--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:05:12 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0284/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -551.53 -554.31
2 -551.50 -555.13
--------------------------------------
TOTAL -551.51 -554.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891099 0.085157 0.354771 1.461019 0.859373 1401.74 1433.31 1.001
r(A<->C){all} 0.152921 0.017405 0.000056 0.417120 0.118443 157.04 300.20 1.000
r(A<->G){all} 0.171165 0.020419 0.000083 0.454439 0.135067 235.37 272.74 1.004
r(A<->T){all} 0.168221 0.018735 0.000027 0.438747 0.131900 221.56 254.43 1.000
r(C<->G){all} 0.169653 0.018371 0.000064 0.425878 0.140459 192.48 216.55 1.007
r(C<->T){all} 0.173672 0.021382 0.000072 0.472730 0.134667 192.13 209.08 1.001
r(G<->T){all} 0.164369 0.019750 0.000082 0.442822 0.125588 123.42 199.08 1.002
pi(A){all} 0.168229 0.000325 0.132373 0.201489 0.167631 1311.35 1406.17 1.000
pi(C){all} 0.327690 0.000538 0.278631 0.369461 0.327444 1143.03 1264.62 1.000
pi(G){all} 0.326469 0.000519 0.281070 0.369079 0.326103 1328.99 1415.00 1.000
pi(T){all} 0.177611 0.000332 0.143029 0.212975 0.176994 1037.69 1228.21 1.000
alpha{1,2} 0.396958 0.199618 0.000232 1.356336 0.229981 1170.45 1335.73 1.000
alpha{3} 0.463562 0.245638 0.000175 1.490978 0.300774 1197.90 1211.78 1.000
pinvar{all} 0.996079 0.000022 0.987309 0.999994 0.997570 1233.56 1244.90 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -531.169624
Model 2: PositiveSelection -531.169576
Model 0: one-ratio -531.169617
Model 7: beta -531.169661
Model 8: beta&w>1 -531.169651
Model 0 vs 1 1.3999999964653398E-5
Model 2 vs 1 9.599999998499698E-5
Model 8 vs 7 1.9999999949504854E-5
>C1
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C2
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C3
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C4
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C5
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C6
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=137
C1 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C2 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C3 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C4 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C5 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C6 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
**************************************************
C1 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C2 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C3 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C4 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C5 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C6 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
**************************************************
C1 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C2 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C3 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C4 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C5 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C6 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
*************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 137 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 137 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4110]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4110]--->[4110]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.668 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C2 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C3 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C4 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C5 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
C6 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
**************************************************
C1 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C2 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C3 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C4 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C5 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
C6 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
**************************************************
C1 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C2 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C3 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C4 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C5 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
C6 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
*************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C2 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C3 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C4 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C5 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
C6 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
**************************************************
C1 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C2 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C3 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C4 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C5 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
C6 TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
**************************************************
C1 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C2 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C3 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C4 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C5 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
C6 TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
**************************************************
C1 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C2 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C3 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C4 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C5 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
C6 GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
**************************************************
C1 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C2 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C3 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C4 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C5 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
C6 TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
**************************************************
C1 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C2 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C3 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C4 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C5 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
C6 TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
**************************************************
C1 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C2 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C3 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C4 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C5 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
C6 GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
**************************************************
C1 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C2 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C3 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C4 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C5 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
C6 TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
**************************************************
C1 AGCTCGGGCTC
C2 AGCTCGGGCTC
C3 AGCTCGGGCTC
C4 AGCTCGGGCTC
C5 AGCTCGGGCTC
C6 AGCTCGGGCTC
***********
>C1
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C2
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C3
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C4
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C5
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C6
ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA
TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG
TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG
GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC
TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT
TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC
GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA
TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG
AGCTCGGGCTC
>C1
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C2
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C3
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C4
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C5
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
>C6
MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 411 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579799035
Setting output file names to "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1073304123
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0788522640
Seed = 622211566
Swapseed = 1579799035
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -919.837651 -- -24.965149
Chain 2 -- -919.837704 -- -24.965149
Chain 3 -- -919.837564 -- -24.965149
Chain 4 -- -919.837651 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -919.837564 -- -24.965149
Chain 2 -- -919.837704 -- -24.965149
Chain 3 -- -919.837704 -- -24.965149
Chain 4 -- -919.837564 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-919.838] (-919.838) (-919.838) (-919.838) * [-919.838] (-919.838) (-919.838) (-919.838)
500 -- [-556.797] (-562.316) (-576.878) (-579.463) * (-564.325) [-563.707] (-560.074) (-578.208) -- 0:00:00
1000 -- [-562.937] (-564.284) (-566.979) (-561.061) * (-557.505) (-561.600) (-564.505) [-562.852] -- 0:00:00
1500 -- (-559.052) [-558.422] (-562.793) (-572.413) * (-559.875) [-564.741] (-557.683) (-561.867) -- 0:00:00
2000 -- [-560.491] (-559.298) (-563.361) (-568.315) * (-556.172) (-557.141) (-557.384) [-559.495] -- 0:00:00
2500 -- (-563.028) (-560.302) [-560.014] (-556.252) * (-562.197) (-568.468) (-564.651) [-562.147] -- 0:00:00
3000 -- [-563.860] (-566.848) (-559.748) (-560.894) * (-569.420) (-560.824) (-557.168) [-559.767] -- 0:00:00
3500 -- (-565.092) (-557.406) [-556.763] (-558.726) * (-561.162) (-565.214) [-560.909] (-561.881) -- 0:00:00
4000 -- (-556.542) (-569.656) [-555.716] (-565.589) * (-556.986) (-568.727) [-563.284] (-560.454) -- 0:00:00
