) (-551.287) (-553.276) [-554.971] * (-552.468) (-552.849) [-552.822] (-552.798) -- 0:00:41
302500 -- (-552.076) [-550.650] (-555.448) (-551.358) * (-551.027) [-553.317] (-551.468) (-551.352) -- 0:00:41
303000 -- (-554.097) [-553.744] (-552.455) (-554.493) * (-553.574) [-552.516] (-554.010) (-552.599) -- 0:00:41
303500 -- (-553.864) (-550.777) [-550.333] (-551.086) * (-551.465) (-552.633) (-550.785) [-553.487] -- 0:00:41
304000 -- (-555.194) [-550.897] (-550.235) (-553.193) * [-553.152] (-550.765) (-555.476) (-556.102) -- 0:00:41
304500 -- (-556.360) (-552.408) [-551.119] (-552.901) * (-555.754) (-550.403) [-549.988] (-552.826) -- 0:00:41
305000 -- [-549.936] (-551.863) (-552.154) (-553.919) * [-556.592] (-550.693) (-553.029) (-558.641) -- 0:00:41
Average standard deviation of split frequencies: 0.007068
305500 -- (-550.862) [-551.492] (-552.058) (-554.810) * (-551.471) [-550.545] (-554.498) (-554.838) -- 0:00:40
306000 -- (-551.922) (-554.300) [-553.210] (-551.497) * [-551.052] (-554.291) (-554.572) (-550.696) -- 0:00:40
306500 -- (-550.485) (-553.650) (-551.034) [-552.224] * (-554.040) (-552.783) (-555.201) [-551.975] -- 0:00:40
307000 -- (-551.749) (-553.361) [-552.672] (-552.354) * (-552.556) (-552.754) (-552.837) [-550.476] -- 0:00:40
307500 -- (-555.220) (-552.209) [-551.814] (-552.326) * (-551.000) (-550.176) [-551.920] (-552.219) -- 0:00:40
308000 -- (-551.793) [-552.490] (-554.290) (-551.856) * (-554.037) [-555.455] (-552.915) (-552.473) -- 0:00:40
308500 -- (-550.856) (-553.332) [-552.177] (-552.484) * (-556.857) (-553.866) (-551.510) [-553.345] -- 0:00:40
309000 -- (-552.245) [-552.255] (-551.437) (-550.122) * (-551.968) (-551.206) (-551.469) [-551.723] -- 0:00:40
309500 -- (-554.936) (-555.447) (-551.191) [-551.132] * (-552.430) (-555.501) (-553.379) [-553.396] -- 0:00:40
310000 -- [-553.092] (-554.657) (-552.148) (-550.752) * (-550.870) (-552.824) [-552.076] (-555.001) -- 0:00:40
Average standard deviation of split frequencies: 0.006427
310500 -- (-551.895) (-552.175) (-552.896) [-553.723] * [-551.769] (-551.311) (-553.350) (-550.624) -- 0:00:42
311000 -- (-553.344) (-554.418) (-552.073) [-551.308] * [-550.457] (-551.623) (-556.765) (-553.118) -- 0:00:42
311500 -- (-551.880) (-556.224) [-553.468] (-552.492) * [-551.732] (-551.338) (-553.232) (-551.311) -- 0:00:41
312000 -- (-551.894) (-551.089) (-553.882) [-554.347] * [-552.720] (-552.543) (-551.613) (-550.225) -- 0:00:41
312500 -- (-554.509) (-552.423) [-556.021] (-552.473) * [-552.051] (-552.487) (-551.725) (-552.423) -- 0:00:41
313000 -- (-552.021) (-553.401) (-551.699) [-552.370] * (-551.204) [-553.979] (-552.479) (-554.195) -- 0:00:41
313500 -- (-553.377) (-552.582) [-551.123] (-551.164) * (-552.319) (-554.225) [-551.655] (-555.609) -- 0:00:41
314000 -- (-552.274) (-552.258) [-550.478] (-555.559) * (-555.942) (-554.234) (-553.550) [-553.438] -- 0:00:41
314500 -- (-551.764) (-552.528) (-553.744) [-552.304] * (-553.986) [-554.331] (-550.692) (-550.385) -- 0:00:41
315000 -- (-551.871) [-553.346] (-555.062) (-553.976) * (-552.404) (-552.540) (-561.250) [-551.821] -- 0:00:41
Average standard deviation of split frequencies: 0.006620
315500 -- (-551.859) (-557.097) (-552.466) [-551.031] * [-551.648] (-551.992) (-552.806) (-553.566) -- 0:00:41
316000 -- [-550.495] (-555.194) (-555.603) (-550.447) * (-551.887) (-551.397) [-554.808] (-550.532) -- 0:00:41
316500 -- (-555.795) (-554.508) [-551.442] (-550.540) * [-552.264] (-552.623) (-551.538) (-551.419) -- 0:00:41
317000 -- [-553.031] (-550.059) (-550.142) (-553.795) * (-553.501) (-553.758) (-555.441) [-552.099] -- 0:00:40
317500 -- (-555.928) (-552.872) (-550.241) [-551.944] * (-553.196) (-552.846) [-552.180] (-550.230) -- 0:00:40
318000 -- (-552.815) (-551.832) [-550.514] (-550.992) * (-552.010) (-552.928) [-550.749] (-551.922) -- 0:00:40
318500 -- [-552.825] (-551.723) (-550.308) (-551.841) * [-553.269] (-557.022) (-550.202) (-552.264) -- 0:00:40
319000 -- (-550.465) [-551.452] (-549.977) (-557.972) * (-550.989) (-551.111) (-552.607) [-552.043] -- 0:00:40
319500 -- (-552.536) (-554.008) (-551.171) [-552.946] * [-551.905] (-550.306) (-551.222) (-551.209) -- 0:00:40
320000 -- (-552.451) (-553.412) [-552.727] (-554.311) * (-550.760) (-552.660) [-551.616] (-550.774) -- 0:00:40
Average standard deviation of split frequencies: 0.006659
320500 -- (-555.231) [-552.527] (-554.094) (-550.713) * (-550.442) (-552.614) (-551.974) [-552.554] -- 0:00:40
321000 -- (-554.474) [-553.217] (-554.880) (-553.639) * (-552.194) [-550.889] (-552.242) (-554.591) -- 0:00:40
321500 -- (-555.804) [-552.572] (-551.151) (-553.969) * (-551.245) [-549.991] (-553.895) (-553.107) -- 0:00:40
322000 -- [-554.857] (-554.635) (-551.610) (-551.291) * (-552.624) (-553.192) [-552.117] (-551.383) -- 0:00:40
322500 -- (-552.943) (-551.963) [-550.379] (-552.188) * [-551.101] (-554.022) (-552.674) (-553.859) -- 0:00:39
323000 -- (-550.499) (-550.888) (-553.400) [-551.409] * (-552.370) (-551.734) (-552.899) [-554.687] -- 0:00:39
323500 -- (-550.388) [-551.985] (-554.369) (-551.213) * (-553.399) (-550.438) [-551.239] (-552.168) -- 0:00:39
324000 -- (-552.271) [-550.830] (-553.452) (-551.533) * (-554.540) [-552.220] (-551.216) (-550.216) -- 0:00:39
324500 -- (-559.287) (-552.808) [-550.988] (-550.586) * (-553.706) [-551.378] (-551.433) (-550.413) -- 0:00:39
325000 -- [-551.604] (-554.102) (-551.227) (-551.889) * (-551.710) (-551.135) [-557.726] (-556.276) -- 0:00:39
Average standard deviation of split frequencies: 0.006805
325500 -- (-552.295) [-551.051] (-550.904) (-553.745) * [-553.250] (-551.949) (-554.591) (-553.817) -- 0:00:39
326000 -- (-555.245) [-551.028] (-551.186) (-551.709) * (-554.023) (-552.147) (-555.124) [-552.984] -- 0:00:39
326500 -- (-551.134) (-552.164) (-554.756) [-550.790] * (-550.382) (-551.278) (-552.211) [-552.429] -- 0:00:39
327000 -- [-551.085] (-552.869) (-558.964) (-551.372) * (-550.311) [-550.924] (-551.939) (-552.081) -- 0:00:39
327500 -- (-558.264) (-554.535) (-551.635) [-550.149] * [-550.496] (-551.449) (-552.317) (-549.997) -- 0:00:41
328000 -- (-556.629) (-551.479) [-550.383] (-553.298) * (-555.917) (-551.650) (-553.521) [-552.705] -- 0:00:40
328500 -- [-553.943] (-553.210) (-551.998) (-551.313) * [-555.971] (-550.239) (-554.486) (-550.644) -- 0:00:40
329000 -- [-553.767] (-552.439) (-550.044) (-549.936) * (-552.749) [-551.938] (-550.398) (-550.727) -- 0:00:40
329500 -- (-552.702) (-553.038) [-550.714] (-551.156) * (-552.571) (-552.534) (-550.283) [-552.339] -- 0:00:40
330000 -- (-552.709) (-556.242) [-550.371] (-552.606) * [-551.283] (-553.788) (-550.274) (-556.012) -- 0:00:40
Average standard deviation of split frequencies: 0.006457
330500 -- (-552.286) (-551.290) (-552.809) [-551.435] * (-552.313) (-554.957) (-550.644) [-555.557] -- 0:00:40
331000 -- [-554.485] (-552.586) (-550.527) (-550.489) * (-553.775) (-551.206) [-551.550] (-554.008) -- 0:00:40
331500 -- (-552.940) (-551.327) [-550.449] (-552.889) * (-552.099) (-552.583) [-552.943] (-552.480) -- 0:00:40
332000 -- [-552.477] (-553.798) (-551.913) (-551.901) * [-550.547] (-551.414) (-550.868) (-553.262) -- 0:00:40
332500 -- (-553.801) [-552.983] (-552.929) (-553.188) * (-550.950) (-557.104) [-553.259] (-552.485) -- 0:00:40
333000 -- [-551.925] (-557.304) (-551.908) (-551.824) * (-558.314) (-556.388) [-551.641] (-553.545) -- 0:00:40
333500 -- (-552.028) [-551.386] (-554.928) (-551.938) * (-553.272) (-553.474) (-554.416) [-551.232] -- 0:00:39
334000 -- [-550.646] (-552.342) (-554.152) (-552.823) * (-552.761) (-549.956) (-555.302) [-551.968] -- 0:00:39
334500 -- (-550.852) [-551.064] (-555.168) (-553.682) * (-550.743) (-550.198) [-550.480] (-550.736) -- 0:00:39
335000 -- [-554.950] (-551.191) (-553.891) (-552.036) * [-551.766] (-551.894) (-550.487) (-551.900) -- 0:00:39
Average standard deviation of split frequencies: 0.006355
335500 -- [-550.803] (-552.548) (-553.530) (-552.595) * (-552.229) (-554.345) [-551.249] (-553.328) -- 0:00:39
336000 -- [-550.794] (-553.896) (-550.699) (-556.290) * [-551.850] (-554.519) (-552.285) (-554.464) -- 0:00:39
336500 -- (-551.230) (-551.126) [-557.284] (-552.252) * (-551.193) [-552.007] (-553.795) (-554.187) -- 0:00:39
337000 -- [-550.495] (-552.125) (-553.134) (-551.145) * (-550.735) [-551.427] (-554.399) (-556.401) -- 0:00:39
337500 -- [-550.890] (-551.859) (-555.521) (-551.922) * (-550.320) (-551.576) [-553.002] (-555.083) -- 0:00:39
338000 -- (-555.242) (-554.592) (-553.781) [-551.099] * [-550.499] (-553.971) (-550.736) (-555.804) -- 0:00:39
338500 -- (-553.929) (-553.874) (-554.650) [-550.677] * (-552.807) (-553.685) [-550.741] (-557.936) -- 0:00:39
339000 -- (-555.575) (-551.477) (-550.521) [-554.240] * (-552.262) (-553.932) (-552.926) [-552.834] -- 0:00:38
339500 -- [-553.047] (-551.596) (-556.646) (-554.204) * (-555.884) (-551.412) (-557.639) [-551.973] -- 0:00:38
340000 -- [-551.136] (-550.906) (-553.803) (-550.793) * (-553.059) [-553.137] (-553.547) (-553.404) -- 0:00:38
Average standard deviation of split frequencies: 0.007082
340500 -- [-552.474] (-555.077) (-556.041) (-551.808) * (-552.987) [-552.647] (-552.749) (-551.759) -- 0:00:38
341000 -- [-552.169] (-552.380) (-552.020) (-555.247) * (-553.772) [-550.947] (-550.832) (-554.845) -- 0:00:38
341500 -- (-554.159) [-551.464] (-552.640) (-551.858) * (-550.578) (-550.603) (-551.231) [-552.778] -- 0:00:38
342000 -- (-551.489) (-552.559) [-551.681] (-551.510) * (-552.332) (-556.069) (-550.814) [-552.338] -- 0:00:38
342500 -- (-551.092) [-551.710] (-556.249) (-553.268) * (-551.931) [-552.314] (-552.679) (-552.443) -- 0:00:38
343000 -- (-558.470) (-554.907) [-552.233] (-554.392) * (-555.205) [-552.247] (-552.320) (-553.291) -- 0:00:38
343500 -- (-550.650) (-553.093) [-554.759] (-554.066) * (-550.844) (-551.990) (-555.627) [-550.074] -- 0:00:38
344000 -- (-551.254) (-551.287) [-553.661] (-550.167) * [-550.487] (-555.141) (-551.736) (-551.188) -- 0:00:40
344500 -- (-551.720) [-552.125] (-551.541) (-552.960) * (-551.139) [-552.677] (-551.638) (-551.465) -- 0:00:39
345000 -- (-552.900) (-552.498) [-550.835] (-555.195) * [-553.128] (-550.736) (-550.488) (-557.387) -- 0:00:39
Average standard deviation of split frequencies: 0.007533
345500 -- [-555.525] (-551.297) (-552.262) (-550.986) * [-550.563] (-553.699) (-550.708) (-555.446) -- 0:00:39
346000 -- (-551.430) (-555.573) (-551.516) [-558.312] * [-552.185] (-551.794) (-551.766) (-551.471) -- 0:00:39
346500 -- (-550.308) (-553.027) [-551.239] (-550.908) * (-553.779) (-554.293) (-550.965) [-550.669] -- 0:00:39
347000 -- (-556.708) (-564.329) [-550.122] (-550.526) * (-551.774) (-556.521) (-556.652) [-554.469] -- 0:00:39
347500 -- (-552.303) [-551.157] (-550.656) (-551.416) * [-550.971] (-554.398) (-551.572) (-551.497) -- 0:00:39
348000 -- [-554.195] (-551.056) (-551.968) (-552.486) * (-550.775) (-559.320) (-553.052) [-551.054] -- 0:00:39
348500 -- (-554.895) [-553.612] (-551.872) (-550.427) * (-550.813) (-551.929) [-550.363] (-550.900) -- 0:00:39
349000 -- (-551.636) (-556.368) (-551.980) [-551.102] * (-550.337) (-554.763) [-552.027] (-554.761) -- 0:00:39
349500 -- (-551.401) (-550.512) [-553.852] (-554.679) * (-558.996) (-552.309) [-552.708] (-552.385) -- 0:00:39
350000 -- (-550.382) (-556.790) (-554.746) [-553.554] * [-551.585] (-552.033) (-554.922) (-557.931) -- 0:00:39
Average standard deviation of split frequencies: 0.007829
350500 -- (-553.414) (-552.211) (-551.345) [-552.004] * (-552.055) (-555.795) (-554.037) [-552.790] -- 0:00:38
351000 -- [-554.905] (-551.090) (-550.490) (-551.446) * (-553.787) (-553.167) (-552.605) [-552.346] -- 0:00:38
351500 -- (-555.751) (-550.853) [-550.618] (-550.946) * (-550.433) (-553.708) (-552.437) [-551.413] -- 0:00:38
352000 -- [-550.611] (-550.667) (-550.596) (-551.282) * (-552.628) (-554.753) (-551.531) [-552.147] -- 0:00:38
352500 -- [-550.821] (-550.151) (-551.549) (-550.443) * [-551.481] (-556.206) (-552.919) (-556.968) -- 0:00:38
353000 -- (-552.805) (-551.984) (-553.270) [-552.431] * (-550.856) [-553.441] (-553.863) (-551.174) -- 0:00:38
353500 -- (-553.909) (-551.593) (-551.649) [-553.482] * [-552.049] (-552.265) (-553.492) (-554.031) -- 0:00:38
354000 -- (-551.851) (-551.454) [-551.719] (-550.497) * (-552.150) [-551.571] (-553.368) (-554.061) -- 0:00:38
354500 -- (-552.819) (-551.678) (-551.467) [-551.424] * (-550.810) (-551.593) (-556.943) [-551.598] -- 0:00:38
355000 -- (-550.015) (-551.511) [-551.554] (-551.718) * [-552.526] (-555.269) (-552.432) (-551.423) -- 0:00:38
Average standard deviation of split frequencies: 0.007789
355500 -- (-554.862) [-552.633] (-555.256) (-554.326) * (-552.627) (-551.852) (-551.436) [-551.607] -- 0:00:38
356000 -- [-550.621] (-550.324) (-553.985) (-553.086) * [-550.278] (-552.910) (-551.160) (-551.495) -- 0:00:37
356500 -- (-552.406) (-552.078) (-551.326) [-551.438] * (-551.849) [-551.157] (-551.508) (-551.942) -- 0:00:37
357000 -- (-550.935) (-553.184) (-551.214) [-551.909] * [-550.678] (-550.036) (-553.189) (-551.411) -- 0:00:37
357500 -- (-554.073) (-556.235) (-553.994) [-551.164] * (-552.713) [-553.456] (-552.129) (-556.056) -- 0:00:37
358000 -- (-553.939) (-556.540) [-554.595] (-551.110) * (-551.132) (-551.370) [-551.031] (-553.380) -- 0:00:37
358500 -- (-552.655) [-555.110] (-557.667) (-551.722) * (-551.798) (-552.545) [-552.643] (-552.751) -- 0:00:37
359000 -- (-550.887) (-555.526) [-553.645] (-552.715) * (-560.182) (-555.255) (-552.738) [-553.920] -- 0:00:37
359500 -- (-552.057) [-552.904] (-552.197) (-552.832) * (-551.986) [-552.322] (-553.425) (-552.536) -- 0:00:37