4500 -- (-563.519) (-567.618) [-564.778] (-564.421) * [-561.781] (-564.043) (-564.602) (-561.648) -- 0:00:00
5000 -- (-558.904) (-558.567) [-558.364] (-558.883) * (-561.689) [-560.132] (-561.459) (-567.667) -- 0:00:00
Average standard deviation of split frequencies: 0.070711
5500 -- (-559.646) (-565.076) (-557.437) [-563.341] * (-565.204) [-564.535] (-559.803) (-562.084) -- 0:00:00
6000 -- [-559.207] (-560.009) (-562.127) (-561.880) * (-558.481) (-567.381) (-559.449) [-556.472] -- 0:02:45
6500 -- (-559.483) (-564.394) (-563.007) [-562.388] * [-564.023] (-576.144) (-562.300) (-563.822) -- 0:02:32
7000 -- [-559.162] (-558.806) (-566.753) (-565.480) * (-560.891) (-564.606) [-564.060] (-570.963) -- 0:02:21
7500 -- (-554.655) (-560.769) [-562.802] (-561.236) * (-559.419) (-555.394) [-560.648] (-559.550) -- 0:02:12
8000 -- [-559.411] (-566.959) (-561.133) (-560.609) * (-567.253) (-551.667) (-562.864) [-561.697] -- 0:02:04
8500 -- (-558.922) (-561.260) (-554.027) [-560.808] * (-560.274) (-549.968) [-555.581] (-557.504) -- 0:01:56
9000 -- [-557.615] (-564.638) (-561.015) (-564.344) * [-556.379] (-551.747) (-564.055) (-557.920) -- 0:01:50
9500 -- (-556.455) (-564.224) [-558.680] (-568.173) * (-559.863) (-551.451) [-558.922] (-568.851) -- 0:01:44
10000 -- [-560.606] (-559.590) (-556.013) (-561.083) * [-566.102] (-553.183) (-566.295) (-557.369) -- 0:01:39
Average standard deviation of split frequencies: 0.069173
10500 -- (-561.111) (-557.384) (-571.485) [-565.286] * [-561.646] (-553.444) (-573.950) (-560.545) -- 0:01:34
11000 -- (-559.147) (-556.814) (-575.274) [-567.374] * (-563.099) [-550.608] (-563.963) (-561.513) -- 0:01:29
11500 -- (-567.932) (-559.820) (-558.858) [-558.841] * [-566.465] (-551.746) (-559.097) (-565.418) -- 0:01:25
12000 -- (-561.104) [-559.626] (-561.062) (-567.408) * [-565.511] (-550.762) (-557.315) (-572.834) -- 0:01:22
12500 -- (-564.543) (-564.176) (-555.649) [-560.419] * [-562.167] (-550.706) (-554.647) (-556.294) -- 0:01:19
13000 -- (-564.765) (-565.082) (-574.502) [-555.830] * (-570.021) (-551.460) (-552.928) [-560.448] -- 0:01:15
13500 -- (-557.595) (-564.305) [-561.557] (-561.342) * (-574.884) [-551.615] (-551.594) (-557.667) -- 0:01:13
14000 -- (-560.699) [-558.870] (-566.319) (-563.314) * (-564.527) [-555.051] (-552.838) (-560.086) -- 0:01:10
14500 -- [-556.099] (-561.985) (-570.997) (-562.721) * (-554.751) (-553.996) [-552.752] (-561.066) -- 0:01:07
15000 -- [-555.735] (-574.621) (-563.472) (-562.305) * (-553.915) (-552.774) (-552.178) [-560.252] -- 0:01:05
Average standard deviation of split frequencies: 0.053314
15500 -- (-562.168) [-560.155] (-557.363) (-569.827) * (-552.925) (-550.171) (-551.159) [-557.465] -- 0:01:03
16000 -- (-565.317) (-567.363) [-559.760] (-555.978) * (-552.852) (-550.181) (-551.859) [-563.690] -- 0:01:01
16500 -- [-565.092] (-575.717) (-558.095) (-567.749) * (-551.597) [-552.124] (-553.737) (-560.923) -- 0:00:59
17000 -- (-565.890) (-580.486) (-566.741) [-563.534] * (-552.658) (-551.952) (-552.501) [-560.563] -- 0:00:57
17500 -- (-568.414) (-571.891) (-560.972) [-558.563] * (-553.879) (-552.069) (-553.712) [-565.602] -- 0:00:56
18000 -- (-561.584) (-560.374) [-562.980] (-566.896) * [-551.310] (-554.420) (-553.916) (-571.997) -- 0:00:54
18500 -- (-575.183) [-551.089] (-560.690) (-565.809) * [-552.236] (-552.758) (-552.271) (-564.815) -- 0:00:53
19000 -- (-556.471) (-551.619) (-562.633) [-559.672] * (-553.265) (-552.666) (-553.306) [-559.321] -- 0:00:51
19500 -- (-565.651) (-552.662) (-562.555) [-558.768] * (-554.108) [-552.199] (-553.345) (-565.502) -- 0:00:50
20000 -- (-556.562) (-552.404) [-558.914] (-567.992) * (-552.648) [-550.741] (-552.578) (-560.588) -- 0:00:49
Average standard deviation of split frequencies: 0.058165
20500 -- (-568.406) [-552.315] (-559.385) (-564.552) * (-551.405) [-551.531] (-552.222) (-561.508) -- 0:00:47
21000 -- (-558.361) [-552.299] (-556.585) (-567.454) * [-551.537] (-558.539) (-550.828) (-571.076) -- 0:00:46
21500 -- (-564.279) (-551.515) [-556.286] (-558.808) * (-552.746) [-552.233] (-550.599) (-579.959) -- 0:00:45
22000 -- (-558.138) [-551.009] (-562.473) (-561.108) * (-551.944) [-553.964] (-550.980) (-565.468) -- 0:00:44
22500 -- (-566.328) (-554.800) (-568.017) [-557.501] * [-551.040] (-553.645) (-552.802) (-552.735) -- 0:00:43
23000 -- (-560.473) [-551.899] (-563.553) (-557.123) * (-552.835) [-551.232] (-551.548) (-554.851) -- 0:01:24
23500 -- (-555.044) (-554.394) (-560.638) [-556.138] * [-557.597] (-550.745) (-550.853) (-553.030) -- 0:01:23
24000 -- (-560.000) [-550.841] (-557.750) (-556.491) * (-550.790) (-554.270) (-550.953) [-552.350] -- 0:01:21
24500 -- (-563.221) [-551.946] (-562.067) (-565.483) * (-551.037) (-556.379) [-550.610] (-550.593) -- 0:01:19
25000 -- (-568.906) (-553.460) (-562.722) [-556.875] * (-556.459) [-554.431] (-554.915) (-553.228) -- 0:01:18
Average standard deviation of split frequencies: 0.046622
25500 -- (-566.656) (-550.000) [-565.998] (-559.168) * [-557.902] (-551.662) (-551.374) (-552.209) -- 0:01:16
26000 -- (-565.100) [-550.642] (-558.827) (-565.544) * (-554.114) (-553.096) (-554.338) [-551.077] -- 0:01:14
26500 -- (-558.208) (-552.415) (-561.236) [-558.452] * (-552.177) [-550.934] (-551.395) (-552.645) -- 0:01:13
27000 -- (-561.249) (-553.592) [-557.997] (-562.395) * (-551.558) [-553.680] (-551.383) (-552.920) -- 0:01:12
27500 -- (-561.868) (-553.034) (-560.688) [-560.629] * (-551.247) (-554.158) [-552.291] (-553.015) -- 0:01:10
28000 -- (-562.392) (-551.204) (-570.151) [-562.166] * (-551.866) (-554.295) (-554.254) [-552.953] -- 0:01:09
28500 -- (-562.461) (-551.505) (-563.122) [-560.199] * (-552.730) (-550.358) (-551.726) [-551.201] -- 0:01:08
29000 -- (-557.382) (-551.422) (-563.808) [-556.904] * [-552.229] (-551.427) (-553.292) (-551.557) -- 0:01:06
29500 -- (-567.375) (-555.533) [-561.422] (-560.450) * (-552.486) (-550.976) (-552.605) [-553.913] -- 0:01:05
30000 -- [-563.327] (-555.906) (-564.172) (-573.608) * (-552.315) (-550.259) (-550.594) [-552.009] -- 0:01:04
Average standard deviation of split frequencies: 0.039284
30500 -- (-561.930) [-553.463] (-560.489) (-565.646) * (-552.249) [-550.518] (-551.041) (-550.202) -- 0:01:03
31000 -- (-555.865) [-551.200] (-561.378) (-554.842) * [-550.493] (-550.759) (-555.569) (-550.234) -- 0:01:02
31500 -- (-569.718) [-553.866] (-563.010) (-556.292) * [-551.975] (-551.793) (-550.915) (-552.873) -- 0:01:01
32000 -- [-560.322] (-551.037) (-564.621) (-551.774) * [-552.910] (-552.535) (-550.147) (-551.182) -- 0:01:00
32500 -- (-564.007) (-551.392) (-559.385) [-551.045] * (-553.161) (-555.394) [-550.943] (-550.688) -- 0:00:59
33000 -- (-560.524) (-552.803) [-556.675] (-550.475) * (-553.297) (-556.771) [-552.419] (-553.527) -- 0:00:58
33500 -- (-563.724) (-550.989) (-556.794) [-551.449] * (-551.814) (-552.893) (-553.782) [-551.837] -- 0:00:57
34000 -- (-562.227) (-551.318) [-568.548] (-558.692) * (-554.059) (-553.204) (-553.159) [-550.828] -- 0:00:56
34500 -- (-565.823) [-553.972] (-561.755) (-551.308) * (-553.396) (-553.299) (-552.070) [-552.107] -- 0:00:55
35000 -- [-559.889] (-555.287) (-564.285) (-554.261) * (-553.895) (-552.165) [-554.845] (-552.443) -- 0:00:55
Average standard deviation of split frequencies: 0.037101
35500 -- [-559.228] (-554.624) (-563.003) (-557.889) * [-550.565] (-552.968) (-554.728) (-551.564) -- 0:00:54
36000 -- [-558.708] (-553.122) (-567.307) (-557.053) * (-550.879) (-553.757) (-552.847) [-551.809] -- 0:00:53
36500 -- [-562.726] (-552.286) (-560.468) (-553.957) * (-553.293) (-554.457) [-554.784] (-551.724) -- 0:00:52
37000 -- (-572.990) (-551.341) (-563.137) [-551.209] * (-552.926) [-553.127] (-553.586) (-551.313) -- 0:00:52
37500 -- (-568.708) [-556.912] (-572.870) (-554.467) * (-551.329) (-552.469) [-552.844] (-554.564) -- 0:00:51
38000 -- [-567.206] (-557.305) (-570.201) (-555.121) * [-550.867] (-558.057) (-552.522) (-552.203) -- 0:00:50
38500 -- (-565.901) (-551.485) [-560.044] (-551.840) * (-552.365) [-550.844] (-552.085) (-551.898) -- 0:00:49
39000 -- (-566.064) (-550.721) (-567.052) [-552.602] * [-552.799] (-550.830) (-551.816) (-554.186) -- 0:00:49
39500 -- (-570.727) (-551.161) [-556.699] (-553.567) * (-551.763) (-554.472) (-551.566) [-550.649] -- 0:00:48
40000 -- [-568.059] (-550.986) (-564.614) (-553.504) * (-553.822) (-552.104) (-552.709) [-553.674] -- 0:01:12
Average standard deviation of split frequencies: 0.034776
40500 -- (-570.216) (-551.580) (-565.104) [-550.918] * (-551.988) (-552.004) [-552.061] (-554.019) -- 0:01:11
41000 -- (-560.552) (-550.781) (-560.024) [-551.830] * (-552.164) (-551.761) [-555.668] (-551.915) -- 0:01:10
41500 -- (-552.925) (-551.488) [-558.857] (-553.411) * (-550.801) [-558.233] (-555.117) (-550.609) -- 0:01:09
42000 -- (-551.485) (-553.270) (-557.751) [-552.295] * (-552.960) [-551.283] (-552.236) (-550.445) -- 0:01:08
42500 -- (-553.837) (-553.672) (-565.777) [-551.844] * [-551.384] (-555.447) (-552.371) (-551.725) -- 0:01:07
43000 -- (-553.559) [-551.881] (-559.452) (-551.641) * [-550.238] (-553.941) (-551.505) (-554.624) -- 0:01:06
43500 -- (-551.307) (-555.292) [-558.541] (-552.149) * (-551.023) [-554.867] (-552.129) (-552.380) -- 0:01:05
44000 -- [-550.974] (-553.165) (-555.043) (-551.511) * (-556.721) (-559.647) [-552.997] (-551.706) -- 0:01:05
44500 -- (-552.258) (-552.567) (-565.818) [-550.609] * [-551.637] (-551.341) (-554.149) (-551.156) -- 0:01:04
45000 -- (-551.725) (-555.276) [-559.303] (-557.742) * (-552.161) (-550.967) (-554.022) [-551.863] -- 0:01:03
Average standard deviation of split frequencies: 0.028881
45500 -- [-554.189] (-550.405) (-568.541) (-557.741) * (-555.971) (-556.114) [-551.770] (-553.975) -- 0:01:02
46000 -- (-553.951) (-551.345) (-564.134) [-553.484] * [-553.862] (-555.162) (-552.006) (-551.576) -- 0:01:02
46500 -- [-551.244] (-551.343) (-563.645) (-557.155) * [-550.154] (-554.191) (-551.872) (-553.823) -- 0:01:01
47000 -- [-552.045] (-550.900) (-556.921) (-553.336) * [-551.334] (-550.355) (-553.642) (-553.332) -- 0:01:00
47500 -- (-554.588) (-550.635) [-558.879] (-556.240) * [-551.004] (-551.277) (-551.338) (-551.823) -- 0:01:00
48000 -- (-551.739) [-552.482] (-559.409) (-558.104) * (-552.116) [-552.538] (-551.425) (-553.741) -- 0:00:59
48500 -- (-553.151) (-550.323) (-561.281) [-550.915] * (-554.974) (-552.036) [-550.790] (-559.382) -- 0:00:58
49000 -- [-550.642] (-551.109) (-559.179) (-551.479) * (-555.095) [-551.272] (-552.121) (-556.177) -- 0:00:58
49500 -- (-552.896) (-553.099) (-556.141) [-552.240] * (-557.693) (-556.387) [-551.975] (-558.493) -- 0:00:57
50000 -- (-554.762) (-558.833) [-558.940] (-551.894) * [-552.138] (-554.005) (-558.424) (-552.388) -- 0:00:57