360000 -- (-551.828) [-551.071] (-552.889) (-551.730) * (-554.944) [-555.126] (-551.571) (-558.048) -- 0:00:37
Average standard deviation of split frequencies: 0.008765
360500 -- (-550.669) (-553.898) (-554.576) [-551.931] * (-553.218) (-552.590) [-550.199] (-551.590) -- 0:00:37
361000 -- (-550.332) [-551.183] (-555.723) (-550.943) * (-551.230) (-552.809) [-552.641] (-551.039) -- 0:00:38
361500 -- (-551.761) [-551.329] (-555.259) (-554.618) * (-550.994) (-553.337) [-551.791] (-552.535) -- 0:00:38
362000 -- (-556.735) (-551.098) [-552.737] (-553.673) * [-552.523] (-551.183) (-550.435) (-550.760) -- 0:00:38
362500 -- (-551.342) (-552.244) [-555.715] (-553.147) * [-556.860] (-555.248) (-551.223) (-553.699) -- 0:00:38
363000 -- (-550.481) [-549.980] (-557.117) (-553.263) * (-559.460) (-552.067) [-551.676] (-553.727) -- 0:00:38
363500 -- (-550.211) (-552.331) [-552.532] (-551.408) * (-560.780) (-551.222) [-551.759] (-553.888) -- 0:00:38
364000 -- [-550.998] (-552.077) (-552.326) (-551.415) * (-553.625) [-550.892] (-556.071) (-551.208) -- 0:00:38
364500 -- [-550.692] (-554.112) (-551.993) (-552.164) * (-554.857) (-552.977) (-557.547) [-551.704] -- 0:00:38
365000 -- (-551.002) (-552.905) (-555.974) [-551.750] * (-551.105) (-552.449) [-550.792] (-552.499) -- 0:00:38
Average standard deviation of split frequencies: 0.008658
365500 -- (-552.117) [-555.414] (-554.597) (-555.690) * [-551.509] (-551.409) (-550.467) (-554.893) -- 0:00:38
366000 -- [-552.089] (-550.654) (-554.038) (-560.046) * (-551.214) [-550.660] (-550.503) (-553.750) -- 0:00:38
366500 -- [-551.190] (-550.486) (-550.897) (-553.065) * (-551.163) (-550.493) (-552.898) [-551.940] -- 0:00:38
367000 -- (-552.662) (-555.920) [-553.699] (-555.701) * (-550.803) (-554.360) (-550.536) [-552.707] -- 0:00:37
367500 -- (-553.596) (-556.333) (-559.730) [-553.081] * (-550.343) (-554.696) [-550.630] (-554.747) -- 0:00:37
368000 -- (-550.326) [-554.286] (-552.029) (-552.237) * (-550.555) (-554.692) [-551.070] (-554.340) -- 0:00:37
368500 -- (-552.078) (-557.788) [-552.508] (-554.963) * (-550.150) (-552.113) [-550.691] (-551.910) -- 0:00:37
369000 -- [-552.146] (-553.338) (-550.983) (-551.399) * (-551.464) (-551.696) [-551.741] (-554.682) -- 0:00:37
369500 -- [-552.916] (-553.129) (-552.330) (-553.199) * (-551.244) [-552.533] (-553.458) (-552.863) -- 0:00:37
370000 -- (-553.296) (-553.796) (-550.787) [-550.325] * [-551.776] (-552.131) (-553.750) (-552.321) -- 0:00:37
Average standard deviation of split frequencies: 0.008154
370500 -- (-550.880) (-553.461) [-552.736] (-553.006) * [-552.975] (-550.556) (-553.074) (-553.391) -- 0:00:37
371000 -- (-550.746) (-555.954) [-553.616] (-552.943) * (-550.595) (-550.542) (-550.592) [-551.775] -- 0:00:37
371500 -- (-552.357) (-553.112) (-550.954) [-553.466] * (-553.746) (-551.225) [-552.018] (-553.177) -- 0:00:37
372000 -- (-551.140) [-550.050] (-550.753) (-554.647) * (-552.766) (-551.110) [-551.329] (-556.162) -- 0:00:37
372500 -- [-554.170] (-552.238) (-562.368) (-553.152) * (-552.414) [-551.933] (-552.313) (-553.192) -- 0:00:37
373000 -- (-558.397) (-551.365) [-551.744] (-552.196) * [-552.404] (-551.503) (-551.712) (-552.673) -- 0:00:36
373500 -- (-552.007) (-551.380) (-550.594) [-553.675] * [-552.178] (-552.431) (-551.593) (-554.402) -- 0:00:36
374000 -- (-552.109) [-552.735] (-551.190) (-558.157) * [-550.710] (-554.771) (-554.011) (-552.609) -- 0:00:36
374500 -- (-554.391) (-552.666) [-552.191] (-557.170) * (-551.379) (-552.124) (-555.406) [-550.923] -- 0:00:36
375000 -- (-551.174) (-553.252) (-553.696) [-552.070] * (-550.602) [-551.299] (-552.721) (-550.595) -- 0:00:36
Average standard deviation of split frequencies: 0.008149
375500 -- (-552.156) (-552.779) (-559.256) [-551.474] * (-550.843) (-551.673) [-554.336] (-553.428) -- 0:00:36
376000 -- [-551.561] (-551.523) (-550.474) (-551.796) * (-551.251) (-554.687) (-552.569) [-553.287] -- 0:00:36
376500 -- (-552.395) (-550.845) (-553.987) [-550.851] * (-552.701) (-555.601) (-552.009) [-554.563] -- 0:00:36
377000 -- [-550.890] (-552.252) (-551.237) (-553.101) * (-552.881) [-553.807] (-553.315) (-552.229) -- 0:00:36
377500 -- (-554.100) [-550.980] (-553.819) (-553.066) * (-551.291) [-551.167] (-559.760) (-551.844) -- 0:00:37
378000 -- (-552.952) (-552.551) (-554.276) [-554.643] * (-560.281) [-552.235] (-554.223) (-553.152) -- 0:00:37
378500 -- (-555.121) (-551.412) (-555.238) [-551.472] * (-550.557) [-551.344] (-553.442) (-552.379) -- 0:00:37
379000 -- (-552.815) (-556.792) (-554.728) [-554.422] * (-550.708) [-551.352] (-553.863) (-551.472) -- 0:00:37
379500 -- [-552.525] (-558.188) (-553.438) (-552.982) * (-551.967) (-551.370) [-556.914] (-552.636) -- 0:00:37
380000 -- (-552.296) [-552.523] (-550.685) (-550.712) * (-554.230) [-551.213] (-553.315) (-558.036) -- 0:00:37
Average standard deviation of split frequencies: 0.009033
380500 -- (-552.666) (-551.461) [-551.139] (-554.499) * [-553.431] (-551.932) (-552.681) (-551.643) -- 0:00:37
381000 -- [-556.743] (-552.315) (-556.360) (-553.234) * (-552.635) (-552.022) [-553.271] (-552.662) -- 0:00:37
381500 -- (-558.560) (-550.779) [-552.294] (-551.365) * [-551.410] (-553.451) (-550.682) (-552.609) -- 0:00:37
382000 -- (-551.510) (-552.971) (-550.692) [-552.819] * (-550.545) [-550.499] (-556.961) (-553.073) -- 0:00:37
382500 -- (-550.946) (-552.357) (-560.448) [-552.791] * (-551.947) (-552.116) [-550.463] (-553.569) -- 0:00:37
383000 -- (-551.472) [-554.963] (-554.053) (-553.282) * (-551.422) (-552.136) (-555.859) [-551.051] -- 0:00:37
383500 -- (-552.334) (-552.257) [-550.688] (-553.292) * (-554.792) (-551.571) (-552.419) [-550.947] -- 0:00:36
384000 -- (-553.402) (-551.416) [-551.796] (-555.144) * (-551.067) (-551.966) (-551.124) [-552.987] -- 0:00:36
384500 -- [-553.952] (-550.901) (-550.793) (-552.232) * [-552.393] (-551.036) (-552.986) (-554.473) -- 0:00:36
385000 -- (-551.024) (-551.061) [-555.349] (-552.572) * [-550.715] (-551.567) (-552.605) (-550.904) -- 0:00:36
Average standard deviation of split frequencies: 0.008621
385500 -- [-551.704] (-552.437) (-552.470) (-556.642) * (-558.245) (-550.276) [-550.963] (-550.792) -- 0:00:36
386000 -- (-552.816) (-553.762) [-554.073] (-552.636) * (-553.059) (-551.722) [-552.101] (-551.602) -- 0:00:36
386500 -- (-550.798) (-554.535) (-556.597) [-551.097] * [-551.028] (-553.501) (-553.960) (-551.789) -- 0:00:36
387000 -- (-552.227) (-561.547) (-553.938) [-552.790] * (-553.169) (-552.011) (-552.846) [-551.898] -- 0:00:36
387500 -- [-551.706] (-556.643) (-555.359) (-550.051) * (-552.479) [-552.537] (-557.347) (-550.281) -- 0:00:36
388000 -- (-553.050) (-556.334) [-553.191] (-552.282) * [-552.536] (-551.909) (-552.315) (-551.523) -- 0:00:36
388500 -- (-553.822) (-554.348) [-550.333] (-551.656) * (-551.546) [-552.209] (-550.576) (-553.764) -- 0:00:36
389000 -- (-553.570) [-553.440] (-551.988) (-555.003) * (-551.213) (-551.124) (-551.276) [-552.129] -- 0:00:36
389500 -- (-552.865) (-551.682) [-552.457] (-553.248) * (-551.854) [-550.960] (-551.861) (-552.128) -- 0:00:36
390000 -- (-553.539) (-554.726) [-551.663] (-550.749) * [-554.415] (-552.597) (-553.055) (-553.003) -- 0:00:35
Average standard deviation of split frequencies: 0.007453
390500 -- (-555.000) (-554.151) [-553.605] (-551.179) * [-554.269] (-555.550) (-551.673) (-551.232) -- 0:00:35
391000 -- (-551.853) (-556.134) [-551.024] (-554.413) * (-555.016) (-554.909) [-552.009] (-551.187) -- 0:00:35
391500 -- (-552.456) (-552.975) (-558.028) [-552.065] * (-554.252) [-551.710] (-550.794) (-553.427) -- 0:00:35
392000 -- (-555.436) (-550.288) (-556.643) [-554.121] * (-552.828) (-558.477) (-551.455) [-552.871] -- 0:00:35
392500 -- (-553.190) [-551.341] (-553.540) (-551.745) * (-551.484) [-550.594] (-551.763) (-550.816) -- 0:00:35
393000 -- (-550.937) (-551.937) (-551.633) [-551.367] * [-550.662] (-558.847) (-551.671) (-550.402) -- 0:00:35
393500 -- (-551.929) (-553.947) (-554.851) [-550.774] * (-551.156) (-551.716) [-551.223] (-550.932) -- 0:00:35
394000 -- [-552.503] (-551.038) (-552.750) (-552.566) * (-551.054) [-554.645] (-552.591) (-553.003) -- 0:00:35
394500 -- [-550.882] (-553.647) (-553.427) (-552.776) * (-551.188) [-551.922] (-556.117) (-552.619) -- 0:00:36
395000 -- (-551.137) (-555.336) (-551.178) [-554.791] * (-552.779) [-550.329] (-554.930) (-551.791) -- 0:00:36
Average standard deviation of split frequencies: 0.007493
395500 -- (-553.571) (-551.464) (-554.227) [-551.493] * [-550.530] (-552.499) (-553.457) (-552.398) -- 0:00:36
396000 -- (-552.508) (-555.467) (-555.392) [-551.330] * (-552.328) (-555.333) [-550.243] (-552.483) -- 0:00:36
396500 -- (-551.109) (-554.393) [-556.766] (-550.672) * (-553.635) (-557.502) (-550.215) [-552.156] -- 0:00:36
397000 -- [-550.652] (-551.909) (-550.977) (-552.202) * (-552.457) (-552.324) [-550.818] (-551.673) -- 0:00:36
397500 -- (-550.307) [-554.746] (-551.689) (-552.258) * [-552.325] (-551.860) (-552.357) (-551.389) -- 0:00:36
398000 -- (-551.779) (-552.666) [-551.254] (-555.289) * (-550.514) (-550.348) (-553.255) [-551.798] -- 0:00:36
398500 -- (-553.301) (-550.478) [-550.809] (-556.446) * [-551.700] (-550.461) (-553.726) (-551.644) -- 0:00:36
399000 -- [-553.356] (-551.426) (-551.072) (-550.576) * (-554.345) (-551.805) [-553.999] (-551.842) -- 0:00:36
399500 -- [-555.070] (-552.405) (-555.080) (-550.554) * (-553.536) (-557.968) (-554.989) [-552.710] -- 0:00:36
400000 -- [-552.208] (-553.528) (-551.888) (-550.359) * (-551.292) [-553.480] (-555.883) (-552.602) -- 0:00:36
Average standard deviation of split frequencies: 0.007890
400500 -- (-551.802) (-553.734) [-550.892] (-552.431) * (-550.936) (-551.196) (-553.456) [-550.833] -- 0:00:35
401000 -- (-550.719) (-551.216) (-553.179) [-550.501] * (-550.842) [-551.572] (-554.067) (-552.089) -- 0:00:35
401500 -- [-551.604] (-551.362) (-550.590) (-550.646) * (-551.960) (-551.038) [-553.183] (-552.299) -- 0:00:35
402000 -- [-551.549] (-553.715) (-550.853) (-552.599) * (-551.957) (-552.162) (-551.349) [-550.838] -- 0:00:35
402500 -- [-550.934] (-553.560) (-552.832) (-553.254) * (-551.280) (-552.522) [-552.230] (-551.254) -- 0:00:35
403000 -- (-551.396) (-553.789) [-551.519] (-550.531) * (-553.926) (-552.331) [-551.714] (-554.417) -- 0:00:35
403500 -- (-553.140) [-554.813] (-551.216) (-550.603) * [-552.243] (-556.629) (-551.946) (-550.689) -- 0:00:35
404000 -- [-551.911] (-553.188) (-552.104) (-550.603) * (-553.632) (-555.114) (-553.923) [-550.386] -- 0:00:35
404500 -- (-551.962) (-552.153) (-553.827) [-550.376] * (-556.049) (-555.566) [-552.835] (-552.098) -- 0:00:35
405000 -- [-550.616] (-550.457) (-552.359) (-551.306) * (-551.404) (-551.201) (-555.320) [-551.697] -- 0:00:35
Average standard deviation of split frequencies: 0.008773
405500 -- [-550.845] (-551.065) (-559.261) (-551.249) * (-554.441) (-551.788) (-553.305) [-552.718] -- 0:00:35
406000 -- (-551.705) [-552.451] (-551.793) (-549.994) * (-553.887) [-553.468] (-552.071) (-551.552) -- 0:00:35
406500 -- (-555.800) (-550.771) (-552.140) [-551.424] * (-550.370) [-552.343] (-550.434) (-550.185) -- 0:00:35
407000 -- (-551.090) (-552.921) [-552.107] (-556.913) * (-551.518) [-552.595] (-551.348) (-552.285) -- 0:00:34
407500 -- (-551.206) (-552.168) [-551.390] (-550.803) * (-552.120) (-552.073) [-551.395] (-550.879) -- 0:00:34
408000 -- [-551.787] (-551.944) (-551.591) (-551.408) * [-559.037] (-554.678) (-553.987) (-550.677) -- 0:00:34
408500 -- (-550.741) (-551.123) (-553.241) [-551.561] * (-553.489) (-555.082) [-556.855] (-554.111) -- 0:00:34
409000 -- (-553.251) (-553.248) [-555.341] (-551.785) * [-552.535] (-552.768) (-552.432) (-554.648) -- 0:00:34
409500 -- (-551.838) [-551.801] (-551.523) (-550.930) * (-551.107) (-554.404) [-553.461] (-550.947) -- 0:00:34
410000 -- (-552.758) (-553.757) (-553.841) [-550.754] * (-552.741) (-551.743) [-551.740] (-551.478) -- 0:00:34
Average standard deviation of split frequencies: 0.009056
410500 -- (-551.454) [-552.099] (-551.039) (-552.344) * [-553.035] (-551.968) (-553.761) (-550.586) -- 0:00:34
411000 -- (-552.208) [-550.395] (-552.618) (-553.217) * (-556.353) [-552.074] (-553.686) (-551.093) -- 0:00:35
411500 -- (-551.844) (-553.763) [-550.829] (-551.864) * [-551.407] (-550.728) (-554.548) (-552.452) -- 0:00:35
412000 -- (-553.019) (-553.496) [-552.049] (-551.824) * (-552.251) (-551.852) (-554.361) [-551.926] -- 0:00:35
412500 -- (-551.295) (-554.796) [-555.179] (-553.220) * [-553.617] (-554.017) (-554.654) (-553.601) -- 0:00:35
413000 -- (-550.571) [-550.509] (-554.733) (-553.002) * (-551.856) (-553.995) [-554.005] (-551.513) -- 0:00:35
413500 -- [-551.877] (-551.442) (-554.089) (-551.958) * [-551.405] (-551.290) (-549.861) (-551.860) -- 0:00:35
414000 -- (-551.571) [-554.349] (-552.081) (-555.694) * (-553.712) (-552.650) [-549.991] (-558.140) -- 0:00:35
414500 -- (-552.206) (-551.086) (-553.497) [-552.339] * [-552.129] (-551.632) (-551.227) (-551.286) -- 0:00:35
415000 -- [-551.827] (-551.344) (-553.859) (-551.154) * (-551.909) (-553.532) (-550.746) [-551.256] -- 0:00:35
Average standard deviation of split frequencies: 0.009254
415500 -- [-551.500] (-550.362) (-550.815) (-552.272) * (-550.345) (-551.631) (-550.521) [-550.963] -- 0:00:35
416000 -- [-553.625] (-551.200) (-550.040) (-555.439) * (-552.603) (-551.182) [-551.581] (-552.298) -- 0:00:35
416500 -- (-556.054) (-552.584) [-550.750] (-553.292) * [-551.368] (-553.605) (-553.760) (-550.948) -- 0:00:35
417000 -- (-552.966) [-555.402] (-552.181) (-553.950) * (-551.414) (-558.003) (-553.657) [-551.186] -- 0:00:34
417500 -- [-552.919] (-551.446) (-551.923) (-553.486) * (-551.045) (-553.119) (-558.088) [-551.386] -- 0:00:34