Average standard deviation of split frequencies: 0.026517
50500 -- (-553.337) [-552.478] (-563.087) (-551.120) * (-553.011) [-552.521] (-553.281) (-552.814) -- 0:00:56
51000 -- (-552.032) (-552.098) [-556.944] (-551.981) * (-550.207) (-553.556) [-551.511] (-551.939) -- 0:00:55
51500 -- [-553.746] (-551.178) (-559.485) (-551.209) * (-551.229) (-550.641) [-550.162] (-550.189) -- 0:00:55
52000 -- [-550.899] (-552.461) (-560.030) (-550.115) * (-551.660) (-551.965) (-552.160) [-551.199] -- 0:00:54
52500 -- [-550.899] (-550.939) (-564.783) (-552.075) * (-552.485) (-550.321) (-551.145) [-550.100] -- 0:00:54
53000 -- (-556.401) (-555.050) (-559.132) [-553.722] * (-556.472) (-551.595) (-550.385) [-551.634] -- 0:00:53
53500 -- [-553.675] (-558.482) (-560.799) (-557.466) * (-551.849) (-550.727) [-552.059] (-551.400) -- 0:00:53
54000 -- (-553.779) (-551.654) (-564.787) [-551.349] * [-552.974] (-554.028) (-554.312) (-550.666) -- 0:00:52
54500 -- (-551.833) (-550.933) (-570.427) [-551.584] * (-552.423) (-553.577) [-553.894] (-554.204) -- 0:00:52
55000 -- (-554.855) (-554.787) (-556.325) [-552.559] * (-552.158) (-550.312) [-553.535] (-551.281) -- 0:00:51
Average standard deviation of split frequencies: 0.022448
55500 -- [-551.942] (-554.629) (-559.837) (-551.916) * (-552.651) (-551.574) (-551.811) [-552.667] -- 0:00:51
56000 -- (-551.986) (-553.282) [-563.599] (-550.277) * (-554.928) (-551.468) (-552.203) [-554.347] -- 0:00:50
56500 -- (-552.828) [-551.050] (-552.354) (-550.657) * (-552.210) [-553.558] (-554.954) (-551.787) -- 0:00:50
57000 -- [-550.742] (-552.353) (-555.614) (-550.685) * (-552.592) (-555.706) [-552.595] (-553.615) -- 0:01:06
57500 -- (-550.331) (-551.390) [-552.270] (-551.340) * (-552.514) (-550.240) [-552.209] (-556.338) -- 0:01:05
58000 -- (-551.318) (-550.909) (-552.751) [-556.114] * (-552.485) (-550.559) [-554.850] (-552.778) -- 0:01:04
58500 -- (-550.451) [-550.924] (-551.622) (-551.240) * [-549.977] (-553.828) (-558.684) (-553.671) -- 0:01:04
59000 -- (-554.908) (-551.920) (-554.914) [-550.915] * (-555.288) (-551.760) [-553.700] (-551.300) -- 0:01:03
59500 -- (-553.149) [-552.460] (-551.396) (-554.933) * (-551.396) (-552.177) (-550.942) [-553.816] -- 0:01:03
60000 -- (-554.986) (-552.324) (-550.165) [-552.997] * (-552.186) (-552.614) [-554.658] (-551.154) -- 0:01:02
Average standard deviation of split frequencies: 0.022923
60500 -- (-558.363) (-551.945) [-552.356] (-551.386) * (-552.086) (-551.620) (-553.006) [-550.357] -- 0:01:02
61000 -- (-552.415) (-553.289) (-551.783) [-553.066] * (-550.274) (-556.787) (-552.946) [-553.116] -- 0:01:01
61500 -- (-549.842) (-552.100) (-553.446) [-556.115] * [-556.140] (-553.785) (-550.344) (-552.433) -- 0:01:01
62000 -- (-552.877) (-553.528) (-558.573) [-551.887] * [-555.615] (-551.424) (-553.375) (-555.887) -- 0:01:00
62500 -- [-550.410] (-554.838) (-553.376) (-554.447) * [-551.728] (-554.430) (-551.672) (-554.506) -- 0:01:00
63000 -- (-552.973) (-551.657) [-552.201] (-552.933) * (-550.547) [-550.480] (-551.772) (-553.790) -- 0:00:59
63500 -- (-551.261) (-558.293) (-553.084) [-553.007] * [-551.916] (-553.751) (-552.582) (-551.064) -- 0:00:58
64000 -- (-553.439) [-553.584] (-551.223) (-552.932) * (-550.328) (-550.321) [-551.530] (-557.768) -- 0:00:58
64500 -- (-554.656) [-556.106] (-553.663) (-554.656) * (-552.979) (-556.620) [-551.115] (-553.644) -- 0:00:58
65000 -- (-551.461) (-553.999) (-551.910) [-551.087] * (-550.922) (-553.145) (-550.960) [-552.746] -- 0:00:57
Average standard deviation of split frequencies: 0.020496
65500 -- (-551.499) (-553.576) (-554.135) [-551.257] * (-556.313) (-552.300) [-552.782] (-551.843) -- 0:00:57
66000 -- (-553.956) [-553.517] (-552.952) (-550.752) * (-555.088) (-553.090) (-554.029) [-550.786] -- 0:00:56
66500 -- (-552.923) [-550.289] (-552.133) (-555.095) * [-553.925] (-551.016) (-552.925) (-554.557) -- 0:00:56
67000 -- (-550.931) (-552.775) [-554.903] (-552.792) * (-554.578) (-550.783) (-551.507) [-552.623] -- 0:00:55
67500 -- (-551.013) (-555.097) (-552.952) [-551.671] * (-558.349) (-552.505) (-552.032) [-550.314] -- 0:00:55
68000 -- (-551.212) (-554.649) (-555.369) [-558.145] * (-552.763) [-552.228] (-552.113) (-553.230) -- 0:00:54
68500 -- (-551.051) (-553.985) (-557.425) [-551.740] * (-552.910) [-551.048] (-552.357) (-555.605) -- 0:00:54
69000 -- (-554.431) (-556.824) (-554.455) [-552.883] * (-551.351) (-550.602) (-554.668) [-552.139] -- 0:00:53
69500 -- (-552.004) (-552.813) [-550.607] (-551.387) * (-554.535) [-550.975] (-552.077) (-553.804) -- 0:00:53
70000 -- (-552.723) (-552.070) [-550.899] (-551.785) * (-556.049) (-552.439) (-552.082) [-550.114] -- 0:00:53
Average standard deviation of split frequencies: 0.025167
70500 -- (-553.262) (-550.569) (-550.983) [-550.811] * (-552.950) [-553.039] (-551.115) (-550.921) -- 0:00:52
71000 -- (-551.066) (-553.894) [-551.764] (-550.879) * [-550.793] (-553.795) (-554.308) (-551.070) -- 0:00:52
71500 -- (-553.762) [-554.171] (-558.708) (-551.930) * (-553.430) (-553.125) [-550.145] (-550.977) -- 0:00:51
72000 -- [-550.390] (-551.773) (-553.474) (-553.332) * (-550.734) (-555.002) [-552.839] (-551.678) -- 0:00:51
72500 -- [-550.741] (-553.505) (-557.252) (-552.270) * (-553.133) (-555.120) [-552.825] (-551.143) -- 0:00:51
73000 -- (-551.410) (-554.793) [-553.282] (-553.218) * (-553.028) (-551.063) (-550.990) [-552.045] -- 0:00:50
73500 -- (-553.208) [-553.654] (-553.095) (-552.643) * [-553.517] (-554.326) (-553.151) (-552.235) -- 0:00:50
74000 -- (-555.667) (-553.057) [-554.025] (-551.003) * (-553.602) (-549.867) [-551.077] (-551.910) -- 0:01:02
74500 -- (-552.939) (-554.218) (-551.791) [-552.827] * (-553.911) [-550.334] (-552.006) (-550.648) -- 0:01:02
75000 -- [-552.275] (-554.457) (-550.431) (-552.711) * (-551.397) (-551.055) [-551.669] (-551.147) -- 0:01:01
Average standard deviation of split frequencies: 0.024811
75500 -- (-551.786) (-555.101) (-550.612) [-553.514] * (-552.317) (-550.390) [-552.507] (-551.545) -- 0:01:01
76000 -- (-552.826) (-551.860) (-550.346) [-555.004] * (-551.724) (-553.066) (-551.744) [-551.054] -- 0:01:00
76500 -- (-552.297) (-556.316) [-551.230] (-552.032) * (-551.066) (-554.170) [-554.340] (-551.493) -- 0:01:00
77000 -- [-553.758] (-552.698) (-551.570) (-554.689) * [-553.200] (-550.855) (-552.062) (-555.324) -- 0:00:59
77500 -- (-553.490) [-550.840] (-551.068) (-552.622) * [-551.808] (-558.049) (-551.793) (-551.575) -- 0:00:59
78000 -- (-554.055) (-554.481) [-552.018] (-551.390) * (-554.076) (-559.177) (-552.173) [-552.367] -- 0:00:59
78500 -- (-551.878) [-551.721] (-552.816) (-550.262) * (-551.994) (-555.952) (-555.326) [-556.595] -- 0:00:58
79000 -- (-550.736) (-550.515) [-552.545] (-551.445) * (-551.318) (-551.869) (-553.479) [-551.344] -- 0:00:58
79500 -- (-550.274) [-553.448] (-552.234) (-552.795) * [-551.367] (-554.646) (-550.120) (-550.675) -- 0:00:57
80000 -- (-550.910) (-552.343) (-553.557) [-554.649] * (-550.910) (-555.108) [-553.156] (-550.820) -- 0:00:57
Average standard deviation of split frequencies: 0.026759
80500 -- [-550.431] (-552.118) (-551.692) (-555.277) * (-550.838) (-554.065) (-551.361) [-550.652] -- 0:00:57
81000 -- (-550.734) (-552.692) [-551.993] (-552.787) * (-551.710) (-553.921) (-551.057) [-551.102] -- 0:00:56
81500 -- (-553.656) (-552.560) (-552.673) [-552.433] * [-552.689] (-555.345) (-554.166) (-552.077) -- 0:00:56
82000 -- (-552.913) [-552.235] (-555.066) (-550.331) * [-553.258] (-550.888) (-554.163) (-551.305) -- 0:00:55
82500 -- (-552.444) (-550.626) (-551.357) [-551.332] * (-553.241) (-552.282) (-551.183) [-552.606] -- 0:00:55
83000 -- (-551.014) (-550.242) [-551.313] (-554.208) * (-551.325) (-550.401) [-552.408] (-554.834) -- 0:00:55
83500 -- (-554.560) (-551.778) [-551.302] (-556.531) * [-551.330] (-552.923) (-554.453) (-552.544) -- 0:00:54
84000 -- (-555.419) [-552.140] (-551.025) (-557.114) * (-550.941) (-550.694) (-552.068) [-554.082] -- 0:00:54
84500 -- (-554.109) (-553.566) [-552.203] (-550.610) * (-550.949) (-554.372) [-551.863] (-556.351) -- 0:00:54
85000 -- (-552.564) (-556.191) (-550.242) [-552.644] * (-551.710) (-558.544) (-551.124) [-551.176] -- 0:00:53
Average standard deviation of split frequencies: 0.024536
85500 -- (-553.143) (-559.382) [-550.487] (-550.383) * (-554.189) [-550.279] (-550.738) (-550.542) -- 0:00:53
86000 -- [-552.677] (-554.603) (-550.476) (-555.769) * [-551.538] (-550.945) (-552.805) (-552.958) -- 0:00:53
86500 -- (-550.960) (-559.449) (-553.202) [-553.127] * (-552.907) (-553.613) (-554.266) [-556.474] -- 0:00:52
87000 -- (-551.694) [-552.023] (-553.262) (-551.617) * (-555.618) [-553.492] (-552.215) (-552.822) -- 0:00:52
87500 -- (-551.694) (-552.235) (-552.704) [-553.185] * (-551.226) (-549.884) (-550.969) [-552.177] -- 0:00:52
88000 -- (-557.277) [-552.907] (-552.010) (-550.074) * (-552.430) (-550.460) [-553.399] (-550.985) -- 0:00:51
88500 -- (-552.637) (-550.853) [-551.318] (-555.897) * (-551.214) (-551.661) [-551.542] (-554.046) -- 0:00:51
89000 -- [-555.858] (-553.983) (-551.121) (-555.875) * [-550.992] (-558.155) (-550.934) (-552.616) -- 0:00:51
89500 -- [-553.904] (-556.370) (-550.352) (-551.336) * (-551.293) [-554.032] (-550.707) (-553.561) -- 0:00:50
90000 -- (-556.550) [-552.100] (-551.609) (-552.082) * (-552.296) [-555.036] (-555.841) (-556.370) -- 0:00:50
Average standard deviation of split frequencies: 0.024437
90500 -- (-553.677) [-551.347] (-550.830) (-552.971) * (-552.684) (-556.447) (-551.591) [-553.569] -- 0:00:50
91000 -- (-550.426) (-551.307) (-555.917) [-554.133] * [-550.446] (-554.981) (-550.691) (-551.294) -- 0:00:59
91500 -- (-550.281) (-552.182) [-553.982] (-551.974) * [-551.840] (-551.418) (-552.515) (-552.741) -- 0:00:59
92000 -- (-549.954) (-553.864) [-554.486] (-553.079) * (-552.304) (-552.340) (-552.743) [-552.215] -- 0:00:59
92500 -- (-551.862) (-550.583) [-550.566] (-553.004) * (-551.993) (-553.036) (-557.859) [-554.222] -- 0:00:58
93000 -- [-552.604] (-552.153) (-552.091) (-552.771) * (-550.744) (-551.678) (-555.221) [-551.104] -- 0:00:58
93500 -- (-561.934) [-552.164] (-551.315) (-552.696) * (-553.737) [-550.962] (-553.075) (-550.942) -- 0:00:58
94000 -- [-553.871] (-550.401) (-553.811) (-551.988) * (-553.156) (-552.283) (-555.426) [-554.235] -- 0:00:57
94500 -- (-552.564) [-551.915] (-550.085) (-553.738) * (-551.311) (-552.418) (-552.518) [-553.690] -- 0:00:57
95000 -- (-554.423) (-553.397) [-551.363] (-551.858) * [-553.037] (-551.414) (-552.591) (-554.666) -- 0:00:57
Average standard deviation of split frequencies: 0.023325
95500 -- (-553.310) [-550.121] (-552.114) (-561.008) * (-554.173) [-552.788] (-554.671) (-552.211) -- 0:00:56
96000 -- [-553.366] (-551.872) (-551.467) (-552.532) * (-552.531) (-553.759) (-554.923) [-550.416] -- 0:00:56
96500 -- (-551.287) (-553.282) (-553.548) [-553.466] * [-550.588] (-552.649) (-553.682) (-550.881) -- 0:00:56
97000 -- (-550.616) (-557.141) (-554.552) [-552.078] * (-553.168) (-552.369) [-552.007] (-549.894) -- 0:00:55
97500 -- (-555.359) (-554.571) [-551.191] (-555.571) * [-551.834] (-551.063) (-551.257) (-553.778) -- 0:00:55
98000 -- [-550.851] (-551.058) (-553.655) (-553.305) * (-550.085) (-552.909) (-553.902) [-552.471] -- 0:00:55
98500 -- [-551.373] (-552.251) (-551.242) (-555.234) * (-553.189) (-556.095) (-552.018) [-551.236] -- 0:00:54
99000 -- (-550.928) (-550.908) (-551.297) [-552.314] * [-552.387] (-554.495) (-551.866) (-551.410) -- 0:00:54
99500 -- (-551.277) (-552.042) [-551.033] (-549.831) * (-552.849) (-553.385) (-550.556) [-553.001] -- 0:00:54
100000 -- (-553.873) (-554.034) [-553.051] (-551.647) * (-553.216) (-553.849) [-550.749] (-551.030) -- 0:00:54
Average standard deviation of split frequencies: 0.023414
100500 -- [-553.285] (-555.042) (-554.007) (-551.651) * (-552.611) (-553.516) (-550.730) [-550.671] -- 0:00:53
101000 -- (-556.054) [-551.956] (-553.440) (-552.895) * (-552.300) (-553.368) (-555.463) [-550.890] -- 0:00:53
101500 -- (-552.937) [-551.129] (-555.708) (-551.796) * (-550.598) (-553.990) (-550.949) [-551.104] -- 0:00:53
102000 -- (-552.148) (-551.244) (-554.969) [-552.238] * (-553.355) [-552.357] (-552.702) (-554.108) -- 0:00:52
102500 -- (-554.541) (-554.197) (-556.667) [-554.533] * (-551.317) (-554.667) [-551.284] (-552.117) -- 0:00:52
103000 -- (-551.995) (-556.974) [-551.807] (-552.713) * (-553.148) (-552.141) [-550.575] (-554.092) -- 0:00:52
103500 -- (-551.275) (-553.965) (-554.533) [-550.506] * (-552.532) (-552.304) [-551.766] (-554.080) -- 0:00:51
104000 -- (-551.184) [-552.465] (-553.097) (-551.132) * [-554.857] (-553.503) (-550.338) (-553.061) -- 0:00:51
104500 -- (-550.931) [-550.846] (-551.793) (-550.521) * (-559.233) (-555.656) (-550.401) [-556.839] -- 0:00:51
105000 -- (-551.574) (-550.798) [-550.844] (-552.188) * (-553.358) (-559.662) (-554.706) [-551.336] -- 0:00:51
Average standard deviation of split frequencies: 0.026260
105500 -- [-550.417] (-550.513) (-552.373) (-553.002) * [-550.671] (-556.265) (-550.883) (-550.407) -- 0:00:50
106000 -- (-551.861) (-550.931) (-559.159) [-551.695] * (-551.000) (-552.879) (-553.224) [-551.199] -- 0:00:50
106500 -- (-553.201) (-552.985) [-552.241] (-552.690) * [-552.956] (-553.216) (-551.390) (-554.208) -- 0:00:50
107000 -- (-551.476) (-552.234) [-551.389] (-552.997) * (-551.775) (-554.077) [-551.445] (-557.728) -- 0:00:50
107500 -- (-555.109) [-552.835] (-551.386) (-551.161) * [-552.214] (-553.976) (-551.300) (-558.048) -- 0:00:49
108000 -- (-551.934) (-554.324) [-551.789] (-557.336) * (-552.597) [-551.183] (-552.324) (-552.375) -- 0:00:57
108500 -- (-553.219) (-550.898) [-554.071] (-555.760) * (-553.501) [-551.890] (-551.905) (-550.627) -- 0:00:57
109000 -- (-553.521) (-552.427) [-551.186] (-550.982) * (-551.479) (-551.864) (-555.250) [-551.335] -- 0:00:57
109500 -- (-556.949) (-553.460) (-551.262) [-553.114] * (-551.692) (-551.564) (-552.533) [-551.256] -- 0:00:56
110000 -- (-553.866) (-553.708) (-552.515) [-551.819] * (-551.052) (-551.216) [-553.678] (-550.211) -- 0:00:56
Average standard deviation of split frequencies: 0.025752
110500 -- [-552.822] (-553.618) (-553.115) (-554.010) * [-550.696] (-551.733) (-552.806) (-552.156) -- 0:00:56
111000 -- (-552.448) (-551.548) (-551.375) [-552.413] * (-552.098) [-550.542] (-554.049) (-550.717) -- 0:00:56
111500 -- [-552.373] (-550.539) (-552.699) (-552.341) * (-554.599) [-551.762] (-558.423) (-551.253) -- 0:00:55
112000 -- (-552.879) (-551.123) [-551.451] (-552.367) * (-552.144) (-551.367) [-553.592] (-550.428) -- 0:00:55
112500 -- (-551.400) (-551.935) (-554.974) [-550.463] * [-551.078] (-552.120) (-555.350) (-551.358) -- 0:00:55
113000 -- (-552.538) [-551.395] (-555.880) (-553.229) * (-552.088) (-554.783) [-552.241] (-552.135) -- 0:00:54
113500 -- (-554.836) [-551.075] (-554.155) (-551.929) * [-553.356] (-554.854) (-555.991) (-551.394) -- 0:00:54
114000 -- (-553.435) (-551.256) (-553.119) [-550.350] * (-554.618) (-557.520) (-554.762) [-553.159] -- 0:00:54
114500 -- (-553.746) (-552.429) (-552.034) [-552.119] * [-550.349] (-556.782) (-551.440) (-551.914) -- 0:00:54
115000 -- (-554.425) (-550.637) (-551.991) [-552.773] * (-553.512) [-554.319] (-553.354) (-551.855) -- 0:00:53
Average standard deviation of split frequencies: 0.022672
115500 -- (-554.389) (-554.441) (-550.895) [-551.734] * (-553.106) (-553.734) (-552.426) [-551.614] -- 0:00:53
116000 -- (-551.861) [-551.926] (-551.435) (-551.237) * (-553.876) (-551.548) (-552.932) [-551.918] -- 0:00:53
116500 -- (-551.536) [-557.205] (-556.726) (-551.518) * (-553.269) (-553.990) [-551.690] (-552.252) -- 0:00:53
117000 -- (-551.234) [-558.582] (-554.514) (-552.226) * (-551.048) (-553.006) [-550.078] (-551.462) -- 0:00:52
117500 -- (-552.130) (-551.370) [-554.553] (-553.172) * [-550.367] (-553.027) (-553.333) (-552.197) -- 0:00:52
118000 -- (-553.700) (-552.054) [-551.626] (-555.358) * (-550.008) [-553.344] (-554.015) (-550.820) -- 0:00:52
118500 -- [-550.685] (-551.413) (-554.264) (-555.889) * (-550.011) (-552.274) (-554.800) [-552.493] -- 0:00:52
119000 -- (-550.563) (-550.054) [-553.650] (-555.730) * (-550.009) (-555.763) (-552.100) [-551.403] -- 0:00:51
119500 -- (-551.225) (-549.820) (-552.261) [-553.061] * (-550.463) (-554.696) (-552.427) [-551.322] -- 0:00:51
120000 -- (-553.667) (-550.300) [-551.152] (-550.243) * (-551.263) (-551.720) (-553.313) [-551.965] -- 0:00:51
Average standard deviation of split frequencies: 0.021487
120500 -- (-551.047) (-552.198) [-552.219] (-554.265) * (-552.290) (-553.053) (-551.662) [-550.327] -- 0:00:51
121000 -- (-553.019) (-551.925) (-555.966) [-551.706] * (-552.082) (-551.757) [-552.802] (-550.656) -- 0:00:50
121500 -- (-553.417) (-553.292) [-552.281] (-550.719) * (-552.362) [-553.793] (-551.965) (-552.384) -- 0:00:50
122000 -- (-550.125) (-554.783) (-551.812) [-554.043] * (-551.233) (-557.845) (-550.399) [-550.263] -- 0:00:50
122500 -- (-550.528) (-559.522) (-559.576) [-553.385] * (-550.897) [-553.769] (-551.554) (-552.153) -- 0:00:50
123000 -- [-553.104] (-559.381) (-552.616) (-552.908) * (-550.686) [-553.042] (-550.903) (-552.372) -- 0:00:49
123500 -- (-551.282) (-553.457) [-550.823] (-551.409) * [-554.090] (-556.992) (-550.533) (-556.599) -- 0:00:49
124000 -- (-551.587) [-551.206] (-550.843) (-551.678) * (-553.971) (-561.430) [-554.165] (-552.564) -- 0:00:49
124500 -- (-551.070) (-550.648) [-550.816] (-551.942) * (-553.704) (-552.972) (-551.529) [-552.592] -- 0:00:49
125000 -- (-550.746) (-553.881) [-551.427] (-551.978) * (-553.002) (-554.880) [-551.640] (-550.840) -- 0:00:49
Average standard deviation of split frequencies: 0.019691
125500 -- (-550.806) [-551.604] (-553.631) (-552.178) * (-553.881) (-553.438) [-554.182] (-550.390) -- 0:00:55
126000 -- (-550.854) [-554.182] (-553.068) (-552.800) * (-550.885) [-551.768] (-552.481) (-553.599) -- 0:00:55
126500 -- (-555.643) [-551.744] (-552.403) (-552.791) * (-550.103) [-551.987] (-551.269) (-554.135) -- 0:00:55
127000 -- (-553.449) (-554.254) (-551.651) [-552.151] * [-552.312] (-554.161) (-552.976) (-553.280) -- 0:00:54
127500 -- [-551.536] (-556.127) (-553.005) (-555.070) * (-551.664) (-552.400) (-555.375) [-550.848] -- 0:00:54
128000 -- (-553.031) [-553.057] (-551.447) (-551.803) * [-552.274] (-553.811) (-555.270) (-552.242) -- 0:00:54
128500 -- (-552.264) (-551.481) (-557.430) [-553.705] * [-552.271] (-556.237) (-553.918) (-550.987) -- 0:00:54
129000 -- (-552.970) (-554.303) (-553.898) [-551.764] * [-552.363] (-553.199) (-553.857) (-552.733) -- 0:00:54
129500 -- (-553.529) (-552.901) (-550.377) [-551.370] * (-552.532) [-552.256] (-551.218) (-550.481) -- 0:00:53
130000 -- (-553.842) (-552.743) [-552.391] (-555.995) * (-550.586) [-550.880] (-551.568) (-552.432) -- 0:00:53
Average standard deviation of split frequencies: 0.021827
130500 -- (-550.950) (-552.143) (-554.051) [-552.640] * (-551.022) [-551.538] (-550.653) (-552.966) -- 0:00:53
131000 -- [-555.446] (-550.145) (-553.169) (-552.040) * (-553.644) (-553.568) (-552.790) [-551.903] -- 0:00:53
131500 -- (-553.453) (-550.218) (-550.785) [-552.781] * (-552.230) [-550.829] (-551.669) (-551.904) -- 0:00:52
132000 -- (-552.667) [-550.640] (-558.289) (-553.717) * (-550.578) [-551.580] (-553.183) (-555.295) -- 0:00:52
132500 -- (-553.492) (-552.657) (-553.474) [-551.846] * (-553.975) (-552.419) (-556.063) [-552.661] -- 0:00:52
133000 -- (-550.566) [-552.393] (-555.657) (-550.944) * [-550.579] (-550.063) (-551.746) (-551.240) -- 0:00:52
133500 -- (-550.566) (-552.000) [-551.040] (-552.038) * (-552.712) [-551.253] (-555.409) (-551.696) -- 0:00:51
134000 -- (-551.773) (-554.509) [-550.878] (-550.876) * (-551.093) (-553.426) [-552.787] (-552.198) -- 0:00:51
134500 -- [-550.531] (-554.118) (-551.898) (-552.073) * (-552.051) (-552.508) (-550.351) [-550.353] -- 0:00:51
135000 -- (-551.878) (-554.585) (-555.849) [-551.460] * (-552.252) (-550.556) [-550.794] (-552.071) -- 0:00:51
Average standard deviation of split frequencies: 0.020068
135500 -- (-554.759) (-554.035) (-555.450) [-550.905] * [-552.729] (-550.635) (-550.921) (-552.254) -- 0:00:51
136000 -- [-550.549] (-554.780) (-557.020) (-551.947) * (-553.076) (-551.158) [-550.260] (-552.071) -- 0:00:50
136500 -- (-551.520) (-552.734) (-553.247) [-550.393] * (-553.360) [-551.170] (-551.684) (-554.639) -- 0:00:50
137000 -- [-551.031] (-555.343) (-551.808) (-552.464) * [-553.215] (-550.874) (-551.036) (-552.524) -- 0:00:50
137500 -- (-553.250) (-552.050) (-550.972) [-551.991] * [-553.257] (-551.750) (-553.969) (-557.129) -- 0:00:50
138000 -- (-554.511) (-550.826) (-551.996) [-556.259] * (-551.943) [-550.986] (-551.096) (-552.357) -- 0:00:49
138500 -- [-554.636] (-552.865) (-551.177) (-551.729) * (-553.711) [-551.724] (-551.863) (-551.011) -- 0:00:49
139000 -- (-556.595) (-551.856) [-552.067] (-552.717) * [-552.298] (-551.622) (-550.868) (-551.630) -- 0:00:49
139500 -- [-553.517] (-552.536) (-550.430) (-552.892) * (-551.803) (-552.258) [-552.630] (-552.233) -- 0:00:49
140000 -- (-553.933) (-553.884) [-550.426] (-553.202) * (-552.691) (-552.345) (-551.231) [-552.037] -- 0:00:49
Average standard deviation of split frequencies: 0.017991
140500 -- (-551.315) (-552.498) (-550.998) [-554.835] * [-552.646] (-550.559) (-551.536) (-553.133) -- 0:00:48