418000 -- [-553.889] (-553.841) (-552.475) (-552.424) * [-551.869] (-553.770) (-551.143) (-557.465) -- 0:00:34
418500 -- (-552.167) (-551.454) [-554.273] (-552.500) * (-552.411) (-554.263) (-550.936) [-550.769] -- 0:00:34
419000 -- (-557.182) (-551.857) (-550.976) [-550.875] * (-554.263) (-559.384) (-552.768) [-551.109] -- 0:00:34
419500 -- [-553.241] (-551.369) (-550.399) (-550.519) * (-552.518) (-555.368) (-556.807) [-551.077] -- 0:00:34
420000 -- (-554.017) [-552.961] (-551.200) (-552.152) * (-552.619) (-551.762) (-554.896) [-551.530] -- 0:00:34
Average standard deviation of split frequencies: 0.008903
420500 -- (-554.787) (-551.971) [-556.459] (-552.980) * (-553.434) [-551.330] (-551.768) (-555.764) -- 0:00:34
421000 -- (-550.599) (-551.422) (-554.800) [-551.721] * (-551.546) [-550.408] (-551.644) (-553.068) -- 0:00:34
421500 -- [-554.223] (-556.474) (-554.497) (-550.816) * (-551.207) (-552.287) (-552.974) [-553.282] -- 0:00:34
422000 -- [-553.907] (-550.932) (-557.780) (-550.397) * [-552.487] (-552.473) (-554.944) (-552.487) -- 0:00:34
422500 -- (-550.397) (-551.475) [-554.697] (-553.983) * (-552.520) [-550.809] (-553.193) (-558.860) -- 0:00:34
423000 -- (-552.500) (-550.434) (-551.196) [-551.283] * [-551.843] (-558.965) (-555.313) (-551.866) -- 0:00:34
423500 -- (-551.454) (-551.797) [-554.001] (-549.947) * (-551.516) (-556.834) (-555.940) [-553.556] -- 0:00:34
424000 -- (-554.567) (-553.116) (-552.448) [-550.937] * (-551.486) (-553.772) (-550.670) [-550.638] -- 0:00:33
424500 -- [-551.673] (-552.002) (-551.116) (-551.415) * (-553.046) (-550.762) (-552.005) [-552.527] -- 0:00:33
425000 -- (-551.250) (-550.443) [-552.085] (-554.529) * (-551.456) (-552.023) (-560.144) [-551.134] -- 0:00:33
Average standard deviation of split frequencies: 0.009283
425500 -- (-550.389) [-552.575] (-551.659) (-555.761) * (-557.320) (-550.091) (-551.330) [-551.132] -- 0:00:33
426000 -- (-551.200) (-554.459) (-551.139) [-551.523] * (-556.893) (-550.242) [-552.653] (-552.962) -- 0:00:33
426500 -- (-550.360) (-550.248) (-553.772) [-551.318] * (-554.987) (-550.248) (-552.145) [-551.264] -- 0:00:33
427000 -- [-552.141] (-551.957) (-553.126) (-552.465) * (-552.017) (-552.139) [-553.192] (-553.538) -- 0:00:33
427500 -- (-551.130) [-550.690] (-552.011) (-550.620) * (-552.686) (-552.200) [-558.017] (-556.285) -- 0:00:34
428000 -- (-549.993) (-553.762) (-552.308) [-551.980] * (-553.896) (-550.597) [-550.639] (-552.674) -- 0:00:34
428500 -- [-551.292] (-551.601) (-552.269) (-556.055) * (-551.305) (-551.898) (-552.002) [-550.851] -- 0:00:34
429000 -- (-551.916) [-556.214] (-550.496) (-555.364) * [-550.708] (-552.303) (-550.910) (-552.154) -- 0:00:34
429500 -- (-551.948) (-551.864) (-551.497) [-553.401] * [-551.251] (-550.976) (-550.442) (-552.418) -- 0:00:34
430000 -- (-553.806) (-556.643) (-553.663) [-551.856] * (-553.940) (-550.976) (-549.995) [-552.115] -- 0:00:34
Average standard deviation of split frequencies: 0.008757
430500 -- (-551.268) (-555.554) [-554.071] (-551.749) * (-555.055) (-552.544) [-552.941] (-551.784) -- 0:00:34
431000 -- [-551.672] (-552.779) (-552.260) (-550.712) * (-551.133) (-555.725) [-551.760] (-553.163) -- 0:00:34
431500 -- [-551.872] (-552.715) (-553.237) (-554.698) * (-551.975) [-551.826] (-551.790) (-554.774) -- 0:00:34
432000 -- (-554.933) [-552.518] (-552.322) (-551.579) * [-550.937] (-553.540) (-551.176) (-551.267) -- 0:00:34
432500 -- [-551.478] (-553.200) (-550.736) (-550.709) * (-554.012) (-551.684) (-550.174) [-549.996] -- 0:00:34
433000 -- (-552.657) (-554.302) [-550.852] (-552.359) * [-551.302] (-550.430) (-551.125) (-550.551) -- 0:00:34
433500 -- (-553.762) (-554.756) [-551.752] (-551.384) * [-550.689] (-551.145) (-552.758) (-551.653) -- 0:00:33
434000 -- (-554.128) [-550.350] (-551.876) (-553.756) * (-555.714) (-550.616) (-554.455) [-551.140] -- 0:00:33
434500 -- (-554.290) (-551.227) (-550.983) [-556.999] * (-551.474) (-551.586) [-550.551] (-553.905) -- 0:00:33
435000 -- (-555.986) [-551.824] (-552.670) (-552.488) * (-551.475) (-551.618) (-551.723) [-552.737] -- 0:00:33
Average standard deviation of split frequencies: 0.008763
435500 -- [-552.554] (-550.625) (-552.777) (-554.693) * [-552.198] (-552.984) (-551.069) (-556.107) -- 0:00:33
436000 -- [-552.876] (-553.284) (-551.110) (-555.066) * (-550.360) (-552.351) (-551.029) [-551.368] -- 0:00:33
436500 -- (-553.847) [-551.224] (-551.306) (-559.297) * (-550.054) (-552.819) (-551.593) [-550.859] -- 0:00:33
437000 -- (-551.443) (-556.443) [-550.782] (-553.822) * (-553.519) (-554.587) (-553.025) [-555.018] -- 0:00:33
437500 -- [-551.921] (-552.675) (-551.099) (-552.006) * (-552.428) [-551.564] (-550.842) (-554.728) -- 0:00:33
438000 -- [-552.363] (-553.383) (-551.377) (-553.848) * (-553.416) (-551.919) (-553.921) [-552.985] -- 0:00:33
438500 -- (-553.771) (-554.318) (-550.774) [-551.958] * (-552.868) (-551.406) [-553.743] (-551.565) -- 0:00:33
439000 -- (-551.775) (-556.550) [-552.397] (-551.563) * [-552.603] (-552.135) (-552.960) (-551.123) -- 0:00:33
439500 -- [-551.865] (-552.730) (-550.885) (-554.773) * [-551.607] (-552.479) (-552.169) (-553.404) -- 0:00:33
440000 -- [-553.978] (-553.702) (-551.416) (-554.954) * [-550.782] (-553.568) (-554.544) (-557.239) -- 0:00:33
Average standard deviation of split frequencies: 0.008840
440500 -- (-551.698) (-556.237) (-551.446) [-550.260] * (-550.692) [-556.174] (-551.956) (-551.348) -- 0:00:33
441000 -- (-554.362) (-552.154) [-551.292] (-551.179) * [-550.346] (-550.735) (-552.967) (-554.455) -- 0:00:32
441500 -- (-557.235) (-554.087) (-552.572) [-554.281] * (-552.896) (-551.521) [-550.033] (-552.324) -- 0:00:32
442000 -- [-551.250] (-553.647) (-552.350) (-552.312) * [-551.450] (-551.302) (-552.041) (-551.793) -- 0:00:32
442500 -- (-551.915) (-551.908) [-553.361] (-552.120) * (-553.601) (-556.510) [-550.712] (-552.289) -- 0:00:32
443000 -- (-552.114) (-553.123) [-551.828] (-551.012) * (-552.986) (-554.278) [-551.176] (-551.478) -- 0:00:32
443500 -- (-552.438) (-552.041) (-553.771) [-551.230] * (-551.791) [-553.995] (-551.275) (-552.254) -- 0:00:32
444000 -- (-553.264) [-551.951] (-551.809) (-554.708) * (-553.883) (-553.290) [-553.302] (-552.421) -- 0:00:32
444500 -- (-553.699) (-552.312) [-551.764] (-550.620) * (-551.084) [-550.524] (-551.177) (-552.825) -- 0:00:33
445000 -- (-553.172) (-552.463) [-552.752] (-551.103) * (-553.400) [-551.132] (-552.320) (-551.023) -- 0:00:33
Average standard deviation of split frequencies: 0.008734
445500 -- [-550.711] (-551.377) (-551.644) (-550.868) * (-552.565) (-551.378) (-556.722) [-551.772] -- 0:00:33
446000 -- [-551.658] (-552.296) (-552.959) (-551.011) * (-552.596) (-555.903) [-552.290] (-551.627) -- 0:00:33
446500 -- (-552.082) (-553.260) [-552.019] (-551.036) * (-558.452) (-556.116) [-551.203] (-553.489) -- 0:00:33
447000 -- [-554.129] (-551.248) (-550.999) (-552.922) * (-555.854) (-554.774) (-550.951) [-550.887] -- 0:00:33
447500 -- [-552.024] (-551.296) (-550.747) (-551.019) * [-551.673] (-553.232) (-552.825) (-552.489) -- 0:00:33
448000 -- (-550.871) (-550.522) (-553.271) [-550.708] * (-552.516) (-551.859) [-550.427] (-557.292) -- 0:00:33
448500 -- (-550.996) (-550.207) (-551.651) [-550.723] * (-551.939) (-550.848) (-556.710) [-552.132] -- 0:00:33
449000 -- (-552.043) [-550.904] (-551.713) (-552.451) * (-551.456) [-552.123] (-555.649) (-552.146) -- 0:00:33
449500 -- (-552.722) [-550.917] (-552.445) (-552.452) * (-554.449) (-551.837) (-554.077) [-554.313] -- 0:00:33
450000 -- (-554.538) (-552.793) (-554.335) [-551.239] * (-552.601) (-552.784) (-552.433) [-553.475] -- 0:00:33
Average standard deviation of split frequencies: 0.008891
450500 -- (-551.538) [-550.713] (-550.429) (-556.663) * (-551.293) [-550.532] (-550.757) (-554.214) -- 0:00:32
451000 -- (-552.932) (-551.683) (-551.961) [-552.478] * (-551.680) [-550.225] (-550.403) (-555.518) -- 0:00:32
451500 -- [-552.527] (-555.824) (-551.712) (-551.533) * [-554.578] (-554.243) (-550.586) (-552.143) -- 0:00:32
452000 -- (-553.279) (-553.650) (-551.760) [-552.940] * [-556.511] (-550.430) (-552.371) (-551.586) -- 0:00:32
452500 -- (-556.939) (-555.579) [-550.722] (-553.215) * (-563.717) (-550.158) [-551.516] (-553.385) -- 0:00:32
453000 -- (-553.118) (-554.061) (-550.547) [-553.319] * [-552.365] (-555.778) (-552.566) (-552.564) -- 0:00:32
453500 -- (-551.758) (-551.574) (-551.535) [-553.559] * (-552.847) [-553.834] (-551.176) (-553.431) -- 0:00:32
454000 -- (-553.676) [-553.671] (-549.932) (-551.769) * (-551.033) (-551.353) (-553.202) [-551.670] -- 0:00:32
454500 -- [-552.020] (-555.050) (-551.072) (-553.118) * (-551.930) (-554.524) (-554.027) [-553.818] -- 0:00:32
455000 -- (-550.581) [-552.516] (-550.907) (-551.183) * (-551.984) [-552.764] (-551.377) (-553.556) -- 0:00:32
Average standard deviation of split frequencies: 0.009132
455500 -- (-555.665) (-552.376) [-553.147] (-554.244) * (-550.767) [-550.462] (-552.239) (-549.826) -- 0:00:32
456000 -- (-552.074) [-551.436] (-552.147) (-555.571) * (-553.323) [-550.607] (-551.869) (-552.095) -- 0:00:32
456500 -- (-553.112) [-550.484] (-551.615) (-553.123) * (-555.550) (-551.247) (-552.336) [-551.027] -- 0:00:32
457000 -- (-557.795) (-550.332) (-550.919) [-551.014] * (-552.256) [-550.684] (-559.348) (-555.468) -- 0:00:32
457500 -- (-553.490) (-555.688) (-554.330) [-555.094] * (-552.322) [-551.299] (-551.182) (-555.319) -- 0:00:32
458000 -- (-551.639) [-554.009] (-554.486) (-554.963) * [-550.434] (-550.699) (-553.305) (-555.992) -- 0:00:31
458500 -- (-553.856) (-553.998) [-550.351] (-552.108) * (-553.794) [-552.542] (-552.955) (-554.719) -- 0:00:31
459000 -- [-554.125] (-553.998) (-551.351) (-551.959) * [-552.546] (-553.117) (-551.067) (-553.991) -- 0:00:31
459500 -- (-552.472) (-559.417) [-550.211] (-551.246) * [-553.744] (-554.943) (-550.559) (-552.795) -- 0:00:31
460000 -- (-556.024) [-552.037] (-550.643) (-552.842) * (-552.831) (-553.575) [-550.597] (-552.167) -- 0:00:31
Average standard deviation of split frequencies: 0.009608
460500 -- (-554.110) [-550.128] (-550.730) (-553.042) * (-552.274) (-550.138) (-552.441) [-550.616] -- 0:00:31
461000 -- (-551.647) (-553.433) [-550.556] (-553.982) * (-555.002) [-549.892] (-557.895) (-557.223) -- 0:00:32
461500 -- (-551.336) (-553.913) [-551.114] (-550.745) * [-554.717] (-549.979) (-551.293) (-553.229) -- 0:00:32
462000 -- (-551.183) (-552.672) [-550.824] (-551.431) * [-553.827] (-550.482) (-552.334) (-554.632) -- 0:00:32
462500 -- [-552.935] (-551.707) (-551.642) (-553.859) * (-552.469) (-551.578) (-557.403) [-554.535] -- 0:00:32
463000 -- (-550.418) [-551.970] (-552.488) (-553.814) * (-551.870) [-550.319] (-551.450) (-552.881) -- 0:00:32
463500 -- (-551.437) [-551.913] (-551.151) (-554.016) * [-554.249] (-556.949) (-553.504) (-553.618) -- 0:00:32
464000 -- (-559.802) [-554.227] (-553.336) (-551.243) * (-550.540) (-553.276) [-552.124] (-550.467) -- 0:00:32
464500 -- (-550.853) [-552.153] (-553.023) (-552.008) * (-554.001) [-553.966] (-551.942) (-552.808) -- 0:00:32
465000 -- (-553.464) (-552.586) (-552.499) [-552.930] * (-551.903) (-551.683) (-554.893) [-552.396] -- 0:00:32
Average standard deviation of split frequencies: 0.009477
465500 -- (-552.737) [-551.325] (-553.764) (-551.828) * (-551.595) (-551.968) (-552.489) [-552.462] -- 0:00:32
466000 -- (-557.130) [-550.685] (-551.424) (-551.756) * (-553.319) [-552.934] (-552.247) (-551.453) -- 0:00:32
466500 -- (-555.361) (-551.328) [-552.907] (-553.018) * (-554.253) (-551.198) (-551.690) [-552.312] -- 0:00:32
467000 -- [-552.859] (-551.525) (-553.886) (-552.301) * (-551.165) (-553.202) [-551.610] (-551.570) -- 0:00:31
467500 -- (-553.825) (-552.320) (-552.422) [-553.044] * (-552.726) (-551.543) [-555.657] (-550.502) -- 0:00:31
468000 -- (-553.265) [-550.660] (-550.318) (-552.427) * (-550.807) (-552.677) (-552.880) [-551.461] -- 0:00:31
468500 -- (-551.886) (-550.734) [-554.063] (-552.099) * (-553.630) (-550.803) (-552.861) [-551.958] -- 0:00:31
469000 -- (-552.372) [-551.054] (-553.257) (-551.084) * [-551.580] (-551.605) (-553.630) (-552.388) -- 0:00:31
469500 -- (-555.293) (-551.848) [-550.842] (-552.916) * (-553.469) [-550.917] (-552.916) (-550.622) -- 0:00:31
470000 -- (-552.570) (-552.524) (-550.670) [-558.300] * (-551.893) (-551.660) [-552.128] (-555.127) -- 0:00:31
Average standard deviation of split frequencies: 0.008958
470500 -- (-553.379) [-553.891] (-554.484) (-553.301) * (-551.525) [-554.826] (-553.626) (-558.343) -- 0:00:31
471000 -- (-550.775) [-555.606] (-553.547) (-552.495) * (-552.500) (-557.591) [-553.426] (-556.395) -- 0:00:31
471500 -- (-551.459) [-553.105] (-553.445) (-553.176) * [-555.321] (-555.268) (-552.681) (-550.365) -- 0:00:31
472000 -- (-553.367) (-551.147) [-551.988] (-554.475) * [-551.302] (-552.407) (-554.033) (-552.713) -- 0:00:31
472500 -- (-557.009) [-550.030] (-557.531) (-550.703) * [-550.983] (-553.553) (-551.651) (-553.427) -- 0:00:31
473000 -- [-550.151] (-552.913) (-553.016) (-551.999) * (-552.177) (-556.577) (-552.614) [-553.438] -- 0:00:31
473500 -- (-552.616) (-552.532) (-560.199) [-551.782] * (-563.287) (-550.866) [-551.859] (-550.816) -- 0:00:31
474000 -- (-551.217) (-550.864) (-551.127) [-552.632] * (-555.726) (-551.701) [-554.111] (-552.365) -- 0:00:31
474500 -- [-555.557] (-550.335) (-554.760) (-553.295) * [-551.496] (-551.049) (-551.168) (-552.855) -- 0:00:31
475000 -- (-551.043) [-555.571] (-552.920) (-551.137) * [-553.537] (-551.848) (-554.365) (-553.571) -- 0:00:30
Average standard deviation of split frequencies: 0.009612
475500 -- (-551.692) (-551.817) (-551.622) [-551.262] * (-551.916) (-551.051) (-550.242) [-551.963] -- 0:00:30
476000 -- (-551.556) [-551.793] (-554.545) (-553.566) * (-551.681) (-551.213) (-551.277) [-552.731] -- 0:00:30
476500 -- (-551.719) (-552.236) [-552.934] (-550.767) * (-553.053) (-551.124) (-552.014) [-551.051] -- 0:00:30
477000 -- (-551.037) (-552.721) (-550.357) [-550.755] * (-551.022) [-552.213] (-552.894) (-556.674) -- 0:00:30
477500 -- (-551.175) [-551.912] (-551.657) (-556.590) * (-554.161) [-551.429] (-554.855) (-552.892) -- 0:00:31
478000 -- [-553.023] (-552.196) (-551.317) (-558.717) * (-551.930) [-552.508] (-553.896) (-553.371) -- 0:00:31
478500 -- (-552.679) (-552.239) [-552.479] (-553.437) * [-551.312] (-555.332) (-556.308) (-553.174) -- 0:00:31
479000 -- [-550.591] (-554.721) (-550.260) (-552.170) * (-550.767) (-552.698) (-557.828) [-550.570] -- 0:00:31
479500 -- (-552.304) [-554.131] (-553.380) (-553.882) * (-552.628) (-552.772) (-552.630) [-551.595] -- 0:00:31
480000 -- (-550.957) (-553.113) [-551.143] (-551.166) * (-551.391) (-552.870) (-553.480) [-552.222] -- 0:00:31
Average standard deviation of split frequencies: 0.009208
480500 -- (-550.119) (-554.182) [-551.484] (-552.417) * (-553.832) (-551.814) (-557.305) [-553.819] -- 0:00:31
481000 -- (-553.103) (-556.202) [-550.656] (-556.020) * (-556.184) (-551.209) (-557.556) [-551.935] -- 0:00:31
481500 -- [-556.894] (-555.408) (-552.260) (-556.384) * (-552.602) [-551.404] (-552.789) (-553.014) -- 0:00:31
482000 -- [-554.327] (-551.528) (-555.234) (-555.253) * (-551.864) [-552.510] (-551.526) (-553.733) -- 0:00:31
482500 -- [-551.923] (-551.590) (-555.363) (-551.729) * (-552.618) (-550.541) (-556.408) [-550.336] -- 0:00:31
483000 -- (-551.119) (-552.673) [-552.137] (-553.912) * [-552.077] (-553.332) (-564.772) (-552.312) -- 0:00:31
483500 -- (-551.006) (-551.412) [-551.825] (-554.105) * [-554.657] (-553.945) (-554.261) (-552.657) -- 0:00:30
484000 -- (-552.372) (-553.051) (-559.021) [-553.495] * (-555.502) (-551.483) [-552.337] (-552.926) -- 0:00:30
484500 -- (-551.511) [-551.442] (-557.914) (-554.343) * (-551.548) [-550.247] (-555.747) (-552.828) -- 0:00:30
485000 -- [-553.033] (-555.618) (-550.519) (-552.361) * [-551.194] (-550.500) (-552.504) (-551.645) -- 0:00:30
Average standard deviation of split frequencies: 0.009754
485500 -- (-553.102) (-552.636) [-553.298] (-551.528) * (-553.365) (-551.184) [-550.773] (-554.555) -- 0:00:30
486000 -- (-551.451) (-550.609) (-552.883) [-552.221] * (-551.240) (-554.942) [-552.416] (-550.553) -- 0:00:30
486500 -- (-551.368) [-552.932] (-551.806) (-553.378) * [-551.832] (-551.673) (-558.447) (-551.715) -- 0:00:30
487000 -- (-550.352) (-555.804) [-552.710] (-550.958) * [-550.751] (-550.385) (-552.343) (-557.303) -- 0:00:30
487500 -- [-552.002] (-551.213) (-551.515) (-552.350) * (-552.985) [-550.604] (-555.058) (-556.040) -- 0:00:30
488000 -- (-551.541) (-550.941) [-552.114] (-551.940) * (-551.588) (-554.926) (-555.636) [-550.500] -- 0:00:30
488500 -- (-555.564) [-550.887] (-551.478) (-551.873) * (-550.188) (-551.794) (-553.258) [-553.086] -- 0:00:30
489000 -- (-552.121) (-552.006) [-551.899] (-555.167) * (-553.775) [-553.449] (-551.904) (-552.505) -- 0:00:30
489500 -- (-552.993) (-550.856) (-553.692) [-549.977] * (-554.013) (-551.464) [-551.177] (-553.406) -- 0:00:30
490000 -- (-552.322) (-551.967) [-551.479] (-552.413) * (-558.883) (-550.685) (-554.955) [-551.246] -- 0:00:30
Average standard deviation of split frequencies: 0.009661
490500 -- (-554.560) (-553.763) [-552.629] (-552.392) * [-551.085] (-552.066) (-552.221) (-552.249) -- 0:00:30
491000 -- (-551.047) (-550.024) [-550.498] (-555.134) * (-553.217) (-552.221) (-551.537) [-551.743] -- 0:00:30
491500 -- (-554.238) [-550.884] (-550.664) (-552.357) * [-552.571] (-552.114) (-552.107) (-551.425) -- 0:00:30
492000 -- [-550.872] (-550.480) (-551.627) (-551.663) * (-550.573) (-552.356) [-556.559] (-550.915) -- 0:00:29
492500 -- [-552.793] (-550.213) (-550.696) (-550.847) * (-550.546) [-550.652] (-551.714) (-553.411) -- 0:00:29
493000 -- (-555.201) (-551.161) [-552.499] (-551.684) * (-550.800) [-551.328] (-550.870) (-553.980) -- 0:00:29
493500 -- (-553.650) (-552.505) [-551.292] (-556.810) * (-551.665) [-553.519] (-553.400) (-554.201) -- 0:00:29
494000 -- (-551.374) (-554.073) (-553.827) [-551.956] * (-557.526) (-555.000) (-552.645) [-552.227] -- 0:00:29
494500 -- (-552.965) [-552.669] (-553.514) (-551.672) * [-552.313] (-555.876) (-550.578) (-552.839) -- 0:00:30
495000 -- (-552.293) (-551.816) [-551.795] (-553.099) * (-553.487) (-552.894) (-550.736) [-551.232] -- 0:00:30
Average standard deviation of split frequencies: 0.009225
495500 -- (-553.553) (-553.078) (-556.332) [-553.512] * [-553.457] (-555.520) (-553.123) (-552.006) -- 0:00:30
496000 -- [-553.001] (-555.757) (-551.880) (-555.674) * (-554.640) (-551.885) (-551.121) [-552.613] -- 0:00:30
496500 -- (-551.819) (-552.993) (-552.254) [-551.501] * (-552.455) (-551.898) (-553.197) [-551.611] -- 0:00:30
497000 -- (-552.241) (-551.963) [-552.613] (-552.752) * [-551.442] (-551.978) (-552.324) (-552.306) -- 0:00:30
497500 -- (-551.971) [-551.495] (-552.575) (-550.537) * (-555.362) (-553.236) (-556.837) [-550.458] -- 0:00:30
498000 -- (-555.812) (-551.599) (-552.947) [-553.095] * (-550.335) (-554.485) (-556.619) [-551.335] -- 0:00:30
498500 -- (-555.117) [-554.125] (-552.692) (-555.147) * (-553.175) [-553.097] (-553.435) (-552.118) -- 0:00:30
499000 -- [-553.569] (-552.172) (-552.355) (-551.074) * (-550.556) [-553.338] (-555.228) (-555.249) -- 0:00:30
499500 -- [-552.826] (-550.879) (-556.124) (-552.566) * [-551.874] (-550.393) (-551.255) (-552.494) -- 0:00:30
500000 -- (-551.968) (-552.839) [-550.135] (-553.554) * [-551.501] (-550.738) (-550.179) (-552.470) -- 0:00:30
Average standard deviation of split frequencies: 0.009139
500500 -- (-552.724) (-555.435) (-551.673) [-550.322] * [-550.934] (-553.358) (-553.924) (-552.293) -- 0:00:29
501000 -- (-552.548) [-552.426] (-550.842) (-558.226) * [-553.013] (-554.452) (-551.889) (-553.231) -- 0:00:29
501500 -- (-554.082) [-554.535] (-550.236) (-561.057) * (-551.098) [-550.644] (-552.265) (-552.133) -- 0:00:29
502000 -- (-552.026) [-552.013] (-553.966) (-554.074) * [-550.821] (-554.004) (-554.214) (-552.788) -- 0:00:29
502500 -- [-550.701] (-555.589) (-551.186) (-553.208) * (-552.002) (-555.835) [-551.943] (-550.930) -- 0:00:29
503000 -- (-558.021) [-551.595] (-553.505) (-550.352) * (-553.835) (-558.284) [-551.337] (-550.743) -- 0:00:29
503500 -- (-562.712) (-551.379) [-551.917] (-553.228) * [-552.522] (-556.761) (-553.207) (-551.872) -- 0:00:29
504000 -- [-552.165] (-555.347) (-551.697) (-551.872) * (-554.023) (-553.640) [-551.463] (-551.517) -- 0:00:29
504500 -- (-552.011) (-554.098) (-551.576) [-551.275] * (-553.840) [-552.541] (-552.438) (-552.259) -- 0:00:29
505000 -- (-556.037) (-557.741) (-557.186) [-552.245] * (-552.110) (-552.150) (-552.791) [-552.243] -- 0:00:29
Average standard deviation of split frequencies: 0.009042
505500 -- (-552.360) (-553.455) (-553.280) [-553.031] * (-550.406) [-554.925] (-551.257) (-552.487) -- 0:00:29
506000 -- (-551.879) (-551.957) (-553.162) [-552.530] * (-552.777) (-550.941) (-555.040) [-552.301] -- 0:00:29
506500 -- [-551.056] (-554.525) (-550.978) (-557.360) * (-551.820) (-555.999) (-552.218) [-550.783] -- 0:00:29
507000 -- [-551.499] (-551.900) (-550.460) (-550.506) * (-551.803) (-552.772) (-550.553) [-550.891] -- 0:00:29
507500 -- [-551.582] (-550.537) (-551.367) (-554.146) * (-551.245) [-550.757] (-550.405) (-551.454) -- 0:00:29
508000 -- (-551.156) [-553.560] (-552.401) (-551.545) * [-551.133] (-550.995) (-553.198) (-553.094) -- 0:00:29
508500 -- (-551.076) (-552.223) [-550.396] (-552.245) * (-550.647) [-554.554] (-554.249) (-552.598) -- 0:00:28
509000 -- (-550.308) [-551.758] (-551.412) (-551.295) * (-551.820) [-550.914] (-551.616) (-554.176) -- 0:00:28
509500 -- (-550.553) (-554.886) [-551.610] (-552.678) * (-552.382) (-553.632) (-552.132) [-551.471] -- 0:00:28
510000 -- (-552.801) (-556.048) [-550.964] (-551.103) * (-554.529) (-553.237) (-550.714) [-552.949] -- 0:00:28
Average standard deviation of split frequencies: 0.008851
510500 -- (-551.752) (-553.294) (-556.636) [-551.465] * (-556.494) (-549.996) [-551.648] (-550.610) -- 0:00:28
511000 -- (-550.688) (-553.806) (-556.492) [-551.640] * [-553.482] (-550.450) (-551.720) (-552.572) -- 0:00:29
511500 -- [-554.217] (-557.050) (-558.516) (-551.099) * (-552.050) (-551.709) (-552.227) [-557.641] -- 0:00:29
512000 -- (-553.805) (-553.656) (-555.763) [-550.910] * (-550.220) (-554.120) [-551.045] (-552.777) -- 0:00:29
512500 -- (-552.409) (-554.443) (-555.471) [-553.060] * (-552.641) [-552.053] (-556.245) (-550.661) -- 0:00:29
513000 -- [-554.992] (-550.763) (-555.919) (-554.863) * (-551.453) (-555.691) (-560.054) [-551.666] -- 0:00:29
513500 -- [-553.095] (-559.924) (-552.084) (-553.091) * (-551.446) (-555.513) [-554.141] (-551.610) -- 0:00:29
514000 -- [-551.600] (-560.739) (-550.661) (-553.656) * (-551.501) (-554.242) (-553.777) [-552.042] -- 0:00:29
514500 -- (-551.710) [-554.768] (-551.457) (-554.399) * (-551.087) [-550.472] (-551.180) (-551.205) -- 0:00:29
515000 -- [-552.214] (-552.985) (-550.181) (-553.618) * (-551.187) (-550.596) (-550.541) [-549.914] -- 0:00:29
Average standard deviation of split frequencies: 0.009404
515500 -- (-551.362) (-553.562) (-554.660) [-550.882] * (-552.063) (-550.976) (-550.988) [-551.277] -- 0:00:29
516000 -- (-552.215) [-553.770] (-559.614) (-553.009) * (-552.491) (-551.690) (-555.433) [-551.050] -- 0:00:29
516500 -- (-551.871) (-555.499) (-551.522) [-551.580] * (-552.788) (-552.546) [-553.758] (-551.657) -- 0:00:29
517000 -- (-552.169) (-558.730) [-551.446] (-552.830) * (-550.470) [-551.931] (-554.473) (-551.710) -- 0:00:28
517500 -- (-552.690) [-555.120] (-552.153) (-552.984) * [-550.703] (-554.014) (-553.863) (-551.893) -- 0:00:28
518000 -- (-552.687) (-552.386) (-551.360) [-553.690] * (-551.473) [-551.491] (-552.422) (-554.736) -- 0:00:28
518500 -- [-553.752] (-553.812) (-550.862) (-550.825) * [-552.127] (-550.520) (-551.531) (-550.931) -- 0:00:28
519000 -- (-555.768) [-556.510] (-554.568) (-556.520) * (-556.001) [-554.242] (-552.127) (-554.267) -- 0:00:28
519500 -- (-553.307) (-551.633) [-553.996] (-550.575) * (-553.987) [-551.786] (-551.456) (-552.419) -- 0:00:28
520000 -- [-551.616] (-553.381) (-555.536) (-551.707) * (-552.570) (-551.831) [-552.351] (-551.947) -- 0:00:28
Average standard deviation of split frequencies: 0.009640
520500 -- [-554.300] (-553.310) (-555.614) (-550.114) * (-554.210) (-552.060) (-551.703) [-553.022] -- 0:00:28
521000 -- (-561.299) [-551.104] (-553.123) (-549.980) * [-550.883] (-550.570) (-552.699) (-552.427) -- 0:00:28
521500 -- (-551.047) (-555.817) [-553.890] (-551.163) * (-554.921) [-551.418] (-554.977) (-551.980) -- 0:00:28
522000 -- (-552.581) (-557.512) [-552.015] (-550.118) * (-551.223) (-551.426) (-550.997) [-553.514] -- 0:00:28
522500 -- [-552.559] (-553.060) (-555.099) (-551.837) * (-551.379) [-550.801] (-552.595) (-553.320) -- 0:00:28
523000 -- (-551.381) [-553.738] (-552.269) (-553.035) * (-551.920) (-552.361) [-551.317] (-553.383) -- 0:00:28
523500 -- (-550.657) (-552.637) (-552.756) [-552.984] * (-555.895) [-551.590] (-552.784) (-552.350) -- 0:00:28
524000 -- (-551.157) (-552.174) (-553.241) [-551.159] * (-555.021) (-550.493) (-550.871) [-552.284] -- 0:00:28
524500 -- (-554.083) (-553.159) (-551.537) [-551.361] * (-554.374) (-550.841) (-552.157) [-553.527] -- 0:00:28
525000 -- (-555.195) [-553.068] (-551.804) (-553.225) * (-552.480) [-552.191] (-554.825) (-553.169) -- 0:00:28
Average standard deviation of split frequencies: 0.009908
525500 -- (-553.779) (-551.901) [-552.589] (-554.266) * (-556.002) [-553.292] (-553.388) (-556.812) -- 0:00:27
526000 -- (-552.516) (-552.997) (-552.498) [-550.130] * (-552.535) (-556.727) [-554.263] (-556.684) -- 0:00:27
526500 -- [-555.835] (-554.134) (-550.645) (-550.994) * (-553.418) (-555.604) (-556.811) [-554.080] -- 0:00:27
527000 -- (-554.007) [-552.590] (-555.418) (-550.718) * (-551.891) (-552.231) (-552.789) [-552.189] -- 0:00:27
527500 -- (-553.280) [-553.138] (-556.742) (-554.090) * (-550.474) (-553.306) (-551.525) [-550.483] -- 0:00:28
528000 -- (-552.515) (-551.091) (-555.399) [-552.175] * (-553.072) (-551.331) (-550.520) [-550.358] -- 0:00:28
528500 -- (-552.099) (-556.089) [-555.170] (-550.663) * (-552.283) [-550.750] (-551.567) (-551.242) -- 0:00:28
529000 -- (-551.967) [-550.886] (-552.604) (-550.793) * (-553.107) (-553.258) (-552.301) [-552.597] -- 0:00:28
529500 -- (-552.753) (-551.390) [-551.798] (-552.968) * (-551.742) (-553.733) (-552.865) [-559.054] -- 0:00:28
530000 -- (-551.897) (-552.894) [-551.676] (-553.840) * (-550.686) (-553.937) [-551.771] (-554.589) -- 0:00:28
Average standard deviation of split frequencies: 0.009031
530500 -- [-552.800] (-553.952) (-551.472) (-551.925) * (-552.969) [-554.283] (-550.985) (-555.964) -- 0:00:28
531000 -- [-551.433] (-551.117) (-552.120) (-552.535) * (-551.811) (-555.144) [-553.515] (-555.695) -- 0:00:28
531500 -- [-551.433] (-551.163) (-550.574) (-555.208) * (-552.338) (-551.285) [-554.533] (-554.166) -- 0:00:28
532000 -- (-554.606) (-550.576) [-550.865] (-552.990) * (-554.416) (-552.071) [-551.805] (-552.975) -- 0:00:28
532500 -- (-551.217) (-552.940) [-554.829] (-550.854) * [-553.144] (-551.867) (-555.732) (-550.919) -- 0:00:28
533000 -- (-551.246) [-551.601] (-552.374) (-550.558) * (-552.088) [-550.904] (-551.052) (-555.005) -- 0:00:28
533500 -- (-550.819) (-553.282) (-553.937) [-555.050] * (-554.072) (-553.719) (-553.293) [-550.116] -- 0:00:27