141000 -- (-550.152) (-552.582) [-550.661] (-554.949) * (-554.019) (-552.843) [-551.845] (-556.715) -- 0:00:48
141500 -- [-554.094] (-553.376) (-552.981) (-552.174) * (-551.530) (-554.805) (-551.724) [-550.253] -- 0:00:48
142000 -- (-556.440) (-554.069) (-555.378) [-553.375] * (-550.185) (-553.884) (-554.154) [-550.260] -- 0:00:48
142500 -- [-552.003] (-552.932) (-554.561) (-558.394) * (-550.123) (-550.635) [-552.357] (-550.474) -- 0:00:54
143000 -- (-551.146) [-556.641] (-552.790) (-552.361) * (-554.270) (-552.824) (-550.269) [-550.895] -- 0:00:53
143500 -- [-550.159] (-558.294) (-553.118) (-550.686) * (-552.909) [-553.447] (-553.958) (-551.492) -- 0:00:53
144000 -- (-550.330) [-551.889] (-554.107) (-553.131) * [-550.680] (-552.614) (-552.618) (-551.827) -- 0:00:53
144500 -- [-552.612] (-551.204) (-556.277) (-551.095) * (-551.477) (-552.379) (-552.276) [-550.361] -- 0:00:53
145000 -- (-553.186) (-551.589) [-553.497] (-552.314) * (-551.649) [-550.415] (-552.287) (-552.065) -- 0:00:53
Average standard deviation of split frequencies: 0.016314
145500 -- [-551.556] (-551.447) (-552.499) (-552.716) * (-550.482) (-551.702) [-554.495] (-552.750) -- 0:00:52
146000 -- (-551.726) [-555.098] (-553.279) (-550.903) * (-551.652) (-551.074) (-552.541) [-552.047] -- 0:00:52
146500 -- [-552.311] (-553.704) (-553.082) (-552.391) * (-550.673) [-550.949] (-555.639) (-551.403) -- 0:00:52
147000 -- (-551.501) [-553.064] (-557.591) (-550.452) * [-552.404] (-551.989) (-552.155) (-551.148) -- 0:00:52
147500 -- (-551.974) (-551.657) (-552.622) [-551.522] * (-553.931) [-552.041] (-552.746) (-551.677) -- 0:00:52
148000 -- [-552.814] (-556.400) (-556.715) (-552.811) * (-552.743) (-549.887) [-551.528] (-552.983) -- 0:00:51
148500 -- (-550.557) (-555.158) [-552.834] (-552.088) * (-551.246) (-553.774) (-554.913) [-550.803] -- 0:00:51
149000 -- (-551.030) [-550.486] (-553.177) (-556.911) * [-550.811] (-556.955) (-552.377) (-551.016) -- 0:00:51
149500 -- (-551.474) [-552.022] (-552.052) (-555.020) * [-551.903] (-552.054) (-554.632) (-551.722) -- 0:00:51
150000 -- (-553.094) (-550.465) [-553.098] (-549.974) * [-551.896] (-551.802) (-554.976) (-554.317) -- 0:00:51
Average standard deviation of split frequencies: 0.016632
150500 -- [-552.478] (-556.472) (-552.171) (-552.727) * (-553.330) [-551.416] (-554.356) (-551.901) -- 0:00:50
151000 -- (-551.665) [-556.457] (-553.157) (-552.684) * (-550.949) [-553.918] (-552.529) (-551.207) -- 0:00:50
151500 -- (-552.595) [-552.437] (-551.791) (-552.314) * [-552.233] (-553.467) (-552.256) (-551.113) -- 0:00:50
152000 -- (-551.531) (-552.766) [-552.048] (-550.248) * [-552.711] (-550.059) (-550.877) (-551.383) -- 0:00:50
152500 -- (-556.496) (-554.740) (-552.465) [-551.845] * [-555.037] (-550.231) (-555.667) (-554.415) -- 0:00:50
153000 -- (-552.719) [-553.316] (-551.854) (-550.167) * [-553.540] (-551.268) (-558.287) (-554.230) -- 0:00:49
153500 -- (-552.925) (-556.717) [-551.773] (-554.691) * (-553.102) (-551.540) (-557.885) [-551.033] -- 0:00:49
154000 -- (-551.793) (-554.575) [-551.037] (-552.471) * (-555.138) [-550.779] (-551.691) (-552.359) -- 0:00:49
154500 -- [-551.764] (-551.216) (-551.582) (-554.825) * (-554.633) [-553.162] (-552.511) (-552.612) -- 0:00:49
155000 -- (-552.016) (-552.380) [-550.291] (-555.617) * [-550.526] (-552.834) (-555.618) (-550.026) -- 0:00:49
Average standard deviation of split frequencies: 0.018449
155500 -- (-552.547) (-553.554) (-550.227) [-553.179] * (-552.665) (-552.004) (-550.633) [-555.226] -- 0:00:48
156000 -- (-551.409) [-554.560] (-559.462) (-551.544) * (-550.573) (-552.820) [-550.723] (-550.813) -- 0:00:48
156500 -- [-551.884] (-552.142) (-553.444) (-550.680) * (-551.381) (-551.386) [-550.561] (-552.704) -- 0:00:48
157000 -- [-554.899] (-554.828) (-553.284) (-550.782) * (-551.604) (-552.033) [-552.313] (-552.514) -- 0:00:48
157500 -- (-552.144) (-553.374) (-553.349) [-550.065] * (-551.370) (-551.184) [-552.338] (-555.084) -- 0:00:48
158000 -- [-555.613] (-552.672) (-551.937) (-551.060) * (-551.617) (-552.608) (-552.028) [-551.912] -- 0:00:47
158500 -- [-555.751] (-553.990) (-551.840) (-554.428) * (-552.376) (-551.955) [-553.208] (-553.317) -- 0:00:47
159000 -- [-553.200] (-553.859) (-555.590) (-556.812) * (-555.018) (-553.226) (-553.431) [-552.613] -- 0:00:47
159500 -- [-550.717] (-554.715) (-555.758) (-551.885) * (-553.684) [-552.133] (-554.416) (-551.368) -- 0:00:52
160000 -- (-551.169) (-553.326) (-553.250) [-551.141] * (-555.858) [-551.649] (-553.656) (-551.977) -- 0:00:52
Average standard deviation of split frequencies: 0.016766
160500 -- (-551.812) (-555.097) [-554.033] (-551.670) * (-555.121) (-550.467) [-550.255] (-556.667) -- 0:00:52
161000 -- (-552.497) (-553.621) (-551.974) [-552.615] * (-554.460) [-550.536] (-550.985) (-550.640) -- 0:00:52
161500 -- [-550.810] (-551.919) (-552.079) (-551.858) * (-552.725) (-553.692) (-554.434) [-550.071] -- 0:00:51
162000 -- (-552.465) (-552.825) [-552.655] (-555.289) * (-554.697) (-552.311) (-554.891) [-550.615] -- 0:00:51
162500 -- (-551.459) (-552.167) [-550.715] (-555.955) * (-550.265) (-551.105) (-555.040) [-551.245] -- 0:00:51
163000 -- (-552.513) (-552.480) [-550.302] (-551.187) * (-555.177) (-550.980) (-550.777) [-550.628] -- 0:00:51
163500 -- (-553.303) [-552.050] (-552.810) (-552.179) * (-552.739) (-552.336) (-555.105) [-550.605] -- 0:00:51
164000 -- (-553.450) [-550.279] (-551.351) (-554.864) * (-556.089) (-555.187) [-552.548] (-550.979) -- 0:00:50
164500 -- (-553.534) [-550.361] (-553.012) (-551.242) * (-553.737) (-553.922) [-552.058] (-552.271) -- 0:00:50
165000 -- (-552.891) [-551.874] (-553.140) (-550.286) * [-552.178] (-554.058) (-551.198) (-553.570) -- 0:00:50
Average standard deviation of split frequencies: 0.015551
165500 -- (-552.814) (-551.052) [-557.542] (-552.273) * [-552.589] (-555.444) (-552.361) (-553.944) -- 0:00:50
166000 -- (-552.496) (-551.623) [-550.974] (-550.614) * (-552.050) (-553.004) (-551.858) [-552.193] -- 0:00:50
166500 -- (-551.734) (-554.215) [-550.522] (-552.648) * (-550.832) [-553.582] (-552.553) (-551.341) -- 0:00:50
167000 -- [-552.558] (-551.731) (-553.949) (-552.433) * (-552.086) (-552.454) (-556.552) [-551.436] -- 0:00:49
167500 -- (-553.001) [-551.965] (-554.611) (-551.938) * (-554.367) (-554.375) (-553.115) [-550.747] -- 0:00:49
168000 -- (-551.178) (-554.523) (-553.320) [-552.373] * (-553.106) (-555.805) [-551.908] (-550.262) -- 0:00:49
168500 -- [-552.747] (-551.023) (-554.227) (-555.098) * (-555.322) [-552.068] (-552.371) (-551.475) -- 0:00:49
169000 -- (-552.280) [-551.056] (-553.600) (-555.727) * (-551.585) (-550.917) [-550.947] (-551.228) -- 0:00:49
169500 -- (-551.029) (-557.352) [-555.364] (-557.234) * (-550.239) (-555.273) [-550.377] (-558.348) -- 0:00:48
170000 -- [-550.010] (-555.234) (-553.541) (-552.050) * (-553.854) (-555.245) [-550.292] (-553.785) -- 0:00:48
Average standard deviation of split frequencies: 0.014683
170500 -- (-551.092) (-554.073) (-552.939) [-553.084] * [-553.104] (-556.960) (-552.780) (-559.418) -- 0:00:48
171000 -- (-550.038) (-551.343) (-550.650) [-553.507] * (-557.367) (-556.526) [-551.931] (-550.997) -- 0:00:48
171500 -- [-552.832] (-552.011) (-555.028) (-551.324) * (-552.261) [-554.997] (-551.038) (-552.668) -- 0:00:48
172000 -- [-550.598] (-553.220) (-554.985) (-552.110) * [-556.365] (-550.325) (-550.854) (-554.306) -- 0:00:48
172500 -- (-550.506) [-553.573] (-555.949) (-556.419) * [-556.811] (-554.897) (-550.712) (-552.196) -- 0:00:47
173000 -- (-550.571) (-553.388) (-550.860) [-552.874] * (-550.692) [-551.223] (-551.253) (-555.420) -- 0:00:47
173500 -- [-551.814] (-552.735) (-552.705) (-550.920) * (-551.607) [-551.186] (-552.936) (-553.470) -- 0:00:47
174000 -- (-552.168) (-552.894) (-552.838) [-552.207] * [-552.068] (-551.453) (-551.460) (-552.367) -- 0:00:47
174500 -- (-552.228) (-551.204) [-555.044] (-551.723) * (-551.762) (-552.943) [-552.644] (-552.662) -- 0:00:47
175000 -- (-551.029) (-550.771) [-556.459] (-554.563) * (-554.131) (-557.395) [-554.599] (-554.998) -- 0:00:47
Average standard deviation of split frequencies: 0.014330
175500 -- (-555.213) (-551.554) (-552.611) [-553.162] * [-549.882] (-551.728) (-555.518) (-552.899) -- 0:00:46
176000 -- (-555.239) (-550.543) (-552.399) [-552.474] * (-550.879) (-551.586) [-551.559] (-552.057) -- 0:00:46
176500 -- (-552.472) (-552.367) (-553.661) [-551.991] * [-551.479] (-551.810) (-552.539) (-553.265) -- 0:00:51
177000 -- [-550.669] (-554.816) (-557.876) (-551.467) * (-550.279) (-552.813) (-552.057) [-554.368] -- 0:00:51
177500 -- [-552.080] (-554.001) (-555.044) (-554.569) * (-555.007) (-551.519) (-551.063) [-551.312] -- 0:00:50
178000 -- [-553.453] (-550.671) (-551.055) (-551.649) * (-551.933) (-555.225) (-550.950) [-552.390] -- 0:00:50
178500 -- (-553.750) [-551.838] (-554.921) (-551.585) * [-550.986] (-551.206) (-551.489) (-553.984) -- 0:00:50
179000 -- (-555.877) (-552.132) (-551.891) [-551.210] * (-553.132) (-552.527) [-551.532] (-556.534) -- 0:00:50
179500 -- (-552.223) (-554.610) (-552.911) [-553.709] * (-551.507) (-550.862) [-551.978] (-552.445) -- 0:00:50
180000 -- (-555.234) (-556.294) [-552.294] (-557.606) * (-555.159) (-552.017) (-555.499) [-551.361] -- 0:00:50
Average standard deviation of split frequencies: 0.014090
180500 -- (-555.776) [-550.326] (-551.443) (-556.005) * (-550.400) [-551.999] (-556.089) (-551.661) -- 0:00:49
181000 -- (-552.369) [-557.170] (-551.737) (-555.948) * (-550.719) [-551.569] (-555.962) (-552.292) -- 0:00:49
181500 -- (-550.312) (-553.236) [-553.551] (-554.863) * (-552.198) [-552.760] (-551.626) (-553.279) -- 0:00:49
182000 -- (-550.560) [-552.689] (-555.045) (-553.558) * (-555.576) (-550.966) [-551.785] (-551.679) -- 0:00:49
182500 -- (-550.808) [-553.167] (-556.041) (-551.926) * (-552.544) [-551.503] (-552.042) (-553.812) -- 0:00:49
183000 -- [-553.018] (-553.921) (-557.099) (-552.394) * (-552.357) (-551.459) [-550.402] (-552.583) -- 0:00:49
183500 -- (-551.494) (-556.749) [-555.014] (-550.030) * (-555.564) (-550.986) (-552.146) [-551.967] -- 0:00:48
184000 -- (-551.556) (-552.643) [-555.468] (-552.240) * [-558.282] (-553.517) (-550.186) (-550.804) -- 0:00:48
184500 -- (-554.035) [-552.684] (-553.295) (-552.507) * (-550.649) [-552.731] (-551.505) (-550.992) -- 0:00:48
185000 -- (-552.674) (-555.548) (-555.325) [-551.533] * (-549.915) (-555.145) [-555.709] (-553.340) -- 0:00:48
Average standard deviation of split frequencies: 0.013306
185500 -- (-552.397) (-551.986) [-553.071] (-556.627) * (-553.208) (-552.649) [-553.418] (-551.408) -- 0:00:48
186000 -- (-555.013) [-550.753] (-552.995) (-553.003) * (-551.948) (-556.058) [-553.978] (-554.582) -- 0:00:48
186500 -- (-556.951) (-550.793) [-552.980] (-555.836) * (-552.277) (-552.848) (-553.368) [-554.596] -- 0:00:47
187000 -- (-553.847) (-552.783) (-550.770) [-551.465] * [-550.943] (-552.971) (-553.704) (-553.572) -- 0:00:47
187500 -- [-550.305] (-554.556) (-553.558) (-552.083) * (-552.637) [-551.507] (-553.565) (-551.024) -- 0:00:47
188000 -- (-553.709) (-552.308) [-553.607] (-553.330) * (-551.741) [-552.823] (-553.566) (-552.918) -- 0:00:47
188500 -- (-552.237) [-552.469] (-554.479) (-551.305) * (-551.548) (-554.617) (-551.794) [-551.382] -- 0:00:47
189000 -- [-553.572] (-552.369) (-556.663) (-551.526) * (-553.113) [-552.687] (-553.366) (-552.424) -- 0:00:47
189500 -- (-553.916) (-551.155) (-550.687) [-550.518] * (-554.364) [-552.776] (-550.490) (-555.076) -- 0:00:47
190000 -- [-555.197] (-553.256) (-552.216) (-552.621) * (-553.234) [-553.872] (-551.698) (-553.417) -- 0:00:46
Average standard deviation of split frequencies: 0.013013
190500 -- (-555.228) [-550.140] (-555.115) (-552.560) * (-554.750) (-552.316) [-551.253] (-555.580) -- 0:00:46
191000 -- [-550.575] (-552.344) (-556.120) (-552.915) * (-551.918) (-553.149) [-552.873] (-553.665) -- 0:00:46
191500 -- (-552.678) (-550.961) [-553.671] (-552.524) * (-553.194) [-551.016] (-552.664) (-551.545) -- 0:00:46
192000 -- (-552.351) [-555.716] (-551.342) (-553.312) * (-554.490) (-552.608) (-553.122) [-555.598] -- 0:00:46
192500 -- [-551.106] (-552.896) (-550.879) (-553.476) * (-550.961) [-552.384] (-555.376) (-550.982) -- 0:00:46
193000 -- [-552.342] (-553.195) (-551.854) (-550.122) * (-555.892) (-554.632) [-552.890] (-559.051) -- 0:00:45
193500 -- (-550.886) (-550.319) (-554.110) [-551.398] * (-551.377) (-551.183) [-551.159] (-551.579) -- 0:00:50
194000 -- [-551.563] (-550.976) (-553.027) (-553.776) * (-554.485) (-551.656) [-554.300] (-551.017) -- 0:00:49
194500 -- [-552.557] (-551.629) (-554.692) (-552.244) * (-552.897) (-552.499) [-553.833] (-553.620) -- 0:00:49
195000 -- [-551.873] (-550.613) (-558.629) (-551.885) * (-551.823) [-552.495] (-552.048) (-552.026) -- 0:00:49
Average standard deviation of split frequencies: 0.013589
195500 -- (-550.565) [-552.809] (-555.801) (-554.498) * (-552.249) (-552.336) (-553.114) [-551.126] -- 0:00:49
196000 -- (-552.837) (-551.488) (-554.423) [-551.473] * (-552.238) (-554.226) (-550.445) [-552.199] -- 0:00:49
196500 -- (-552.060) (-553.866) [-555.576] (-550.119) * [-550.669] (-552.884) (-552.142) (-551.848) -- 0:00:49
197000 -- (-554.366) (-551.548) [-552.963] (-552.874) * (-552.620) (-552.781) (-551.925) [-551.122] -- 0:00:48
197500 -- (-553.062) [-553.074] (-557.492) (-553.275) * (-552.615) (-555.561) (-552.841) [-550.515] -- 0:00:48
198000 -- [-551.398] (-551.903) (-554.558) (-554.493) * (-550.804) [-553.913] (-553.625) (-550.517) -- 0:00:48
198500 -- (-557.239) (-553.055) [-552.665] (-551.681) * [-550.734] (-552.597) (-553.614) (-553.094) -- 0:00:48
199000 -- (-552.893) [-550.719] (-554.803) (-550.910) * [-550.824] (-551.912) (-551.768) (-550.827) -- 0:00:48
199500 -- (-553.232) (-550.654) (-554.470) [-552.163] * (-557.639) [-553.215] (-552.874) (-551.562) -- 0:00:48
200000 -- (-555.949) [-550.615] (-553.728) (-551.366) * (-557.805) [-551.780] (-554.123) (-552.356) -- 0:00:48
Average standard deviation of split frequencies: 0.013273
200500 -- [-555.668] (-552.178) (-551.404) (-553.800) * (-551.961) (-556.684) (-551.421) [-551.715] -- 0:00:47
201000 -- (-552.385) [-550.968] (-550.805) (-551.639) * (-553.610) [-553.650] (-551.603) (-551.305) -- 0:00:47
201500 -- [-554.471] (-550.755) (-554.988) (-553.109) * (-553.564) [-556.066] (-550.930) (-550.504) -- 0:00:47
202000 -- [-553.712] (-552.218) (-550.554) (-552.725) * (-555.179) (-553.056) [-550.859] (-550.125) -- 0:00:47
202500 -- [-550.621] (-550.401) (-552.394) (-551.288) * (-552.794) (-554.431) [-550.472] (-551.761) -- 0:00:47
203000 -- (-555.063) (-553.452) [-553.891] (-552.171) * (-552.071) [-550.662] (-550.798) (-552.803) -- 0:00:47
203500 -- (-552.473) [-550.191] (-558.182) (-551.516) * (-552.061) (-551.735) (-552.292) [-550.189] -- 0:00:46
204000 -- [-551.403] (-550.612) (-556.124) (-550.916) * (-550.950) (-550.626) (-556.817) [-550.743] -- 0:00:46
204500 -- (-551.288) [-553.372] (-557.766) (-550.500) * (-551.433) (-551.240) (-552.400) [-552.088] -- 0:00:46
205000 -- [-551.551] (-560.193) (-552.021) (-551.480) * [-550.976] (-553.851) (-551.442) (-551.641) -- 0:00:46
Average standard deviation of split frequencies: 0.013489
205500 -- [-550.897] (-553.149) (-552.451) (-550.969) * [-553.408] (-554.382) (-552.248) (-552.083) -- 0:00:46
206000 -- (-551.529) (-550.888) [-550.954] (-550.632) * (-552.430) [-551.221] (-552.413) (-552.470) -- 0:00:46
206500 -- (-553.534) (-552.087) (-551.226) [-551.576] * [-553.452] (-552.939) (-554.634) (-551.508) -- 0:00:46
207000 -- (-554.488) (-550.190) [-552.481] (-551.756) * (-550.765) (-552.698) (-551.504) [-551.251] -- 0:00:45
207500 -- (-555.447) (-552.466) [-550.871] (-552.006) * (-551.517) (-553.869) [-550.209] (-551.165) -- 0:00:45
208000 -- (-555.580) (-558.311) (-552.203) [-552.730] * (-552.576) (-550.791) [-549.977] (-554.951) -- 0:00:45
208500 -- (-551.893) [-552.879] (-555.484) (-552.190) * [-552.476] (-551.490) (-550.432) (-555.256) -- 0:00:45
209000 -- [-551.978] (-554.456) (-552.147) (-553.661) * (-552.474) [-552.975] (-553.339) (-554.630) -- 0:00:45
209500 -- (-552.768) [-552.401] (-553.695) (-553.504) * (-550.994) (-552.187) (-551.693) [-551.750] -- 0:00:45
210000 -- [-555.552] (-553.476) (-553.934) (-553.130) * (-550.362) [-554.062] (-551.552) (-553.319) -- 0:00:45
Average standard deviation of split frequencies: 0.014421
210500 -- (-554.155) (-554.148) [-552.592] (-552.876) * (-552.120) (-552.873) [-551.163] (-550.897) -- 0:00:48
211000 -- (-550.625) (-553.363) [-551.068] (-554.772) * (-553.356) (-552.961) [-550.243] (-552.650) -- 0:00:48
211500 -- [-549.896] (-553.826) (-555.775) (-551.839) * (-552.256) (-551.158) (-552.605) [-555.192] -- 0:00:48
212000 -- (-550.354) (-550.828) [-552.887] (-552.108) * [-551.154] (-553.481) (-551.371) (-557.437) -- 0:00:48
212500 -- (-550.145) [-552.081] (-553.009) (-552.522) * (-555.277) [-554.167] (-551.277) (-553.622) -- 0:00:48
213000 -- (-551.590) (-551.495) [-550.920] (-556.156) * [-553.008] (-551.309) (-550.585) (-557.344) -- 0:00:48
213500 -- [-552.679] (-552.662) (-551.281) (-554.136) * [-552.778] (-551.835) (-550.697) (-551.475) -- 0:00:47
214000 -- (-552.894) (-560.145) (-551.346) [-551.007] * (-551.436) [-554.236] (-551.359) (-555.936) -- 0:00:47
214500 -- (-552.161) (-555.246) (-551.867) [-551.010] * [-550.994] (-550.491) (-552.048) (-553.868) -- 0:00:47
215000 -- [-549.900] (-551.838) (-550.627) (-552.427) * (-553.539) (-555.078) (-553.848) [-550.984] -- 0:00:47
Average standard deviation of split frequencies: 0.013943
215500 -- (-553.309) (-550.897) [-551.281] (-551.494) * [-552.376] (-552.800) (-550.867) (-553.923) -- 0:00:47
216000 -- (-554.846) (-551.839) [-550.621] (-554.426) * [-550.895] (-552.703) (-551.288) (-554.265) -- 0:00:47
216500 -- [-551.307] (-554.232) (-553.122) (-552.884) * [-553.875] (-554.858) (-550.999) (-554.800) -- 0:00:47
217000 -- (-551.957) [-551.268] (-555.544) (-553.480) * (-551.822) (-551.914) [-550.732] (-551.089) -- 0:00:46
217500 -- (-552.550) (-551.427) (-560.757) [-550.909] * [-551.142] (-552.282) (-550.374) (-551.791) -- 0:00:46
218000 -- (-551.644) (-554.956) [-554.523] (-551.829) * (-552.117) (-550.488) [-554.222] (-552.626) -- 0:00:46
218500 -- (-555.812) (-551.266) (-551.206) [-553.396] * (-554.286) (-553.775) [-551.004] (-552.868) -- 0:00:46
219000 -- (-557.563) [-551.981] (-557.626) (-551.773) * (-552.698) [-551.812] (-550.559) (-550.790) -- 0:00:46
219500 -- (-557.278) [-551.978] (-552.474) (-552.932) * [-553.965] (-551.348) (-551.648) (-551.168) -- 0:00:46
220000 -- (-556.642) (-552.980) (-553.132) [-552.822] * [-551.648] (-554.158) (-551.130) (-553.769) -- 0:00:46
Average standard deviation of split frequencies: 0.013320
220500 -- (-553.152) (-551.534) (-552.716) [-552.738] * (-553.021) (-553.589) (-551.195) [-553.875] -- 0:00:45
221000 -- (-555.743) (-551.800) (-552.499) [-553.340] * (-553.589) [-554.357] (-550.791) (-552.675) -- 0:00:45
221500 -- [-551.402] (-552.604) (-552.087) (-553.279) * [-550.487] (-552.215) (-552.778) (-550.627) -- 0:00:45
222000 -- (-551.149) [-554.919] (-554.906) (-550.686) * (-550.277) [-552.455] (-555.112) (-554.087) -- 0:00:45
222500 -- (-550.588) [-550.476] (-551.888) (-555.022) * [-555.471] (-551.497) (-551.521) (-553.080) -- 0:00:45
223000 -- (-553.258) (-552.465) [-551.142] (-552.551) * (-551.648) [-553.884] (-551.650) (-552.418) -- 0:00:45
223500 -- (-551.430) (-550.506) (-550.588) [-552.446] * [-551.330] (-553.144) (-554.541) (-553.498) -- 0:00:45
224000 -- (-555.627) [-555.521] (-555.209) (-552.656) * (-553.978) (-551.485) [-551.628] (-556.026) -- 0:00:45
224500 -- [-552.121] (-551.725) (-553.943) (-551.353) * (-552.267) [-550.718] (-553.283) (-553.502) -- 0:00:44
225000 -- [-551.019] (-550.930) (-554.319) (-552.084) * (-552.986) (-551.221) (-551.623) [-550.849] -- 0:00:44
Average standard deviation of split frequencies: 0.012399
225500 -- (-553.431) (-554.547) [-554.730] (-553.266) * (-554.795) (-552.200) (-552.637) [-552.074] -- 0:00:44
226000 -- (-551.825) (-551.890) [-552.635] (-556.295) * [-552.908] (-553.742) (-552.804) (-553.145) -- 0:00:44
226500 -- (-554.738) (-551.361) (-552.806) [-551.113] * (-551.123) (-553.435) [-551.583] (-551.741) -- 0:00:44
227000 -- (-550.067) (-551.361) (-552.141) [-551.477] * (-552.305) [-551.153] (-551.394) (-552.643) -- 0:00:44
227500 -- [-552.157] (-550.507) (-552.777) (-552.200) * (-552.445) [-550.595] (-552.579) (-553.415) -- 0:00:47
228000 -- (-551.975) (-551.921) [-551.013] (-551.182) * [-550.456] (-554.064) (-551.058) (-554.553) -- 0:00:47
228500 -- (-551.211) (-550.214) [-553.934] (-555.416) * [-550.723] (-554.054) (-551.191) (-553.289) -- 0:00:47
229000 -- (-553.587) [-550.939] (-551.383) (-554.261) * [-550.612] (-553.591) (-552.200) (-553.502) -- 0:00:47
229500 -- [-551.935] (-550.771) (-551.653) (-551.407) * (-551.667) (-553.088) (-551.825) [-550.917] -- 0:00:47
230000 -- [-550.966] (-553.096) (-554.640) (-551.705) * (-551.357) (-551.258) [-550.946] (-555.805) -- 0:00:46
Average standard deviation of split frequencies: 0.013464
230500 -- [-551.923] (-552.668) (-551.976) (-557.309) * (-557.214) (-550.953) [-553.399] (-552.277) -- 0:00:46
231000 -- [-551.934] (-552.088) (-555.403) (-554.813) * (-557.815) [-550.721] (-551.953) (-553.545) -- 0:00:46