534000 -- (-554.229) (-552.939) [-555.795] (-554.413) * (-551.937) (-551.330) (-556.516) [-554.607] -- 0:00:27
534500 -- (-557.346) [-553.000] (-558.044) (-552.513) * (-551.003) (-551.235) [-553.325] (-551.505) -- 0:00:27
535000 -- [-554.925] (-550.690) (-553.019) (-554.423) * (-556.907) [-553.998] (-553.061) (-556.051) -- 0:00:27
Average standard deviation of split frequencies: 0.009088
535500 -- (-551.867) [-550.747] (-552.186) (-554.198) * (-554.562) (-556.707) (-550.745) [-551.208] -- 0:00:27
536000 -- (-550.683) [-550.595] (-550.121) (-552.193) * (-551.403) [-553.935] (-551.112) (-555.489) -- 0:00:27
536500 -- [-551.664] (-551.456) (-550.974) (-555.941) * [-551.285] (-553.049) (-555.233) (-550.956) -- 0:00:27
537000 -- (-551.084) (-554.835) [-553.534] (-550.514) * (-551.309) (-554.074) (-552.556) [-552.259] -- 0:00:27
537500 -- [-550.348] (-552.639) (-552.476) (-550.551) * (-554.366) (-552.160) [-551.025] (-553.352) -- 0:00:27
538000 -- [-551.998] (-556.064) (-550.558) (-552.301) * [-551.381] (-551.806) (-551.435) (-553.171) -- 0:00:27
538500 -- [-550.226] (-553.345) (-550.989) (-550.288) * (-550.147) (-552.377) [-551.067] (-553.520) -- 0:00:27
539000 -- (-550.188) (-552.077) (-552.706) [-549.842] * (-552.417) (-551.964) (-553.968) [-552.257] -- 0:00:27
539500 -- [-551.405] (-552.931) (-551.486) (-550.447) * (-555.647) (-558.084) [-552.830] (-555.279) -- 0:00:27
540000 -- (-551.170) [-551.629] (-552.759) (-550.723) * (-551.627) (-551.675) [-551.917] (-551.997) -- 0:00:27
Average standard deviation of split frequencies: 0.009349
540500 -- (-550.997) (-553.660) [-550.650] (-551.603) * (-553.733) (-550.355) (-551.909) [-550.576] -- 0:00:27
541000 -- (-552.802) [-550.990] (-552.954) (-551.418) * [-552.725] (-553.037) (-552.684) (-553.819) -- 0:00:27
541500 -- [-552.150] (-551.284) (-556.006) (-554.066) * (-551.036) (-552.726) [-553.298] (-558.706) -- 0:00:27
542000 -- [-551.576] (-554.124) (-550.394) (-556.306) * [-552.238] (-551.852) (-552.882) (-555.639) -- 0:00:27
542500 -- (-551.564) [-550.730] (-550.311) (-550.078) * [-549.945] (-552.474) (-550.452) (-552.299) -- 0:00:26
543000 -- (-553.462) [-550.693] (-551.140) (-550.127) * (-554.820) [-550.871] (-553.746) (-553.345) -- 0:00:27
543500 -- (-550.104) [-556.513] (-551.274) (-550.829) * (-554.069) (-552.661) [-553.004] (-551.268) -- 0:00:27
544000 -- (-551.994) (-553.330) (-552.786) [-552.201] * [-551.331] (-552.241) (-551.248) (-553.253) -- 0:00:27
544500 -- (-552.700) (-554.251) (-553.177) [-552.791] * (-553.108) [-550.951] (-550.348) (-552.154) -- 0:00:27
545000 -- [-554.678] (-555.295) (-555.083) (-552.441) * [-551.391] (-550.610) (-551.699) (-553.173) -- 0:00:27
Average standard deviation of split frequencies: 0.009161
545500 -- [-550.506] (-553.930) (-553.220) (-551.294) * [-551.775] (-551.812) (-551.684) (-556.318) -- 0:00:27
546000 -- (-553.218) [-550.881] (-555.188) (-551.813) * (-555.568) (-555.352) [-552.083] (-556.036) -- 0:00:27
546500 -- (-554.143) (-551.474) (-553.218) [-552.682] * [-553.560] (-551.910) (-554.595) (-552.981) -- 0:00:27
547000 -- (-552.522) (-551.510) (-551.825) [-552.459] * [-554.525] (-551.891) (-553.635) (-552.327) -- 0:00:27
547500 -- (-552.643) (-550.859) [-558.735] (-552.567) * (-552.961) [-552.111] (-554.319) (-551.316) -- 0:00:27
548000 -- (-558.082) [-552.475] (-557.343) (-551.551) * (-551.890) [-551.486] (-554.282) (-554.220) -- 0:00:27
548500 -- (-551.297) (-552.346) [-552.209] (-550.812) * (-553.000) (-551.211) [-553.160] (-552.582) -- 0:00:27
549000 -- (-551.332) [-555.203] (-552.285) (-553.083) * (-553.993) (-551.087) [-551.051] (-553.980) -- 0:00:27
549500 -- (-551.140) (-553.237) (-552.622) [-551.369] * (-551.851) (-551.677) [-551.508] (-553.757) -- 0:00:27
550000 -- [-551.703] (-552.279) (-554.167) (-551.264) * (-552.027) [-552.452] (-554.224) (-554.205) -- 0:00:27
Average standard deviation of split frequencies: 0.009512
550500 -- (-551.640) (-553.818) (-552.390) [-551.673] * (-552.852) (-556.347) [-550.120] (-553.146) -- 0:00:26
551000 -- (-553.459) [-550.964] (-550.923) (-552.188) * (-550.628) [-552.622] (-553.074) (-550.587) -- 0:00:26
551500 -- (-552.759) [-551.828] (-553.607) (-554.684) * [-552.285] (-552.801) (-550.914) (-554.755) -- 0:00:26
552000 -- [-552.530] (-551.214) (-554.020) (-552.158) * (-550.596) (-550.509) [-551.712] (-551.240) -- 0:00:26
552500 -- (-551.445) [-550.311] (-550.374) (-551.053) * (-552.464) [-551.416] (-551.350) (-553.653) -- 0:00:26
553000 -- (-552.328) (-552.625) [-551.043] (-550.310) * (-552.034) [-553.697] (-550.782) (-551.873) -- 0:00:26
553500 -- (-553.046) (-550.824) [-550.442] (-551.704) * (-550.904) (-553.128) (-553.527) [-552.875] -- 0:00:26
554000 -- (-550.636) [-550.804] (-553.580) (-553.741) * [-556.445] (-554.940) (-550.980) (-550.776) -- 0:00:26
554500 -- (-550.959) (-555.384) (-558.148) [-554.407] * (-558.099) (-553.205) (-552.067) [-551.875] -- 0:00:26
555000 -- (-551.455) (-557.141) (-559.189) [-552.793] * (-553.119) [-557.438] (-552.153) (-553.752) -- 0:00:26
Average standard deviation of split frequencies: 0.009468
555500 -- (-552.798) [-551.095] (-558.450) (-550.914) * (-551.515) [-552.183] (-552.201) (-550.662) -- 0:00:26
556000 -- (-558.539) [-550.445] (-550.556) (-554.272) * [-551.966] (-552.409) (-553.576) (-553.798) -- 0:00:26
556500 -- (-551.681) (-550.431) [-552.216] (-552.332) * (-551.746) (-552.630) (-551.393) [-552.625] -- 0:00:26
557000 -- (-552.046) (-552.671) [-550.529] (-552.629) * (-554.973) (-551.749) [-550.157] (-554.787) -- 0:00:27
557500 -- (-552.268) (-553.834) (-554.376) [-552.270] * [-554.217] (-553.086) (-550.151) (-552.056) -- 0:00:26
558000 -- (-552.367) [-555.912] (-555.357) (-550.414) * (-553.673) (-551.611) (-551.650) [-551.898] -- 0:00:26
558500 -- (-552.127) (-557.914) (-552.376) [-550.682] * (-551.533) (-552.886) (-555.292) [-551.333] -- 0:00:26
559000 -- [-551.916] (-560.877) (-555.341) (-551.696) * [-551.955] (-550.063) (-555.018) (-550.606) -- 0:00:26
559500 -- [-552.294] (-551.964) (-552.524) (-550.973) * (-550.960) [-554.959] (-557.937) (-552.425) -- 0:00:26
560000 -- [-554.426] (-553.999) (-551.824) (-552.701) * (-551.338) (-552.316) [-551.837] (-552.303) -- 0:00:26
Average standard deviation of split frequencies: 0.008968
560500 -- [-552.756] (-555.093) (-552.849) (-554.345) * (-551.723) (-550.373) [-551.159] (-553.129) -- 0:00:26
561000 -- (-550.740) (-552.863) [-551.414] (-555.354) * [-552.101] (-554.799) (-552.205) (-556.004) -- 0:00:26
561500 -- (-550.631) (-551.968) (-550.582) [-552.014] * (-554.611) (-558.062) (-555.414) [-558.229] -- 0:00:26
562000 -- (-550.338) [-551.449] (-552.285) (-550.258) * (-551.920) (-554.354) (-551.723) [-555.982] -- 0:00:26
562500 -- [-550.946] (-551.395) (-553.783) (-552.334) * (-550.506) [-561.814] (-553.145) (-551.051) -- 0:00:26
563000 -- (-551.282) [-551.604] (-551.323) (-553.305) * (-552.148) [-554.947] (-552.684) (-551.047) -- 0:00:26
563500 -- (-552.316) (-556.758) [-551.179] (-552.782) * (-550.290) (-557.966) (-551.966) [-551.148] -- 0:00:26
564000 -- (-550.755) (-553.671) [-550.224] (-555.284) * (-553.196) [-551.146] (-551.534) (-550.624) -- 0:00:26
564500 -- (-551.236) (-551.993) (-552.274) [-550.528] * [-553.382] (-551.380) (-553.046) (-551.120) -- 0:00:26
565000 -- (-558.054) (-551.853) (-550.500) [-552.588] * (-551.668) [-550.392] (-555.452) (-551.236) -- 0:00:26
Average standard deviation of split frequencies: 0.008653
565500 -- (-555.901) (-554.207) (-550.892) [-552.119] * (-551.814) (-551.930) (-553.140) [-551.751] -- 0:00:26
566000 -- [-552.937] (-553.918) (-557.606) (-553.882) * (-550.645) (-553.724) (-553.832) [-553.116] -- 0:00:26
566500 -- (-552.093) [-557.339] (-554.611) (-559.040) * (-551.926) (-555.365) [-550.808] (-555.445) -- 0:00:26
567000 -- (-553.631) (-554.764) (-553.868) [-552.366] * (-554.139) (-552.297) (-550.671) [-552.323] -- 0:00:25
567500 -- (-555.476) (-551.849) [-554.944] (-553.612) * (-550.280) [-551.291] (-551.581) (-550.198) -- 0:00:25
568000 -- (-551.322) [-551.711] (-552.111) (-552.997) * [-551.198] (-552.789) (-553.608) (-555.765) -- 0:00:25
568500 -- [-552.286] (-557.842) (-551.306) (-552.457) * (-551.216) (-553.944) (-550.981) [-554.151] -- 0:00:25
569000 -- (-552.406) (-552.589) [-552.132] (-552.717) * [-550.528] (-553.385) (-551.589) (-553.820) -- 0:00:25
569500 -- (-557.095) (-549.983) (-552.207) [-554.227] * [-551.341] (-554.921) (-551.531) (-551.072) -- 0:00:25
570000 -- [-551.693] (-550.965) (-553.417) (-556.265) * [-551.676] (-554.275) (-551.673) (-551.230) -- 0:00:25
Average standard deviation of split frequencies: 0.008261
570500 -- (-553.629) (-552.166) (-555.169) [-552.265] * (-556.226) (-551.199) [-553.072] (-551.154) -- 0:00:25
571000 -- (-553.052) [-550.920] (-551.040) (-551.593) * (-553.716) (-551.207) (-551.026) [-554.934] -- 0:00:25
571500 -- (-550.928) (-551.052) [-551.851] (-550.834) * (-556.798) (-550.268) [-553.149] (-552.907) -- 0:00:25
572000 -- [-554.600] (-551.938) (-554.885) (-550.982) * (-550.784) [-556.671] (-556.276) (-551.501) -- 0:00:25
572500 -- (-552.432) (-552.116) [-551.148] (-553.274) * (-551.248) (-553.951) [-550.449] (-552.329) -- 0:00:25
573000 -- (-552.200) (-550.404) [-551.145] (-551.933) * (-550.544) [-552.218] (-551.817) (-550.543) -- 0:00:25
573500 -- [-550.882] (-550.366) (-551.237) (-552.278) * (-552.140) [-555.623] (-552.672) (-555.357) -- 0:00:25
574000 -- (-550.781) (-552.442) [-551.718] (-552.202) * (-552.030) (-550.848) (-554.790) [-552.791] -- 0:00:25
574500 -- (-553.223) (-550.600) [-553.589] (-551.400) * (-553.266) (-551.982) (-550.686) [-551.438] -- 0:00:25
575000 -- (-551.329) [-550.800] (-552.545) (-554.091) * [-555.028] (-553.621) (-550.775) (-551.147) -- 0:00:25
Average standard deviation of split frequencies: 0.008473
575500 -- [-550.501] (-551.626) (-553.800) (-551.625) * (-553.654) (-554.020) [-551.303] (-551.174) -- 0:00:25
576000 -- (-550.794) [-551.286] (-550.547) (-551.373) * (-551.835) (-557.252) (-550.701) [-552.594] -- 0:00:25
576500 -- [-551.387] (-553.371) (-551.521) (-550.975) * (-558.149) [-554.582] (-556.172) (-553.621) -- 0:00:25
577000 -- (-551.599) [-552.513] (-556.217) (-551.130) * [-554.486] (-551.635) (-552.263) (-554.442) -- 0:00:25
577500 -- (-550.282) (-551.212) (-555.711) [-552.185] * (-556.548) (-551.073) (-551.357) [-557.668] -- 0:00:25
578000 -- (-552.046) (-554.185) [-552.056] (-554.226) * (-551.486) (-553.665) [-551.979] (-554.036) -- 0:00:25
578500 -- (-551.764) (-552.934) [-552.605] (-552.181) * (-552.446) (-558.839) (-553.279) [-551.244] -- 0:00:25
579000 -- (-555.347) (-551.308) (-551.207) [-553.971] * (-551.347) (-553.307) (-552.326) [-550.044] -- 0:00:25
579500 -- (-553.389) (-551.525) [-558.858] (-551.898) * (-552.631) (-554.349) (-550.642) [-551.583] -- 0:00:25
580000 -- (-550.538) (-551.406) (-552.333) [-552.564] * (-554.120) (-553.585) (-551.662) [-552.039] -- 0:00:25
Average standard deviation of split frequencies: 0.008309
580500 -- (-550.890) (-553.555) (-553.555) [-551.219] * (-550.033) (-553.970) (-554.658) [-552.237] -- 0:00:25
581000 -- (-551.202) (-553.533) [-551.238] (-556.521) * [-551.530] (-558.587) (-550.529) (-550.551) -- 0:00:25
581500 -- (-552.453) (-551.037) (-553.726) [-551.916] * (-550.906) (-555.929) [-550.610] (-552.010) -- 0:00:25
582000 -- (-552.592) (-551.084) (-550.932) [-550.722] * (-551.767) (-551.835) [-553.305] (-552.256) -- 0:00:25
582500 -- (-557.251) [-551.698] (-554.382) (-552.791) * [-551.790] (-551.664) (-551.759) (-553.498) -- 0:00:25
583000 -- [-552.374] (-551.399) (-553.334) (-554.693) * (-551.216) (-552.744) [-551.304] (-552.165) -- 0:00:25
583500 -- (-557.472) [-552.447] (-551.127) (-550.810) * (-552.873) (-551.217) (-554.163) [-550.901] -- 0:00:24
584000 -- (-551.179) (-550.509) (-553.000) [-552.731] * (-550.299) (-550.758) (-555.943) [-549.792] -- 0:00:24
584500 -- [-551.127] (-550.499) (-551.278) (-550.936) * (-552.633) (-551.491) (-553.618) [-551.154] -- 0:00:24
585000 -- (-551.256) (-551.865) [-551.400] (-552.226) * (-550.865) [-552.144] (-550.635) (-553.455) -- 0:00:24
Average standard deviation of split frequencies: 0.008470
585500 -- (-554.785) (-556.053) [-551.567] (-553.029) * (-556.888) [-551.442] (-550.687) (-556.904) -- 0:00:24
586000 -- [-550.437] (-552.816) (-551.511) (-553.996) * (-556.992) [-556.150] (-551.428) (-550.939) -- 0:00:24
586500 -- (-550.883) (-551.663) (-554.735) [-552.502] * (-551.929) (-554.278) [-553.284] (-555.657) -- 0:00:24
587000 -- [-553.277] (-552.499) (-551.963) (-550.446) * (-553.421) [-554.388] (-553.941) (-553.424) -- 0:00:24
587500 -- (-551.102) (-550.600) (-551.151) [-556.405] * (-552.768) (-554.035) (-551.240) [-550.293] -- 0:00:24
588000 -- [-554.066] (-550.341) (-551.986) (-550.343) * (-551.548) (-556.382) [-551.674] (-553.311) -- 0:00:24
588500 -- (-554.446) [-551.480] (-554.773) (-554.222) * (-554.419) (-552.665) [-552.753] (-554.019) -- 0:00:24
589000 -- (-551.609) (-550.523) (-551.243) [-553.638] * (-554.427) (-555.722) [-550.526] (-553.064) -- 0:00:24
589500 -- [-553.772] (-556.493) (-554.002) (-551.949) * (-552.836) (-554.721) [-551.512] (-551.585) -- 0:00:24
590000 -- (-554.460) (-561.733) [-550.670] (-552.880) * (-552.713) (-550.756) (-554.407) [-550.620] -- 0:00:24
Average standard deviation of split frequencies: 0.008638
590500 -- [-552.826] (-554.765) (-551.127) (-552.974) * (-551.153) (-553.774) (-558.755) [-551.497] -- 0:00:24
591000 -- (-550.245) (-550.413) [-551.060] (-551.130) * (-553.644) [-553.723] (-550.911) (-551.138) -- 0:00:24