231500 -- (-551.657) [-551.591] (-551.022) (-552.015) * (-553.357) (-550.543) [-551.577] (-550.523) -- 0:00:46
232000 -- (-553.780) [-553.486] (-551.054) (-551.577) * (-552.338) (-557.228) (-556.387) [-550.431] -- 0:00:46
232500 -- (-556.540) (-558.142) [-553.542] (-555.205) * (-551.107) [-552.475] (-551.652) (-550.187) -- 0:00:46
233000 -- (-556.647) (-556.134) [-551.291] (-552.011) * (-557.719) (-552.446) [-552.565] (-552.103) -- 0:00:46
233500 -- (-552.413) [-551.794] (-552.455) (-550.498) * (-556.700) [-551.941] (-550.848) (-554.917) -- 0:00:45
234000 -- (-553.003) (-554.329) (-553.203) [-552.838] * (-554.867) [-553.731] (-555.821) (-553.569) -- 0:00:45
234500 -- (-553.229) [-550.261] (-557.807) (-550.894) * (-552.588) (-551.826) [-552.530] (-552.349) -- 0:00:45
235000 -- (-553.854) [-551.565] (-551.734) (-552.026) * (-555.597) [-554.707] (-552.862) (-553.839) -- 0:00:45
Average standard deviation of split frequencies: 0.012220
235500 -- (-553.170) [-552.946] (-550.265) (-551.203) * [-552.445] (-555.327) (-550.168) (-553.214) -- 0:00:45
236000 -- (-551.121) (-552.038) [-550.446] (-552.566) * (-553.639) (-554.463) (-551.684) [-552.856] -- 0:00:45
236500 -- [-551.099] (-552.495) (-550.094) (-553.021) * (-552.823) [-552.039] (-550.646) (-555.289) -- 0:00:45
237000 -- (-554.764) (-555.642) (-554.464) [-552.968] * [-552.875] (-552.009) (-552.396) (-553.448) -- 0:00:45
237500 -- (-554.132) [-553.299] (-552.237) (-555.621) * (-550.437) (-558.912) (-551.214) [-551.589] -- 0:00:44
238000 -- (-554.617) (-551.515) (-555.507) [-550.335] * (-550.741) [-551.347] (-553.055) (-551.118) -- 0:00:44
238500 -- (-554.312) (-557.241) (-555.867) [-551.072] * (-552.838) [-554.213] (-550.105) (-553.831) -- 0:00:44
239000 -- [-557.343] (-550.341) (-553.443) (-553.098) * (-553.661) (-553.273) [-551.693] (-550.710) -- 0:00:44
239500 -- (-550.798) [-550.461] (-550.949) (-550.722) * [-553.257] (-551.286) (-550.408) (-555.540) -- 0:00:44
240000 -- (-553.502) (-551.541) (-556.232) [-552.529] * (-551.458) (-551.313) [-550.761] (-552.072) -- 0:00:44
Average standard deviation of split frequencies: 0.012098
240500 -- (-552.708) (-550.940) (-553.094) [-551.793] * (-555.109) (-553.119) (-552.759) [-554.840] -- 0:00:44
241000 -- [-553.604] (-552.960) (-552.961) (-550.459) * (-550.909) (-552.282) (-553.426) [-554.364] -- 0:00:44
241500 -- (-554.790) (-553.066) [-550.567] (-550.880) * [-554.698] (-558.900) (-550.976) (-552.403) -- 0:00:43
242000 -- (-554.515) (-552.056) (-551.923) [-550.837] * (-551.682) (-555.038) [-551.175] (-551.266) -- 0:00:43
242500 -- (-554.739) (-553.568) [-552.478] (-551.423) * [-550.416] (-552.622) (-551.739) (-553.555) -- 0:00:43
243000 -- (-552.752) (-552.907) [-551.972] (-550.891) * (-552.075) (-551.565) (-550.787) [-553.960] -- 0:00:43
243500 -- [-550.354] (-550.563) (-551.030) (-553.377) * (-550.635) [-550.773] (-552.024) (-556.564) -- 0:00:43
244000 -- (-550.888) (-554.499) [-552.703] (-550.375) * (-550.703) [-550.548] (-550.718) (-556.776) -- 0:00:46
244500 -- [-551.269] (-551.252) (-552.759) (-555.751) * (-551.707) (-551.827) [-550.587] (-551.093) -- 0:00:46
245000 -- (-551.032) (-555.142) [-550.987] (-551.415) * (-551.999) (-550.456) [-550.918] (-551.396) -- 0:00:46
Average standard deviation of split frequencies: 0.011610
245500 -- (-553.177) (-553.897) [-552.844] (-552.709) * (-552.750) (-552.659) (-551.770) [-551.240] -- 0:00:46
246000 -- (-550.783) (-552.301) [-552.929] (-553.061) * (-554.134) (-552.463) (-551.844) [-551.621] -- 0:00:45
246500 -- [-550.528] (-551.506) (-549.842) (-550.177) * [-552.866] (-550.760) (-554.544) (-552.011) -- 0:00:45
247000 -- (-551.231) (-552.206) (-550.072) [-554.071] * [-551.012] (-551.579) (-551.460) (-554.512) -- 0:00:45
247500 -- (-558.198) (-554.091) [-552.573] (-553.467) * (-552.124) (-551.824) (-551.505) [-552.363] -- 0:00:45
248000 -- [-552.743] (-550.654) (-550.717) (-550.927) * (-554.651) (-552.762) (-551.224) [-553.398] -- 0:00:45
248500 -- (-552.646) (-551.073) [-550.246] (-550.954) * (-563.043) [-552.108] (-552.423) (-550.255) -- 0:00:45
249000 -- (-550.939) (-550.468) [-550.365] (-551.434) * (-558.388) [-550.435] (-552.408) (-552.729) -- 0:00:45
249500 -- (-555.415) (-553.549) (-553.851) [-552.513] * [-551.224] (-553.963) (-552.148) (-551.848) -- 0:00:45
250000 -- (-552.504) [-553.310] (-555.163) (-552.878) * (-551.898) (-550.623) (-551.417) [-550.287] -- 0:00:45
Average standard deviation of split frequencies: 0.011394
250500 -- (-553.030) [-551.474] (-550.159) (-550.407) * (-550.283) [-550.204] (-550.261) (-552.276) -- 0:00:44
251000 -- (-551.859) [-551.965] (-552.296) (-550.557) * (-554.501) [-550.795] (-551.663) (-551.805) -- 0:00:44
251500 -- (-552.027) [-554.467] (-550.054) (-551.055) * (-554.117) (-554.778) (-549.975) [-550.212] -- 0:00:44
252000 -- (-554.123) [-552.017] (-551.255) (-552.717) * (-552.994) [-552.946] (-550.315) (-550.242) -- 0:00:44
252500 -- (-556.303) (-552.016) (-550.605) [-551.898] * (-552.201) (-552.077) [-550.083] (-550.740) -- 0:00:44
253000 -- (-550.866) (-551.574) (-552.452) [-551.788] * [-551.594] (-550.805) (-553.384) (-551.626) -- 0:00:44
253500 -- (-551.403) [-552.180] (-555.412) (-551.937) * (-552.751) (-550.845) (-552.409) [-551.415] -- 0:00:44
254000 -- [-551.509] (-551.447) (-550.763) (-551.256) * (-551.012) [-553.916] (-552.418) (-551.177) -- 0:00:44
254500 -- (-551.725) [-551.451] (-555.107) (-551.014) * (-551.146) (-551.861) [-554.051] (-554.932) -- 0:00:43
255000 -- (-551.356) [-551.974] (-551.193) (-553.316) * (-550.782) [-553.864] (-559.681) (-551.558) -- 0:00:43
Average standard deviation of split frequencies: 0.012240
255500 -- (-552.393) (-552.016) (-550.775) [-552.379] * (-551.290) (-551.680) (-552.422) [-550.799] -- 0:00:43
256000 -- (-554.053) (-551.938) (-551.261) [-550.934] * [-550.482] (-552.163) (-554.427) (-552.995) -- 0:00:43
256500 -- (-552.239) [-552.921] (-553.305) (-552.473) * (-553.573) (-555.062) (-556.812) [-551.324] -- 0:00:43
257000 -- [-551.891] (-550.938) (-551.149) (-555.926) * (-552.212) (-555.662) [-550.982] (-554.151) -- 0:00:43
257500 -- [-553.086] (-551.361) (-552.066) (-555.214) * (-552.486) [-555.956] (-551.516) (-550.728) -- 0:00:43
258000 -- [-551.077] (-550.529) (-550.878) (-556.732) * (-550.748) (-552.987) (-552.162) [-552.272] -- 0:00:43
258500 -- (-550.807) (-551.604) (-551.518) [-553.523] * (-552.935) [-552.888] (-551.735) (-551.218) -- 0:00:43
259000 -- (-553.264) (-550.855) (-551.350) [-552.554] * (-553.369) [-556.091] (-556.695) (-554.898) -- 0:00:42
259500 -- (-555.591) [-550.481] (-550.907) (-551.277) * [-552.647] (-555.631) (-556.042) (-556.076) -- 0:00:42
260000 -- (-552.342) (-550.734) [-551.710] (-552.489) * (-552.515) [-553.097] (-551.332) (-552.401) -- 0:00:42
Average standard deviation of split frequencies: 0.012127
260500 -- (-554.242) [-552.817] (-554.684) (-553.231) * (-553.566) [-551.226] (-554.785) (-550.955) -- 0:00:42
261000 -- (-555.915) (-552.389) (-551.651) [-552.363] * [-552.694] (-552.820) (-553.780) (-553.358) -- 0:00:45
261500 -- (-552.123) [-551.905] (-551.108) (-555.740) * (-551.512) (-551.520) [-550.374] (-552.414) -- 0:00:45
262000 -- (-553.121) (-552.044) [-551.356] (-550.928) * (-551.853) (-555.411) [-556.270] (-554.953) -- 0:00:45
262500 -- (-552.001) (-552.561) (-550.908) [-552.275] * (-551.859) [-554.407] (-553.610) (-553.349) -- 0:00:44
263000 -- (-552.176) (-551.839) [-551.768] (-551.642) * (-550.638) [-551.777] (-554.915) (-552.836) -- 0:00:44
263500 -- (-550.369) (-551.868) (-550.719) [-552.114] * [-550.759] (-554.908) (-550.887) (-551.782) -- 0:00:44
264000 -- (-554.240) [-552.817] (-551.236) (-554.571) * (-553.022) (-555.029) [-552.627] (-553.317) -- 0:00:44
264500 -- (-553.032) (-553.006) (-550.657) [-556.787] * (-553.112) (-553.682) (-551.962) [-556.543] -- 0:00:44
265000 -- (-554.094) (-550.800) [-553.514] (-552.287) * (-551.225) [-551.667] (-550.473) (-556.310) -- 0:00:44
Average standard deviation of split frequencies: 0.011363
265500 -- (-551.580) (-553.656) [-551.816] (-554.309) * (-553.452) [-551.974] (-551.496) (-555.465) -- 0:00:44
266000 -- (-551.457) (-552.286) [-551.964] (-554.089) * (-553.950) [-552.584] (-550.954) (-552.077) -- 0:00:44
266500 -- [-559.090] (-551.771) (-555.106) (-550.717) * (-555.215) (-553.221) (-555.525) [-550.169] -- 0:00:44
267000 -- (-552.287) (-550.475) (-553.424) [-550.215] * (-551.367) (-551.771) (-551.244) [-550.861] -- 0:00:43
267500 -- (-551.000) (-551.544) [-550.135] (-550.344) * (-551.246) [-552.321] (-553.314) (-551.949) -- 0:00:43
268000 -- [-553.253] (-553.617) (-552.094) (-550.440) * (-550.525) (-556.179) [-550.223] (-552.102) -- 0:00:43
268500 -- (-554.456) [-552.721] (-554.623) (-558.242) * [-551.709] (-553.696) (-552.494) (-553.624) -- 0:00:43
269000 -- (-553.442) (-553.505) (-557.231) [-552.510] * (-551.841) (-552.806) [-553.068] (-551.323) -- 0:00:43
269500 -- (-550.244) [-555.784] (-554.311) (-551.185) * (-554.158) (-551.287) [-551.037] (-551.851) -- 0:00:43
270000 -- (-550.268) (-550.554) [-551.060] (-554.393) * (-551.358) [-554.677] (-550.978) (-553.744) -- 0:00:43
Average standard deviation of split frequencies: 0.011065
270500 -- (-550.869) (-550.927) [-554.213] (-551.110) * [-555.144] (-550.669) (-552.052) (-552.101) -- 0:00:43
271000 -- (-550.351) [-551.140] (-551.212) (-553.271) * (-551.134) (-551.932) [-550.594] (-550.923) -- 0:00:43
271500 -- (-550.680) (-553.793) [-552.747] (-550.893) * [-551.250] (-550.933) (-551.017) (-550.923) -- 0:00:42
272000 -- (-550.912) [-552.550] (-552.248) (-551.243) * (-553.387) [-553.692] (-551.089) (-551.446) -- 0:00:42
272500 -- (-552.868) [-553.648] (-550.497) (-550.424) * (-560.400) (-552.363) [-553.449] (-550.261) -- 0:00:42
273000 -- (-550.259) [-552.078] (-551.180) (-551.346) * (-552.490) (-555.004) (-552.889) [-550.256] -- 0:00:42
273500 -- (-552.171) (-552.521) [-554.492] (-551.007) * (-551.866) (-552.932) [-552.457] (-551.194) -- 0:00:42
274000 -- [-551.181] (-551.788) (-553.980) (-551.496) * (-551.809) [-551.009] (-551.713) (-551.734) -- 0:00:42
274500 -- [-551.021] (-550.944) (-553.062) (-552.641) * [-551.768] (-551.077) (-553.312) (-550.402) -- 0:00:42
275000 -- (-551.225) (-550.567) [-555.448] (-553.237) * (-556.009) [-551.558] (-550.857) (-553.586) -- 0:00:42
Average standard deviation of split frequencies: 0.010650
275500 -- (-551.419) (-552.135) [-558.274] (-552.774) * (-552.150) [-552.471] (-551.561) (-551.944) -- 0:00:42
276000 -- (-552.617) (-553.178) (-554.023) [-553.723] * (-551.788) (-550.548) [-550.706] (-555.039) -- 0:00:41
276500 -- (-550.990) [-551.181] (-552.830) (-551.268) * (-550.452) (-551.763) (-549.943) [-553.637] -- 0:00:41