591500 -- (-552.750) (-550.527) (-551.531) [-553.572] * (-554.294) [-553.359] (-552.746) (-551.212) -- 0:00:24
592000 -- [-550.416] (-551.236) (-551.274) (-551.490) * (-550.089) (-552.811) (-554.401) [-553.933] -- 0:00:24
592500 -- (-555.384) (-554.373) (-553.459) [-551.144] * (-554.394) [-550.930] (-550.302) (-554.647) -- 0:00:24
593000 -- (-551.968) (-551.030) [-551.064] (-555.104) * (-551.980) (-550.528) [-550.016] (-555.638) -- 0:00:24
593500 -- (-554.631) [-553.982] (-555.133) (-554.835) * (-553.500) (-553.660) [-550.467] (-553.086) -- 0:00:24
594000 -- [-551.542] (-552.134) (-551.860) (-554.341) * (-551.967) [-552.058] (-552.249) (-550.561) -- 0:00:24
594500 -- (-553.322) (-553.541) (-555.498) [-553.256] * [-550.357] (-553.720) (-552.192) (-551.774) -- 0:00:24
595000 -- (-552.303) (-554.420) (-551.223) [-553.217] * [-550.081] (-557.477) (-555.655) (-552.294) -- 0:00:24
Average standard deviation of split frequencies: 0.008747
595500 -- (-553.218) (-552.197) (-552.708) [-550.610] * [-551.165] (-553.381) (-554.476) (-552.181) -- 0:00:24
596000 -- [-552.311] (-553.785) (-554.140) (-550.755) * (-552.432) (-553.167) (-554.027) [-551.377] -- 0:00:24
596500 -- [-550.816] (-554.607) (-554.126) (-554.420) * (-550.880) (-554.141) [-551.154] (-550.686) -- 0:00:24
597000 -- (-554.622) (-551.441) [-551.122] (-551.363) * (-553.337) (-553.198) (-553.676) [-550.624] -- 0:00:24
597500 -- (-554.137) (-552.875) (-551.430) [-551.373] * (-555.816) [-552.421] (-550.084) (-551.999) -- 0:00:24
598000 -- (-555.136) (-550.498) [-550.708] (-554.784) * (-559.396) (-552.911) (-553.852) [-551.363] -- 0:00:24
598500 -- (-553.508) (-553.185) [-556.273] (-550.834) * [-550.728] (-552.836) (-551.752) (-551.741) -- 0:00:24
599000 -- (-552.048) [-553.847] (-552.173) (-552.147) * (-552.564) (-556.370) (-553.079) [-551.729] -- 0:00:24
599500 -- [-551.969] (-550.894) (-552.705) (-550.805) * [-549.972] (-555.510) (-551.010) (-553.267) -- 0:00:24
600000 -- (-551.581) [-551.785] (-552.541) (-550.212) * (-554.941) (-551.851) [-550.825] (-552.431) -- 0:00:24
Average standard deviation of split frequencies: 0.008771
600500 -- [-552.802] (-555.228) (-550.677) (-551.119) * (-552.553) (-552.805) (-551.327) [-551.160] -- 0:00:23
601000 -- (-554.156) (-553.679) [-551.182] (-550.627) * (-552.311) (-550.982) [-552.180] (-554.448) -- 0:00:23
601500 -- [-551.696] (-552.671) (-554.837) (-550.367) * (-551.531) (-552.295) [-551.952] (-551.927) -- 0:00:23
602000 -- (-553.992) [-552.504] (-550.605) (-553.075) * (-552.176) [-555.207] (-551.710) (-550.604) -- 0:00:23
602500 -- [-551.411] (-551.710) (-550.820) (-552.163) * [-551.348] (-554.584) (-551.188) (-550.168) -- 0:00:23
603000 -- (-555.056) [-556.142] (-551.221) (-554.271) * [-550.692] (-554.386) (-553.663) (-555.005) -- 0:00:23
603500 -- (-552.341) (-557.442) [-552.025] (-554.666) * (-559.593) (-553.513) [-552.961] (-553.684) -- 0:00:23
604000 -- (-550.034) (-556.353) [-551.969] (-554.487) * (-558.152) [-550.284] (-556.398) (-551.349) -- 0:00:23
604500 -- [-550.663] (-551.507) (-553.794) (-552.238) * (-550.619) (-550.326) [-549.910] (-550.417) -- 0:00:23
605000 -- (-552.105) (-554.492) (-552.341) [-550.760] * (-550.442) [-552.962] (-553.275) (-549.997) -- 0:00:23
Average standard deviation of split frequencies: 0.009426
605500 -- (-552.997) (-556.465) (-551.670) [-551.596] * (-553.249) (-553.175) (-553.899) [-552.370] -- 0:00:23
606000 -- (-551.772) [-553.677] (-551.674) (-551.959) * (-551.791) (-557.086) [-552.383] (-551.795) -- 0:00:23
606500 -- [-550.807] (-552.592) (-552.654) (-550.292) * (-551.862) (-553.500) [-553.856] (-552.232) -- 0:00:23
607000 -- (-551.268) (-554.001) (-554.684) [-552.002] * (-552.147) (-554.458) [-551.054] (-551.867) -- 0:00:23
607500 -- [-552.107] (-552.591) (-554.251) (-551.893) * (-552.005) (-553.594) (-552.312) [-554.343] -- 0:00:23
608000 -- (-552.652) (-555.861) (-554.395) [-552.080] * [-550.910] (-551.157) (-550.343) (-552.531) -- 0:00:23
608500 -- (-550.309) [-551.521] (-555.856) (-552.341) * (-550.273) (-554.856) (-550.982) [-549.909] -- 0:00:23
609000 -- [-553.203] (-553.561) (-555.699) (-550.033) * (-556.715) (-551.882) [-551.885] (-551.771) -- 0:00:23
609500 -- (-551.958) (-556.647) (-553.363) [-552.264] * (-552.338) [-553.957] (-553.451) (-553.609) -- 0:00:23
610000 -- (-555.121) (-551.309) (-554.140) [-552.433] * [-555.526] (-552.562) (-551.426) (-551.057) -- 0:00:23
Average standard deviation of split frequencies: 0.009400
610500 -- [-555.951] (-552.842) (-557.292) (-554.010) * (-554.036) (-553.283) (-558.888) [-551.100] -- 0:00:23
611000 -- [-554.322] (-554.105) (-552.696) (-554.120) * (-552.672) (-554.345) (-552.061) [-551.754] -- 0:00:23
611500 -- (-551.822) [-551.992] (-551.674) (-550.454) * (-553.406) (-552.455) (-552.691) [-551.602] -- 0:00:23
612000 -- (-550.862) [-551.658] (-551.269) (-551.138) * (-552.202) [-555.115] (-552.604) (-551.388) -- 0:00:23
612500 -- [-551.108] (-551.274) (-554.052) (-560.991) * (-552.339) (-554.782) (-552.345) [-551.825] -- 0:00:23
613000 -- (-552.171) [-553.031] (-553.406) (-551.805) * (-553.268) (-550.547) (-550.820) [-555.703] -- 0:00:23
613500 -- (-553.157) (-550.592) (-553.720) [-551.552] * (-553.806) (-550.644) (-551.113) [-551.743] -- 0:00:23
614000 -- (-555.048) (-553.061) (-551.865) [-550.226] * (-554.859) (-553.399) [-552.517] (-550.729) -- 0:00:23
614500 -- (-553.831) (-550.339) (-555.013) [-550.817] * [-554.627] (-553.809) (-554.094) (-552.103) -- 0:00:23
615000 -- [-551.469] (-554.889) (-550.572) (-551.122) * (-556.377) [-552.224] (-552.311) (-553.943) -- 0:00:23
Average standard deviation of split frequencies: 0.009183
615500 -- (-552.402) (-552.358) (-553.280) [-552.046] * [-551.956] (-555.789) (-550.615) (-552.892) -- 0:00:23
616000 -- (-553.875) (-551.438) [-552.095] (-554.284) * (-553.346) (-550.587) [-552.785] (-550.932) -- 0:00:23
616500 -- [-553.832] (-553.132) (-553.632) (-552.599) * (-551.859) (-550.731) [-551.310] (-551.906) -- 0:00:23
617000 -- [-555.291] (-553.405) (-556.441) (-552.100) * [-556.430] (-555.444) (-551.375) (-552.066) -- 0:00:22
617500 -- [-551.588] (-550.053) (-557.414) (-554.642) * (-555.312) [-552.334] (-553.412) (-550.560) -- 0:00:22
618000 -- (-552.353) (-551.205) (-556.686) [-551.419] * (-553.072) (-552.538) (-551.167) [-550.938] -- 0:00:22
618500 -- [-552.778] (-552.205) (-553.126) (-550.947) * (-552.807) (-551.316) (-551.361) [-550.528] -- 0:00:22
619000 -- [-550.526] (-553.424) (-555.477) (-552.965) * [-551.084] (-551.490) (-553.016) (-552.124) -- 0:00:22
619500 -- [-550.250] (-551.997) (-553.432) (-553.503) * (-552.003) (-551.907) [-551.682] (-557.705) -- 0:00:22
620000 -- (-558.503) [-551.538] (-554.558) (-554.865) * (-552.024) [-550.441] (-552.785) (-551.318) -- 0:00:22
Average standard deviation of split frequencies: 0.009382
620500 -- [-552.516] (-552.404) (-553.299) (-560.588) * (-553.500) (-550.657) [-553.263] (-552.433) -- 0:00:22
621000 -- (-558.179) (-553.228) (-552.025) [-553.069] * (-552.200) [-551.146] (-554.759) (-556.937) -- 0:00:22
621500 -- [-551.148] (-551.085) (-551.134) (-550.572) * [-551.396] (-550.800) (-554.147) (-550.699) -- 0:00:22
622000 -- (-551.633) (-552.549) (-552.190) [-551.612] * (-552.348) (-551.751) (-552.706) [-551.660] -- 0:00:22
622500 -- (-550.872) (-554.944) (-552.353) [-553.847] * (-553.370) [-553.570] (-552.437) (-551.923) -- 0:00:22
623000 -- (-551.245) (-553.060) [-550.510] (-557.476) * (-551.862) (-556.910) (-550.475) [-552.112] -- 0:00:22
623500 -- (-551.580) (-554.389) [-551.230] (-552.354) * (-554.444) (-554.821) [-551.145] (-553.131) -- 0:00:22
624000 -- [-551.556] (-553.852) (-549.999) (-551.909) * (-552.869) (-555.075) [-550.905] (-551.873) -- 0:00:22
624500 -- (-554.628) (-553.966) [-550.215] (-552.081) * (-552.266) (-556.637) (-557.532) [-556.859] -- 0:00:22
625000 -- (-552.077) (-554.890) [-550.206] (-552.503) * (-551.557) [-554.095] (-552.451) (-551.779) -- 0:00:22
Average standard deviation of split frequencies: 0.009347
625500 -- (-550.013) (-550.764) [-550.158] (-558.853) * (-550.091) [-554.174] (-550.891) (-552.586) -- 0:00:22
626000 -- [-556.229] (-550.859) (-554.757) (-553.029) * (-550.994) [-551.261] (-551.358) (-552.116) -- 0:00:22
626500 -- [-555.387] (-551.594) (-550.579) (-550.215) * (-552.943) (-552.511) (-550.558) [-550.661] -- 0:00:22
627000 -- (-553.636) (-550.480) [-552.058] (-554.042) * [-553.693] (-551.979) (-551.764) (-554.646) -- 0:00:22
627500 -- (-552.793) (-551.675) (-554.319) [-554.973] * (-555.419) (-553.103) [-550.402] (-558.103) -- 0:00:22
628000 -- (-554.460) (-551.209) (-556.571) [-552.289] * (-552.193) [-554.432] (-552.609) (-553.745) -- 0:00:22
628500 -- (-552.688) (-555.440) (-552.063) [-551.697] * [-554.183] (-552.321) (-553.125) (-551.542) -- 0:00:22
629000 -- (-550.804) (-552.062) (-550.346) [-552.836] * (-552.843) (-551.445) [-551.457] (-551.972) -- 0:00:22
629500 -- (-552.898) (-553.495) (-553.488) [-552.200] * (-553.534) [-551.752] (-551.733) (-552.522) -- 0:00:22
630000 -- (-555.196) (-554.200) [-551.698] (-553.186) * (-550.638) (-550.649) (-551.117) [-552.481] -- 0:00:22
Average standard deviation of split frequencies: 0.009146
630500 -- (-551.927) [-552.424] (-552.020) (-551.172) * (-551.243) (-551.950) [-551.852] (-554.703) -- 0:00:22
631000 -- (-554.550) (-554.246) [-552.514] (-552.642) * (-554.273) [-551.875] (-551.615) (-552.728) -- 0:00:22
631500 -- (-553.091) [-550.387] (-554.564) (-553.194) * [-552.984] (-550.640) (-551.677) (-551.570) -- 0:00:22
632000 -- (-552.386) (-552.574) (-550.976) [-552.071] * (-550.537) (-551.681) (-556.254) [-550.281] -- 0:00:22
632500 -- (-552.635) (-554.762) [-550.182] (-553.758) * [-552.623] (-550.445) (-553.731) (-552.870) -- 0:00:22
633000 -- (-550.939) (-553.947) [-550.521] (-553.909) * (-551.339) (-552.631) (-554.513) [-552.848] -- 0:00:22
633500 -- (-552.568) [-551.845] (-551.303) (-550.295) * [-550.711] (-551.964) (-551.440) (-554.402) -- 0:00:21
634000 -- (-552.268) (-550.945) [-550.647] (-553.250) * (-551.406) (-552.518) (-552.295) [-551.923] -- 0:00:21
634500 -- (-553.256) (-550.842) [-552.687] (-551.575) * (-551.057) (-551.927) (-554.122) [-552.440] -- 0:00:21
635000 -- (-550.651) [-551.616] (-551.382) (-550.066) * (-556.239) (-552.113) [-550.604] (-552.127) -- 0:00:21
Average standard deviation of split frequencies: 0.009126
635500 -- (-550.488) (-555.054) [-553.540] (-554.256) * [-551.990] (-552.050) (-552.445) (-552.505) -- 0:00:21
636000 -- [-551.504] (-552.642) (-553.486) (-551.224) * [-552.370] (-554.302) (-551.178) (-551.079) -- 0:00:21
636500 -- (-552.230) (-551.921) (-551.815) [-551.382] * (-553.493) (-550.362) (-557.787) [-551.561] -- 0:00:21
637000 -- (-552.247) [-550.973] (-550.258) (-552.129) * (-552.776) (-550.633) [-554.606] (-553.588) -- 0:00:21
637500 -- [-552.223] (-552.220) (-550.476) (-552.415) * (-550.261) (-552.102) (-557.440) [-552.107] -- 0:00:21
638000 -- (-551.895) (-552.810) [-550.958] (-553.816) * (-551.079) (-553.304) [-552.446] (-555.828) -- 0:00:21
638500 -- (-551.078) (-554.171) [-552.794] (-550.301) * (-551.770) (-551.386) [-552.475] (-553.146) -- 0:00:21
639000 -- (-551.909) [-552.574] (-550.667) (-551.346) * [-553.572] (-553.999) (-552.158) (-551.987) -- 0:00:21
639500 -- [-554.143] (-553.745) (-550.801) (-553.174) * (-550.424) (-557.034) [-554.663] (-553.690) -- 0:00:21
640000 -- (-554.135) [-555.775] (-551.152) (-552.608) * (-550.599) (-551.645) (-552.592) [-552.786] -- 0:00:21
Average standard deviation of split frequencies: 0.009795
640500 -- (-557.560) (-552.868) (-552.441) [-552.088] * [-551.829] (-553.643) (-552.918) (-550.793) -- 0:00:21
641000 -- (-553.880) (-551.044) [-552.743] (-551.903) * [-550.834] (-553.175) (-551.799) (-550.234) -- 0:00:21
641500 -- [-553.862] (-551.254) (-551.657) (-555.591) * (-552.383) [-552.456] (-551.063) (-550.828) -- 0:00:21
642000 -- (-551.298) (-552.764) (-553.732) [-550.671] * (-551.815) (-552.713) [-551.522] (-552.636) -- 0:00:21
642500 -- [-552.102] (-554.225) (-551.678) (-550.354) * (-555.930) (-554.353) [-551.582] (-550.209) -- 0:00:21
643000 -- [-552.238] (-552.042) (-550.498) (-551.407) * (-554.985) [-552.330] (-555.250) (-550.387) -- 0:00:21
643500 -- (-554.009) (-551.592) [-551.683] (-551.015) * (-554.055) (-554.640) [-551.563] (-552.362) -- 0:00:21
644000 -- (-553.978) [-551.921] (-551.139) (-551.014) * (-552.373) (-555.078) (-551.178) [-552.361] -- 0:00:21
644500 -- (-552.532) (-552.966) (-551.042) [-551.047] * [-552.548] (-552.507) (-559.085) (-550.912) -- 0:00:21
645000 -- (-552.545) [-552.607] (-550.930) (-550.843) * (-552.619) (-553.029) [-553.211] (-550.776) -- 0:00:21
Average standard deviation of split frequencies: 0.010034
645500 -- (-556.121) (-552.620) [-551.339] (-551.887) * (-550.859) (-552.650) (-553.197) [-553.410] -- 0:00:21
646000 -- [-552.648] (-552.356) (-550.731) (-553.622) * (-551.660) (-553.570) [-549.841] (-552.049) -- 0:00:21
646500 -- [-552.518] (-552.215) (-551.500) (-551.585) * (-556.081) (-551.663) (-552.826) [-554.688] -- 0:00:21
647000 -- (-552.149) (-552.332) (-551.514) [-551.577] * (-551.352) (-551.649) [-552.368] (-554.177) -- 0:00:21
647500 -- (-553.083) (-552.310) [-551.996] (-550.331) * [-550.429] (-554.242) (-551.687) (-553.954) -- 0:00:21
648000 -- (-550.493) [-553.180] (-551.066) (-551.027) * (-550.325) (-554.874) (-552.782) [-551.030] -- 0:00:21
648500 -- (-551.001) (-557.475) [-551.710] (-550.754) * (-550.322) [-554.208] (-554.169) (-550.432) -- 0:00:21
649000 -- (-551.145) [-550.903] (-550.677) (-552.340) * (-550.332) [-551.919] (-555.048) (-551.858) -- 0:00:21
649500 -- [-550.870] (-550.584) (-552.840) (-552.224) * (-550.054) [-550.183] (-554.322) (-555.154) -- 0:00:21
650000 -- (-554.227) [-553.643] (-552.812) (-555.359) * (-550.206) [-551.113] (-555.456) (-552.134) -- 0:00:21
Average standard deviation of split frequencies: 0.009283
650500 -- (-554.487) [-550.914] (-554.537) (-553.939) * (-551.440) (-554.685) [-550.938] (-551.432) -- 0:00:20
651000 -- [-552.300] (-553.824) (-553.776) (-552.715) * [-550.333] (-552.399) (-552.251) (-552.150) -- 0:00:20
651500 -- (-551.499) [-553.253] (-552.132) (-552.042) * (-550.327) (-550.999) [-550.301] (-553.234) -- 0:00:20
652000 -- [-552.350] (-550.278) (-551.846) (-552.831) * (-551.454) (-551.445) (-554.973) [-552.086] -- 0:00:20
652500 -- (-552.361) (-550.944) (-550.732) [-552.089] * (-551.336) (-551.321) (-550.863) [-551.768] -- 0:00:20
653000 -- (-552.597) (-551.074) [-550.712] (-552.299) * (-552.695) [-550.395] (-550.515) (-551.495) -- 0:00:20
653500 -- (-551.561) [-550.457] (-551.756) (-551.168) * [-552.760] (-551.333) (-551.189) (-551.728) -- 0:00:20
654000 -- (-552.999) (-555.730) (-551.008) [-550.834] * (-551.643) (-553.740) (-552.630) [-551.150] -- 0:00:20
654500 -- (-552.955) (-556.990) [-551.955] (-551.860) * (-551.748) [-552.084] (-551.694) (-552.222) -- 0:00:20
655000 -- [-552.095] (-557.302) (-553.462) (-552.278) * (-553.733) (-551.200) (-552.714) [-551.352] -- 0:00:20
Average standard deviation of split frequencies: 0.009701
655500 -- (-551.181) [-550.611] (-554.906) (-550.639) * (-553.669) (-551.305) (-555.146) [-552.144] -- 0:00:20
656000 -- [-550.414] (-552.725) (-555.486) (-550.770) * [-552.713] (-560.548) (-555.443) (-551.036) -- 0:00:20
656500 -- (-555.466) [-557.413] (-557.668) (-551.287) * (-552.214) [-551.764] (-553.961) (-551.905) -- 0:00:20
657000 -- (-551.810) (-551.872) (-552.634) [-552.719] * (-552.515) (-561.315) (-552.095) [-552.031] -- 0:00:20
657500 -- (-555.441) (-552.762) (-553.820) [-551.095] * (-550.607) (-555.439) [-552.055] (-551.368) -- 0:00:20
658000 -- (-553.305) (-553.692) (-552.579) [-552.296] * [-553.625] (-551.866) (-552.876) (-553.252) -- 0:00:20
658500 -- [-552.152] (-551.473) (-553.860) (-552.008) * [-553.913] (-552.585) (-555.570) (-552.644) -- 0:00:20
659000 -- (-551.844) (-552.944) [-553.966] (-557.550) * (-553.984) [-555.027] (-553.750) (-555.754) -- 0:00:20
659500 -- (-553.785) [-554.633] (-551.348) (-556.031) * (-552.188) (-551.575) [-552.462] (-552.280) -- 0:00:20
660000 -- (-552.372) (-552.390) [-551.654] (-551.074) * (-551.890) (-552.440) [-551.446] (-550.111) -- 0:00:20
Average standard deviation of split frequencies: 0.009410
660500 -- [-550.391] (-550.914) (-551.739) (-550.874) * (-552.315) (-551.382) [-551.865] (-550.675) -- 0:00:20
661000 -- (-552.286) [-551.828] (-552.435) (-551.124) * (-553.647) (-552.268) (-552.630) [-552.347] -- 0:00:20
661500 -- (-552.187) (-551.966) (-552.148) [-553.811] * (-559.055) [-550.392] (-551.078) (-551.722) -- 0:00:20
662000 -- (-551.617) [-551.550] (-554.246) (-552.389) * (-550.458) (-551.634) [-553.501] (-553.457) -- 0:00:20
662500 -- [-551.822] (-550.829) (-553.248) (-554.215) * (-558.829) [-551.155] (-551.798) (-553.131) -- 0:00:20
663000 -- [-552.549] (-553.722) (-553.489) (-557.065) * (-554.835) (-554.030) [-553.056] (-554.542) -- 0:00:20
663500 -- (-550.001) (-553.650) (-553.250) [-552.223] * (-550.446) (-554.714) [-551.545] (-552.172) -- 0:00:20
664000 -- (-550.389) [-551.534] (-553.554) (-551.527) * [-552.177] (-554.117) (-551.915) (-551.849) -- 0:00:20
664500 -- (-552.754) (-553.205) (-551.026) [-553.089] * [-553.357] (-551.648) (-555.956) (-551.719) -- 0:00:20
665000 -- (-552.961) (-557.382) [-552.895] (-552.745) * (-553.783) (-553.894) [-555.728] (-553.757) -- 0:00:20
Average standard deviation of split frequencies: 0.009290
665500 -- [-552.366] (-554.976) (-551.478) (-554.392) * [-550.510] (-552.366) (-553.765) (-551.968) -- 0:00:20
666000 -- (-552.117) [-552.046] (-552.864) (-556.239) * [-553.389] (-555.487) (-553.615) (-550.253) -- 0:00:20
666500 -- (-552.562) (-557.808) [-550.889] (-559.161) * (-556.841) [-553.699] (-551.008) (-551.539) -- 0:00:20
667000 -- [-551.912] (-551.238) (-553.740) (-552.887) * (-551.507) (-551.079) [-554.856] (-552.187) -- 0:00:19
667500 -- [-552.818] (-550.290) (-556.185) (-551.639) * (-553.085) (-551.479) [-552.368] (-550.785) -- 0:00:19
668000 -- [-550.189] (-553.723) (-553.385) (-551.201) * [-552.344] (-554.092) (-553.147) (-550.895) -- 0:00:19
668500 -- (-551.753) (-552.301) [-550.696] (-552.459) * (-554.049) (-552.229) (-551.160) [-551.016] -- 0:00:19
669000 -- [-550.944] (-551.645) (-551.679) (-552.130) * (-553.561) (-550.579) (-550.706) [-551.417] -- 0:00:19
669500 -- [-553.197] (-553.950) (-551.302) (-552.688) * (-554.647) (-551.179) [-550.919] (-551.317) -- 0:00:19
670000 -- (-552.261) (-552.174) (-552.576) [-550.297] * (-550.653) (-553.070) [-550.864] (-559.958) -- 0:00:19
Average standard deviation of split frequencies: 0.009138
670500 -- (-551.628) [-550.872] (-551.793) (-551.970) * (-551.131) (-554.756) (-553.480) [-551.181] -- 0:00:19
671000 -- (-552.941) (-552.643) [-551.215] (-553.231) * (-551.353) (-553.411) [-551.678] (-554.857) -- 0:00:19
671500 -- [-551.006] (-554.304) (-552.601) (-552.160) * (-554.258) [-550.235] (-551.403) (-551.988) -- 0:00:19
672000 -- [-550.932] (-558.858) (-551.207) (-556.924) * (-552.648) (-551.125) (-551.847) [-554.021] -- 0:00:19
672500 -- [-551.466] (-556.427) (-556.289) (-551.278) * (-552.506) (-550.113) (-553.048) [-551.434] -- 0:00:19
673000 -- [-551.073] (-553.228) (-557.403) (-550.557) * (-550.156) (-550.063) [-553.444] (-553.959) -- 0:00:19
673500 -- (-552.548) [-551.033] (-554.120) (-550.614) * (-551.151) (-553.030) (-558.071) [-551.224] -- 0:00:19
674000 -- (-550.645) (-550.791) (-553.087) [-551.386] * [-552.380] (-554.039) (-552.796) (-552.556) -- 0:00:19
674500 -- [-555.305] (-550.887) (-553.586) (-550.512) * [-551.292] (-555.495) (-551.269) (-550.011) -- 0:00:19
675000 -- (-559.631) (-550.713) [-550.561] (-550.348) * (-551.888) [-552.496] (-551.817) (-550.011) -- 0:00:19
Average standard deviation of split frequencies: 0.008891
675500 -- [-553.254] (-551.531) (-550.750) (-553.551) * (-551.805) (-553.216) [-551.599] (-552.289) -- 0:00:19
676000 -- (-553.889) (-552.814) [-552.111] (-552.686) * (-553.249) (-554.853) (-550.587) [-550.530] -- 0:00:19
676500 -- [-553.022] (-554.345) (-554.307) (-552.235) * (-551.766) (-550.635) [-551.564] (-553.641) -- 0:00:19
677000 -- [-554.619] (-553.621) (-551.740) (-553.316) * (-555.647) (-551.706) (-550.510) [-551.239] -- 0:00:19
677500 -- (-553.787) [-550.762] (-551.114) (-553.576) * (-551.607) [-551.168] (-552.170) (-553.490) -- 0:00:19
678000 -- (-553.482) (-553.325) [-550.603] (-552.737) * (-554.624) [-551.520] (-551.062) (-552.018) -- 0:00:19
678500 -- (-553.288) (-552.759) [-552.101] (-554.378) * (-552.004) [-551.534] (-550.053) (-553.757) -- 0:00:19
679000 -- (-555.803) (-552.753) (-551.424) [-552.494] * (-553.476) (-551.226) [-554.794] (-555.714) -- 0:00:19
679500 -- (-553.080) [-552.072] (-556.510) (-555.477) * (-552.790) (-551.278) (-551.129) [-551.913] -- 0:00:19
680000 -- (-559.778) (-557.355) (-551.328) [-554.740] * (-554.520) (-555.338) [-550.709] (-551.808) -- 0:00:19
Average standard deviation of split frequencies: 0.008744
680500 -- [-556.254] (-552.290) (-553.284) (-555.642) * (-552.003) [-553.816] (-550.742) (-551.559) -- 0:00:19
681000 -- [-552.540] (-552.195) (-550.673) (-555.186) * (-553.110) [-551.808] (-551.334) (-554.104) -- 0:00:19
681500 -- (-554.787) (-555.783) [-554.175] (-554.375) * (-553.452) (-552.777) (-553.163) [-551.366] -- 0:00:19
682000 -- (-552.012) [-554.279] (-553.266) (-551.665) * (-553.913) (-555.980) (-553.151) [-552.897] -- 0:00:19
682500 -- (-554.471) (-556.526) (-553.823) [-553.160] * (-553.027) (-553.147) [-550.964] (-554.616) -- 0:00:19
683000 -- [-551.039] (-551.531) (-554.023) (-555.030) * [-551.711] (-552.811) (-554.609) (-556.563) -- 0:00:19
683500 -- (-552.908) (-552.274) [-550.731] (-553.554) * (-552.519) (-552.675) [-550.798] (-557.586) -- 0:00:18
684000 -- (-551.142) [-552.756] (-550.544) (-553.640) * (-553.557) (-550.291) [-552.041] (-552.787) -- 0:00:18
684500 -- (-553.433) [-557.294] (-550.962) (-551.467) * (-554.569) (-552.044) [-554.089] (-551.365) -- 0:00:18
685000 -- (-555.348) (-559.303) (-550.445) [-550.237] * [-552.406] (-552.792) (-550.729) (-552.229) -- 0:00:18
Average standard deviation of split frequencies: 0.008719
685500 -- (-552.616) (-553.660) (-550.835) [-550.599] * [-552.041] (-555.133) (-550.625) (-551.638) -- 0:00:18
686000 -- (-550.458) (-552.109) (-550.305) [-553.929] * (-552.727) (-552.973) (-556.693) [-554.247] -- 0:00:18
686500 -- [-551.298] (-552.455) (-551.376) (-554.666) * (-551.067) [-551.851] (-553.867) (-556.923) -- 0:00:18
687000 -- [-552.656] (-555.984) (-552.547) (-551.694) * (-552.893) [-552.056] (-555.396) (-552.048) -- 0:00:19
687500 -- (-552.250) [-552.584] (-552.572) (-551.838) * (-552.201) (-552.810) (-555.056) [-551.821] -- 0:00:19
688000 -- (-559.114) (-553.172) (-551.382) [-550.389] * (-552.186) [-550.846] (-557.145) (-551.112) -- 0:00:19
688500 -- [-550.900] (-550.510) (-556.671) (-552.034) * (-552.064) [-553.155] (-551.418) (-550.800) -- 0:00:19
689000 -- (-551.498) [-551.799] (-552.916) (-553.694) * (-552.775) (-553.818) [-554.149] (-550.818) -- 0:00:18
689500 -- (-551.293) [-550.871] (-552.666) (-552.317) * (-552.705) (-552.901) [-552.805] (-552.085) -- 0:00:18
690000 -- (-551.554) [-555.455] (-555.931) (-552.252) * [-551.225] (-555.104) (-552.065) (-560.258) -- 0:00:18
Average standard deviation of split frequencies: 0.009129
690500 -- [-555.517] (-552.657) (-554.863) (-551.432) * (-550.274) (-552.066) [-552.228] (-554.302) -- 0:00:18
691000 -- (-553.673) (-551.477) [-553.574] (-553.434) * (-550.441) [-551.922] (-551.065) (-551.952) -- 0:00:18
691500 -- (-553.261) [-551.492] (-555.365) (-551.167) * (-551.506) [-551.309] (-553.735) (-553.923) -- 0:00:18
692000 -- [-552.413] (-553.740) (-553.745) (-551.702) * (-551.356) [-555.919] (-550.907) (-551.131) -- 0:00:18
692500 -- (-552.034) [-554.032] (-552.923) (-553.195) * (-556.286) (-551.005) (-550.764) [-550.739] -- 0:00:18
693000 -- (-550.890) [-551.448] (-551.810) (-553.291) * (-551.659) (-551.354) (-560.149) [-551.154] -- 0:00:18
693500 -- (-553.606) (-552.550) (-555.917) [-551.303] * (-552.000) [-549.964] (-559.790) (-551.708) -- 0:00:18
694000 -- [-552.675] (-550.157) (-551.820) (-551.404) * (-553.645) [-553.358] (-556.776) (-550.925) -- 0:00:18
694500 -- [-551.631] (-550.415) (-554.903) (-551.549) * (-552.860) [-550.797] (-550.841) (-553.612) -- 0:00:18
695000 -- (-550.936) [-553.102] (-556.061) (-553.196) * (-554.427) (-552.061) [-551.745] (-554.000) -- 0:00:18
Average standard deviation of split frequencies: 0.009398
695500 -- [-550.724] (-555.758) (-552.088) (-550.669) * [-552.937] (-552.515) (-551.156) (-553.967) -- 0:00:18
696000 -- (-552.388) (-552.704) (-551.955) [-552.469] * (-551.338) (-551.014) [-551.881] (-551.223) -- 0:00:18
696500 -- (-551.026) [-551.188] (-551.333) (-551.600) * (-551.427) (-551.407) [-551.923] (-550.687) -- 0:00:18
697000 -- [-551.597] (-553.350) (-550.654) (-551.126) * [-550.709] (-554.057) (-551.566) (-552.771) -- 0:00:18
697500 -- [-551.457] (-552.082) (-551.079) (-554.235) * (-551.863) (-551.469) [-551.056] (-555.588) -- 0:00:18
698000 -- (-551.629) [-552.231] (-554.000) (-553.480) * [-553.746] (-551.005) (-550.174) (-551.420) -- 0:00:18
698500 -- (-554.188) (-551.925) [-556.769] (-550.146) * (-552.428) (-550.745) [-551.685] (-552.147) -- 0:00:18
699000 -- (-554.529) (-551.547) (-552.374) [-551.500] * [-551.356] (-551.684) (-551.763) (-550.976) -- 0:00:18
699500 -- [-551.651] (-552.141) (-551.130) (-554.930) * [-551.389] (-552.222) (-550.898) (-552.050) -- 0:00:18
700000 -- [-553.063] (-550.748) (-552.644) (-550.662) * (-552.316) (-552.486) (-552.740) [-551.015] -- 0:00:18
Average standard deviation of split frequencies: 0.010008
700500 -- (-552.307) (-550.774) (-552.514) [-550.540] * (-553.624) (-551.212) [-551.463] (-550.513) -- 0:00:17
701000 -- (-551.236) (-552.799) [-552.182] (-553.963) * [-550.612] (-553.661) (-552.186) (-551.782) -- 0:00:17
701500 -- [-552.571] (-551.033) (-551.533) (-552.684) * (-550.458) [-550.337] (-551.833) (-553.563) -- 0:00:17
702000 -- (-554.452) [-554.677] (-552.257) (-554.452) * (-551.798) (-550.513) [-551.604] (-554.583) -- 0:00:18
702500 -- [-551.421] (-555.260) (-552.309) (-552.028) * [-554.006] (-552.080) (-553.496) (-556.373) -- 0:00:18
703000 -- (-552.409) (-551.766) [-550.890] (-554.704) * (-550.827) (-551.259) [-552.342] (-552.305) -- 0:00:18
703500 -- (-551.656) (-552.474) [-553.208] (-552.419) * (-551.208) [-550.634] (-554.707) (-550.940) -- 0:00:18
704000 -- (-556.256) [-552.293] (-555.160) (-550.798) * (-551.806) [-552.273] (-552.503) (-550.633) -- 0:00:18
704500 -- [-550.690] (-554.431) (-554.277) (-555.764) * (-551.393) (-559.000) (-553.429) [-551.753] -- 0:00:18
705000 -- (-550.913) [-552.258] (-553.395) (-553.750) * [-552.088] (-551.581) (-554.337) (-551.905) -- 0:00:17
Average standard deviation of split frequencies: 0.010016
705500 -- (-552.036) (-551.250) (-552.759) [-551.976] * (-555.748) [-552.709] (-551.317) (-550.605) -- 0:00:17
706000 -- (-554.399) (-552.256) [-553.584] (-553.034) * (-552.688) (-555.103) [-550.769] (-552.320) -- 0:00:17
706500 -- (-557.224) (-550.949) (-550.851) [-552.348] * (-553.224) (-554.405) (-550.078) [-550.614] -- 0:00:17
707000 -- [-552.105] (-553.214) (-551.214) (-550.564) * (-551.531) (-550.832) [-550.776] (-550.839) -- 0:00:17
707500 -- [-553.119] (-551.339) (-555.439) (-555.098) * (-550.840) (-551.688) (-550.127) [-553.325] -- 0:00:17
708000 -- (-551.860) [-551.271] (-554.632) (-552.286) * (-552.686) [-551.012] (-552.969) (-556.608) -- 0:00:17
708500 -- (-559.371) [-550.899] (-560.084) (-551.721) * (-552.914) (-551.002) (-551.325) [-555.903] -- 0:00:17
709000 -- (-559.904) [-551.555] (-552.560) (-552.324) * (-550.481) (-549.990) [-551.670] (-554.015) -- 0:00:17
709500 -- (-552.608) [-551.735] (-552.545) (-557.678) * [-552.655] (-551.714) (-551.067) (-554.571) -- 0:00:17
710000 -- [-551.808] (-550.632) (-552.126) (-552.619) * [-552.137] (-553.443) (-551.502) (-554.202) -- 0:00:17
Average standard deviation of split frequencies: 0.010033
710500 -- (-551.041) (-552.267) [-550.637] (-551.809) * (-552.306) [-552.484] (-550.727) (-553.295) -- 0:00:17
711000 -- (-551.079) (-552.944) [-551.982] (-553.380) * (-553.330) (-552.986) (-550.524) [-552.161] -- 0:00:17
711500 -- (-550.494) [-551.815] (-551.327) (-550.270) * [-551.491] (-552.540) (-552.993) (-553.046) -- 0:00:17
712000 -- (-550.766) (-551.768) (-550.394) [-551.553] * [-550.859] (-552.181) (-559.398) (-551.119) -- 0:00:17
712500 -- (-559.085) [-554.380] (-553.112) (-554.220) * (-552.351) [-550.733] (-552.664) (-554.047) -- 0:00:17
713000 -- [-551.855] (-553.644) (-555.346) (-551.310) * (-551.825) (-550.550) [-551.449] (-551.923) -- 0:00:17
713500 -- (-550.943) [-551.656] (-557.327) (-551.654) * (-552.917) (-551.753) [-551.624] (-557.422) -- 0:00:17
714000 -- [-550.294] (-551.960) (-551.484) (-550.679) * (-550.205) (-550.576) (-554.164) [-551.109] -- 0:00:17
714500 -- (-550.684) (-553.703) (-551.708) [-549.949] * (-553.487) (-553.745) [-550.043] (-553.926) -- 0:00:17
715000 -- [-550.534] (-551.747) (-552.153) (-550.291) * (-552.120) (-558.574) [-553.285] (-551.843) -- 0:00:17
Average standard deviation of split frequencies: 0.009752
715500 -- [-553.737] (-552.288) (-553.170) (-550.795) * (-552.416) [-554.059] (-552.057) (-552.700) -- 0:00:17
716000 -- (-551.724) [-553.652] (-557.497) (-553.045) * (-551.360) (-552.675) (-553.430) [-558.220] -- 0:00:17
716500 -- (-552.575) (-552.631) [-552.022] (-554.071) * (-552.569) [-551.292] (-552.440) (-551.260) -- 0:00:17
717000 -- (-550.444) (-555.031) [-551.324] (-554.349) * (-552.005) (-552.526) [-551.667] (-551.683) -- 0:00:17
717500 -- [-552.086] (-552.256) (-550.673) (-555.419) * (-553.252) (-550.857) [-551.653] (-553.516) -- 0:00:17
718000 -- (-553.778) (-550.970) (-551.889) [-552.143] * (-554.573) (-551.082) [-551.664] (-551.249) -- 0:00:17
718500 -- [-556.493] (-552.253) (-552.938) (-554.907) * (-553.353) (-553.796) (-551.743) [-551.192] -- 0:00:17
719000 -- (-553.955) [-550.475] (-551.472) (-555.860) * [-550.856] (-552.841) (-550.062) (-550.710) -- 0:00:17
719500 -- (-550.159) [-551.330] (-552.552) (-554.216) * (-553.548) (-551.121) (-553.784) [-553.612] -- 0:00:17
720000 -- (-553.511) (-555.408) (-550.030) [-553.070] * [-552.829] (-551.697) (-555.474) (-556.421) -- 0:00:17
Average standard deviation of split frequencies: 0.009648
720500 -- (-550.158) (-553.663) (-550.314) [-550.763] * (-551.902) (-554.007) (-552.491) [-557.419] -- 0:00:17
721000 -- (-555.002) (-551.974) [-550.307] (-550.781) * (-550.718) [-552.244] (-552.857) (-552.653) -- 0:00:17
721500 -- (-550.286) (-551.640) [-550.414] (-552.630) * [-550.275] (-552.588) (-552.107) (-552.541) -- 0:00:16
722000 -- [-550.191] (-551.425) (-552.281) (-551.306) * [-550.649] (-554.823) (-551.114) (-550.916) -- 0:00:16
722500 -- [-552.829] (-551.336) (-551.263) (-550.538) * (-550.507) (-553.346) [-551.616] (-552.749) -- 0:00:16
723000 -- [-551.780] (-553.724) (-552.519) (-552.812) * (-553.832) (-550.426) (-552.122) [-552.126] -- 0:00:16
723500 -- (-552.608) (-552.758) (-551.046) [-553.080] * (-555.268) (-550.028) [-551.842] (-550.560) -- 0:00:16
724000 -- [-552.394] (-552.559) (-551.158) (-560.088) * (-552.439) [-553.106] (-550.887) (-553.112) -- 0:00:16
724500 -- (-551.802) [-551.188] (-551.488) (-551.269) * (-553.958) [-554.056] (-550.604) (-552.644) -- 0:00:16
725000 -- (-551.494) [-551.562] (-551.458) (-550.505) * [-553.644] (-552.028) (-550.760) (-554.728) -- 0:00:16
Average standard deviation of split frequencies: 0.009293
725500 -- (-550.588) [-553.240] (-557.189) (-552.720) * (-556.282) [-551.728] (-551.995) (-556.862) -- 0:00:16
726000 -- (-553.295) [-553.189] (-550.944) (-551.221) * (-552.324) (-550.857) [-551.618] (-551.397) -- 0:00:16
726500 -- (-551.624) (-552.928) [-550.999] (-554.225) * (-551.844) [-552.154] (-551.171) (-550.346) -- 0:00:16
727000 -- (-550.685) (-550.322) [-551.651] (-550.923) * (-552.609) (-553.129) (-550.721) [-559.233] -- 0:00:16
727500 -- (-557.088) [-551.826] (-553.714) (-552.825) * (-551.306) (-550.348) (-552.934) [-552.199] -- 0:00:16
728000 -- (-551.374) [-553.076] (-555.148) (-550.604) * (-551.741) [-553.555] (-551.699) (-551.373) -- 0:00:16
728500 -- (-553.507) (-552.798) (-556.122) [-550.517] * [-550.200] (-556.633) (-551.675) (-551.835) -- 0:00:16
729000 -- (-554.682) (-553.909) [-554.119] (-552.450) * [-550.674] (-551.196) (-558.309) (-554.537) -- 0:00:16
729500 -- [-552.278] (-551.961) (-552.764) (-552.039) * [-553.659] (-554.182) (-558.743) (-552.970) -- 0:00:16
730000 -- [-552.865] (-551.800) (-556.746) (-554.539) * [-550.362] (-551.437) (-551.860) (-553.850) -- 0:00:16
Average standard deviation of split frequencies: 0.009799
730500 -- (-552.547) (-552.296) (-557.399) [-550.494] * [-550.156] (-551.992) (-552.608) (-550.337) -- 0:00:16
731000 -- [-551.482] (-552.275) (-553.555) (-553.127) * (-553.013) (-552.060) [-552.964] (-551.416) -- 0:00:16
731500 -- (-557.602) [-552.556] (-552.914) (-551.330) * (-553.637) (-552.494) (-551.445) [-551.310] -- 0:00:16
732000 -- (-553.645) (-551.302) (-552.092) [-550.665] * (-553.472) (-556.509) [-551.489] (-551.330) -- 0:00:16
732500 -- (-551.727) (-552.734) [-553.852] (-551.133) * (-552.345) (-552.957) [-552.689] (-552.586) -- 0:00:16
733000 -- (-553.346) (-555.452) (-554.855) [-551.064] * (-552.177) (-553.223) (-556.202) [-551.673] -- 0:00:16
733500 -- (-550.587) (-553.381) [-551.468] (-551.274) * (-556.860) (-553.802) [-550.849] (-553.109) -- 0:00:16
734000 -- (-552.191) (-550.405) [-552.618] (-554.402) * (-555.216) (-565.638) [-553.311] (-553.238) -- 0:00:16
734500 -- [-550.376] (-552.007) (-550.936) (-552.299) * [-552.090] (-561.355) (-550.521) (-556.913) -- 0:00:16
735000 -- (-551.431) (-554.875) [-556.675] (-552.027) * [-553.459] (-553.235) (-551.385) (-550.879) -- 0:00:16
Average standard deviation of split frequencies: 0.009487
735500 -- (-550.503) [-553.201] (-557.866) (-552.072) * (-553.073) (-554.576) [-550.907] (-554.119) -- 0:00:16
736000 -- (-554.057) [-551.865] (-551.967) (-554.153) * (-550.886) (-553.616) [-552.792] (-551.943) -- 0:00:16
736500 -- (-553.403) (-553.735) [-550.922] (-551.073) * (-554.719) [-550.804] (-552.719) (-551.214) -- 0:00:16
737000 -- (-552.013) (-551.075) [-554.211] (-550.733) * (-554.635) (-553.547) (-551.297) [-552.236] -- 0:00:16
737500 -- [-551.429] (-550.943) (-553.795) (-551.213) * (-550.844) (-550.609) [-554.430] (-550.621) -- 0:00:16
738000 -- (-551.247) (-558.237) [-557.132] (-552.247) * (-550.027) [-554.685] (-554.615) (-551.858) -- 0:00:15
738500 -- (-551.294) (-552.097) [-553.178] (-552.326) * (-552.082) [-551.747] (-552.643) (-554.823) -- 0:00:15
739000 -- (-555.239) [-551.807] (-553.511) (-551.908) * (-551.298) [-555.220] (-554.924) (-554.964) -- 0:00:15
739500 -- (-551.340) (-552.952) [-551.015] (-550.299) * [-551.089] (-552.477) (-553.073) (-553.824) -- 0:00:15
740000 -- (-550.487) [-553.723] (-549.912) (-553.325) * (-551.778) [-550.743] (-551.286) (-556.092) -- 0:00:15
Average standard deviation of split frequencies: 0.009507
740500 -- [-551.102] (-553.126) (-552.380) (-552.820) * (-553.460) [-551.672] (-552.923) (-557.104) -- 0:00:15
741000 -- (-553.329) (-553.130) [-553.223] (-554.394) * (-550.898) (-552.099) [-552.910] (-551.882) -- 0:00:15
741500 -- (-550.714) (-552.067) [-553.219] (-550.969) * (-555.216) (-552.761) (-552.021) [-551.055] -- 0:00:15
742000 -- (-551.418) (-550.376) (-552.820) [-551.125] * (-555.305) [-551.619] (-552.352) (-550.059) -- 0:00:15
742500 -- (-551.830) (-553.311) [-550.917] (-552.626) * (-551.526) [-550.897] (-552.164) (-553.456) -- 0:00:15
743000 -- (-551.097) (-556.052) (-550.977) [-554.082] * (-553.855) [-551.510] (-551.608) (-551.063) -- 0:00:15
743500 -- [-552.368] (-556.082) (-551.791) (-553.854) * (-554.361) [-552.518] (-552.639) (-559.940) -- 0:00:15
744000 -- (-556.577) (-557.943) (-551.409) [-550.281] * (-555.284) [-550.280] (-555.614) (-550.624) -- 0:00:15
744500 -- (-557.464) (-553.216) [-551.220] (-550.736) * [-551.591] (-550.469) (-552.931) (-551.950) -- 0:00:15
745000 -- [-551.737] (-556.077) (-556.005) (-560.479) * [-551.769] (-551.391) (-550.896) (-550.857) -- 0:00:15
Average standard deviation of split frequencies: 0.009637
745500 -- (-555.342) (-550.783) [-551.667] (-558.820) * (-550.167) (-555.103) [-552.689] (-553.565) -- 0:00:15
746000 -- (-553.070) [-553.086] (-551.125) (-551.420) * (-558.916) [-555.349] (-552.359) (-553.320) -- 0:00:15
746500 -- [-551.133] (-554.972) (-551.045) (-556.666) * (-552.231) [-551.771] (-557.440) (-551.856) -- 0:00:15
747000 -- [-551.544] (-551.279) (-550.558) (-555.164) * (-550.479) [-552.641] (-553.506) (-553.089) -- 0:00:15
747500 -- (-558.952) [-550.890] (-550.597) (-551.927) * (-554.021) (-553.988) (-552.715) [-552.909] -- 0:00:15
748000 -- (-551.420) [-550.638] (-555.907) (-554.550) * (-553.913) (-551.490) [-554.436] (-553.438) -- 0:00:15
748500 -- (-551.311) [-553.500] (-558.730) (-553.380) * [-553.142] (-551.331) (-554.314) (-566.584) -- 0:00:15
749000 -- [-555.338] (-550.158) (-555.656) (-551.743) * [-558.222] (-551.553) (-553.386) (-552.566) -- 0:00:15
749500 -- (-554.083) (-551.033) (-557.142) [-551.280] * [-558.142] (-553.758) (-551.676) (-557.662) -- 0:00:15
750000 -- [-555.633] (-558.646) (-553.739) (-552.634) * (-552.181) [-551.435] (-552.273) (-553.453) -- 0:00:15
Average standard deviation of split frequencies: 0.009066
750500 -- (-554.806) (-558.211) [-552.742] (-554.922) * (-551.714) (-552.598) (-553.042) [-552.003] -- 0:00:15
751000 -- (-554.072) [-551.349] (-551.070) (-553.833) * (-555.625) [-552.953] (-552.420) (-551.146) -- 0:00:15
751500 -- [-550.251] (-550.181) (-551.503) (-550.645) * [-554.000] (-551.953) (-553.224) (-551.843) -- 0:00:15
752000 -- (-554.537) (-550.221) [-551.533] (-553.012) * [-553.326] (-552.756) (-550.955) (-553.370) -- 0:00:15
752500 -- (-551.720) (-551.945) [-552.437] (-552.937) * (-550.364) (-550.272) [-553.719] (-551.594) -- 0:00:15
753000 -- (-551.388) [-551.685] (-553.130) (-550.266) * (-550.382) (-551.220) [-551.039] (-550.650) -- 0:00:15
753500 -- (-555.647) (-554.178) [-551.605] (-551.421) * (-551.414) [-551.126] (-555.159) (-550.747) -- 0:00:15
754000 -- (-552.175) (-552.060) (-551.796) [-552.182] * (-550.530) [-550.523] (-554.127) (-554.805) -- 0:00:15
754500 -- (-554.100) (-550.728) [-551.339] (-550.522) * (-551.636) (-551.697) [-552.202] (-551.525) -- 0:00:14
755000 -- [-551.224] (-552.473) (-551.494) (-553.051) * (-551.300) [-554.034] (-550.250) (-552.037) -- 0:00:14
Average standard deviation of split frequencies: 0.009236
755500 -- (-553.187) [-551.655] (-553.013) (-550.889) * (-555.069) [-553.392] (-550.772) (-551.117) -- 0:00:14
756000 -- (-554.417) (-551.175) (-551.727) [-550.649] * (-554.321) [-551.570] (-551.170) (-565.164) -- 0:00:14
756500 -- (-553.253) (-552.028) [-551.274] (-553.921) * (-550.492) [-551.169] (-553.339) (-551.164) -- 0:00:14
757000 -- (-553.077) (-552.530) (-550.614) [-551.564] * (-550.770) (-552.494) (-552.153) [-550.680] -- 0:00:14
757500 -- [-552.325] (-553.734) (-552.384) (-550.779) * [-553.405] (-554.154) (-550.860) (-551.884) -- 0:00:14
758000 -- (-551.079) (-553.526) (-551.573) [-550.705] * (-552.263) [-551.952] (-550.832) (-551.132) -- 0:00:14
758500 -- (-551.185) [-551.009] (-550.820) (-552.048) * [-552.870] (-550.412) (-555.274) (-555.739) -- 0:00:14
759000 -- [-551.333] (-550.668) (-550.628) (-550.205) * (-553.024) (-550.254) [-551.935] (-553.521) -- 0:00:14
759500 -- (-552.318) (-553.002) [-554.625] (-549.840) * (-555.035) [-553.530] (-550.176) (-550.779) -- 0:00:14
760000 -- [-552.140] (-550.885) (-557.492) (-552.049) * [-551.638] (-554.976) (-551.287) (-550.682) -- 0:00:14
Average standard deviation of split frequencies: 0.008986
760500 -- [-556.429] (-551.507) (-557.489) (-551.644) * (-551.795) (-551.399) (-555.092) [-550.824] -- 0:00:14
761000 -- (-551.133) [-553.000] (-554.240) (-551.175) * (-553.338) [-552.242] (-554.486) (-550.358) -- 0:00:14
761500 -- (-553.771) (-552.586) (-550.878) [-551.676] * [-552.883] (-554.362) (-554.014) (-551.968) -- 0:00:14
762000 -- (-552.521) (-553.153) [-552.116] (-550.350) * [-552.858] (-551.616) (-555.300) (-555.318) -- 0:00:14
762500 -- (-552.416) (-553.004) [-553.326] (-550.165) * (-551.528) (-550.866) (-554.629) [-556.291] -- 0:00:14
763000 -- [-552.599] (-554.374) (-550.843) (-551.063) * [-552.239] (-551.263) (-550.842) (-554.736) -- 0:00:14
763500 -- [-551.906] (-553.638) (-550.286) (-553.600) * [-557.409] (-555.052) (-551.399) (-550.344) -- 0:00:14
764000 -- [-550.493] (-551.654) (-550.654) (-556.260) * (-555.438) (-553.162) [-554.197] (-551.195) -- 0:00:14
764500 -- [-550.458] (-551.511) (-553.805) (-553.859) * (-552.531) (-553.338) (-551.238) [-553.862] -- 0:00:14
765000 -- [-551.857] (-554.088) (-550.999) (-552.747) * (-553.542) (-553.038) (-551.796) [-551.903] -- 0:00:14
Average standard deviation of split frequ 