277000 -- (-552.578) (-552.168) [-551.772] (-554.512) * [-552.048] (-550.197) (-553.285) (-552.106) -- 0:00:41
277500 -- (-554.719) (-552.236) (-550.448) [-552.129] * [-550.703] (-551.215) (-553.482) (-550.920) -- 0:00:44
278000 -- [-551.075] (-550.345) (-552.240) (-551.452) * [-552.344] (-551.491) (-550.043) (-550.527) -- 0:00:44
278500 -- [-551.381] (-551.375) (-552.376) (-551.479) * (-556.661) (-550.307) [-551.574] (-554.778) -- 0:00:44
279000 -- (-554.008) [-551.067] (-552.334) (-551.259) * [-550.955] (-552.445) (-552.906) (-550.154) -- 0:00:43
279500 -- [-558.260] (-550.063) (-551.923) (-552.807) * (-554.306) (-551.534) [-551.738] (-550.825) -- 0:00:43
280000 -- (-559.545) [-550.674] (-553.148) (-554.742) * (-555.094) [-551.028] (-550.928) (-551.646) -- 0:00:43
Average standard deviation of split frequencies: 0.010967
280500 -- (-552.426) (-551.955) [-552.962] (-553.238) * (-551.950) (-555.045) (-550.280) [-550.827] -- 0:00:43
281000 -- (-550.585) (-554.238) (-550.092) [-552.254] * [-551.551] (-554.939) (-551.831) (-552.238) -- 0:00:43
281500 -- (-551.142) [-551.745] (-551.386) (-556.514) * (-550.723) [-550.380] (-553.930) (-553.721) -- 0:00:43
282000 -- [-555.390] (-550.621) (-552.537) (-552.983) * [-553.903] (-554.168) (-556.334) (-554.758) -- 0:00:43
282500 -- [-551.313] (-553.668) (-550.828) (-559.725) * (-550.597) (-553.126) [-556.033] (-552.071) -- 0:00:43
283000 -- [-551.103] (-552.646) (-552.012) (-553.713) * (-551.327) (-551.732) [-552.020] (-550.658) -- 0:00:43
283500 -- (-550.709) [-552.202] (-553.222) (-551.798) * [-551.968] (-550.771) (-552.379) (-553.487) -- 0:00:42
284000 -- [-551.184] (-554.836) (-554.944) (-553.025) * (-553.114) (-556.253) [-552.656] (-554.091) -- 0:00:42
284500 -- (-552.421) [-551.540] (-552.163) (-553.968) * (-554.006) (-560.852) [-553.430] (-552.753) -- 0:00:42
285000 -- [-553.473] (-552.932) (-551.525) (-553.720) * (-555.330) [-551.493] (-552.977) (-551.303) -- 0:00:42
Average standard deviation of split frequencies: 0.010256
285500 -- (-553.269) (-553.878) [-550.917] (-551.511) * (-553.232) [-551.183] (-553.115) (-552.315) -- 0:00:42
286000 -- (-551.644) (-552.035) (-553.221) [-550.908] * (-551.190) [-553.346] (-553.392) (-552.823) -- 0:00:42
286500 -- (-552.730) [-551.555] (-553.109) (-551.725) * (-549.955) (-552.228) (-551.004) [-550.247] -- 0:00:42
287000 -- (-552.843) [-551.941] (-556.117) (-557.194) * (-550.755) (-550.879) [-554.611] (-549.934) -- 0:00:42
287500 -- [-555.245] (-553.518) (-554.014) (-554.827) * (-554.829) (-552.212) [-551.805] (-550.595) -- 0:00:42
288000 -- (-550.384) (-553.352) (-551.440) [-550.987] * (-552.627) (-554.688) [-551.559] (-550.469) -- 0:00:42
288500 -- (-551.574) (-554.268) (-551.059) [-550.320] * (-551.579) (-553.155) [-553.309] (-553.334) -- 0:00:41
289000 -- [-551.534] (-554.101) (-552.542) (-552.122) * (-551.764) (-551.440) [-551.171] (-550.371) -- 0:00:41
289500 -- (-552.411) [-551.546] (-550.493) (-553.624) * (-553.860) (-553.656) [-551.462] (-550.554) -- 0:00:41
290000 -- [-550.591] (-553.211) (-554.254) (-554.818) * [-551.766] (-550.022) (-553.528) (-550.550) -- 0:00:41
Average standard deviation of split frequencies: 0.009540
290500 -- (-552.632) (-553.702) [-552.119] (-552.193) * (-551.749) [-550.652] (-554.882) (-550.911) -- 0:00:41
291000 -- (-555.311) [-554.325] (-551.185) (-551.276) * (-553.309) [-551.756] (-552.948) (-551.853) -- 0:00:41
291500 -- (-552.191) [-551.548] (-550.703) (-552.925) * (-552.890) [-551.256] (-552.635) (-553.598) -- 0:00:41
292000 -- (-554.079) (-550.602) (-553.784) [-552.073] * (-553.489) (-551.689) (-551.085) [-551.436] -- 0:00:41
292500 -- [-553.265] (-554.859) (-553.292) (-551.745) * (-551.263) (-552.728) [-551.030] (-552.584) -- 0:00:41
293000 -- (-554.245) (-554.654) [-552.105] (-551.491) * [-552.791] (-552.934) (-551.943) (-551.956) -- 0:00:41
293500 -- (-550.539) [-554.760] (-552.996) (-551.669) * (-559.183) (-550.467) (-553.408) [-552.240] -- 0:00:40
294000 -- [-552.804] (-550.817) (-550.855) (-550.556) * (-552.352) [-551.337] (-553.849) (-552.742) -- 0:00:40
294500 -- (-551.050) (-552.947) (-557.910) [-552.665] * (-551.326) (-551.337) [-550.389] (-554.976) -- 0:00:43
295000 -- (-551.674) (-552.838) [-552.382] (-553.450) * [-550.310] (-553.820) (-551.667) (-553.660) -- 0:00:43
Average standard deviation of split frequencies: 0.008712
295500 -- (-552.684) (-552.603) [-550.800] (-555.237) * (-554.672) [-553.476] (-555.623) (-551.851) -- 0:00:42
296000 -- (-552.980) [-552.049] (-552.108) (-553.640) * (-555.652) (-551.583) [-553.023] (-555.240) -- 0:00:42
296500 -- (-552.376) (-552.781) [-550.534] (-553.750) * (-552.727) (-553.475) (-550.881) [-550.847] -- 0:00:42
297000 -- (-551.752) (-555.720) (-552.113) [-550.294] * [-552.448] (-552.038) (-552.149) (-552.163) -- 0:00:42
297500 -- (-552.652) (-555.035) [-552.402] (-555.305) * (-553.072) (-551.385) (-552.675) [-551.961] -- 0:00:42
298000 -- (-551.241) (-552.399) [-552.688] (-550.210) * (-553.557) (-550.275) [-551.734] (-551.775) -- 0:00:42
298500 -- (-557.827) (-552.288) (-551.869) [-552.182] * (-553.360) (-551.808) [-552.283] (-550.534) -- 0:00:42
299000 -- (-552.143) (-551.692) (-550.795) [-552.398] * (-552.787) (-550.244) (-550.810) [-550.595] -- 0:00:42
299500 -- (-550.544) [-553.186] (-550.936) (-551.924) * [-552.122] (-552.464) (-553.278) (-551.789) -- 0:00:42
300000 -- (-550.480) (-555.025) [-550.221] (-553.902) * (-555.802) (-551.605) [-552.591] (-552.210) -- 0:00:42
Average standard deviation of split frequencies: 0.008485
300500 -- (-552.848) (-552.039) (-552.025) [-553.083] * (-553.368) (-550.681) [-551.022] (-553.297) -- 0:00:41
301000 -- (-552.060) (-553.325) [-550.534] (-551.006) * (-554.627) (-551.801) [-553.617] (-554.168) -- 0:00:41
301500 -- (-555.245) [-550.978] (-552.971) (-553.380) * (-552.317) [-550.590] (-554.033) (-553.748) -- 0:00:41
302000 -- (-551.688) (-551.287) (-553.276) [-554.971] * (-552.468) (-552.849) [-552.822] (-552.798) -- 0:00:41
302500 -- (-552.076) [-550.650] (-555.448) (-551.358) * (-551.027) [-553.317] (-551.468) (-551.352) -- 0:00:41
303000 -- (-554.097) [-553.744] (-552.455) (-554.493) * (-553.574) [-552.516] (-554.010) (-552.599) -- 0:00:41
303500 -- (-553.864) (-550.777) [-550.333] (-551.086) * (-551.465) (-552.633) (-550.785) [-553.487] -- 0:00:41
304000 -- (-555.194) [-550.897] (-550.235) (-553.193) * [-553.152] (-550.765) (-555.476) (-556.102) -- 0:00:41
304500 -- (-556.360) (-552.408) [-551.119] (-552.901) * (-555.754) (-550.403) [-549.988] (-552.826) -- 0:00:41
305000 -- [-549.936] (-551.863) (-552.154) (-553.919) * [-556.592] (-550.693) (-553.029) (-558.641) -- 0:00:41
Average standard deviation of split frequencies: 0.007068
305500 -- (-550.862) [-551.492] (-552.058) (-554.810) * (-551.471) [-550.545] (-554.498) (-554.838) -- 0:00:40
306000 -- (-551.922) (-554.300) [-553.210] (-551.497) * [-551.052] (-554.291) (-554.572) (-550.696) -- 0:00:40
306500 -- (-550.485) (-553.650) (-551.034) [-552.224] * (-554.040) (-552.783) (-555.201) [-551.975] -- 0:00:40
307000 -- (-551.749) (-553.361) [-552.672] (-552.354) * (-552.556) (-552.754) (-552.837) [-550.476] -- 0:00:40
307500 -- (-555.220) (-552.209) [-551.814] (-552.326) * (-551.000) (-550.176) [-551.920] (-552.219) -- 0:00:40
308000 -- (-551.793) [-552.490] (-554.290) (-551.856) * (-554.037) [-555.455] (-552.915) (-552.473) -- 0:00:40
308500 -- (-550.856) (-553.332) [-552.177] (-552.484) * (-556.857) (-553.866) (-551.510) [-553.345] -- 0:00:40
309000 -- (-552.245) [-552.255] (-551.437) (-550.122) * (-551.968) (-551.206) (-551.469) [-551.723] -- 0:00:40
309500 -- (-554.936) (-555.447) (-551.191) [-551.132] * (-552.430) (-555.501) (-553.379) [-553.396] -- 0:00:40
310000 -- [-553.092] (-554.657) (-552.148) (-550.752) * (-550.870) (-552.824) [-552.076] (-555.001) -- 0:00:40
Average standard deviation of split frequencies: 0.006427
310500 -- (-551.895) (-552.175) (-552.896) [-553.723] * [-551.769] (-551.311) (-553.350) (-550.624) -- 0:00:42
311000 -- (-553.344) (-554.418) (-552.073) [-551.308] * [-550.457] (-551.623) (-556.765) (-553.118) -- 0:00:42
311500 -- (-551.880) (-556.224) [-553.468] (-552.492) * [-551.732] (-551.338) (-553.232) (-551.311) -- 0:00:41
312000 -- (-551.894) (-551.089) (-553.882) [-554.347] * [-552.720] (-552.543) (-551.613) (-550.225) -- 0:00:41
312500 -- (-554.509) (-552.423) [-556.021] (-552.473) * [-552.051] (-552.487) (-551.725) (-552.423) -- 0:00:41
313000 -- (-552.021) (-553.401) (-551.699) [-552.370] * (-551.204) [-553.979] (-552.479) (-554.195) -- 0:00:41
313500 -- (-553.377) (-552.582) [-551.123] (-551.164) * (-552.319) (-554.225) [-551.655] (-555.609) -- 0:00:41
314000 -- (-552.274) (-552.258) [-550.478] (-555.559) * (-555.942) (-554.234) (-553.550) [-553.438] -- 0:00:41
314500 -- (-551.764) (-552.528) (-553.744) [-552.304] * (-553.986) [-554.331] (-550.692) (-550.385) -- 0:00:41
315000 -- (-551.871) [-553.346] (-555.062) (-553.976) * (-552.404) (-552.540) (-561.250) [-551.821] -- 0:00:41
Average standard deviation of split frequencies: 0.006620
315500 -- (-551.859) (-557.097) (-552.466) [-551.031] * [-551.648] (-551.992) (-552.806) (-553.566) -- 0:00:41
316000 -- [-550.495] (-555.194) (-555.603) (-550.447) * (-551.887) (-551.397) [-554.808] (-550.532) -- 0:00:41
316500 -- (-555.795) (-554.508) [-551.442] (-550.540) * [-552.264] (-552.623) (-551.538) (-551.419) -- 0:00:41
317000 -- [-553.031] (-550.059) (-550.142) (-553.795) * (-553.501) (-553.758) (-555.441) [-552.099] -- 0:00:40
317500 -- (-555.928) (-552.872) (-550.241) [-551.944] * (-553.196) (-552.846) [-552.180] (-550.230) -- 0:00:40
318000 -- (-552.815) (-551.832) [-550.514] (-550.992) * (-552.010) (-552.928) [-550.749] (-551.922) -- 0:00:40
318500 -- [-552.825] (-551.723) (-550.308) (-551.841) * [-553.269] (-557.022) (-550.202) (-552.264) -- 0:00:40
319000 -- (-550.465) [-551.452] (-549.977) (-557.972) * (-550.989) (-551.111) (-552.607) [-552.043] -- 0:00:40
319500 -- (-552.536) (-554.008) (-551.171) [-552.946] * [-551.905] (-550.306) (-551.222) (-551.209) -- 0:00:40
320000 -- (-552.451) (-553.412) [-552.727] (-554.311) * (-550.760) (-552.660) [-551.616] (-550.774) -- 0:00:40
Average standard deviation of split frequencies: 0.006659
320500 -- (-555.231) [-552.527] (-554.094) (-550.713) * (-550.442) (-552.614) (-551.974) [-552.554] -- 0:00:40
321000 -- (-554.474) [-553.217] (-554.880) (-553.639) * (-552.194) [-550.889] (-552.242) (-554.591) -- 0:00:40
321500 -- (-555.804) [-552.572] (-551.151) (-553.969) * (-551.245) [-549.991] (-553.895) (-553.107) -- 0:00:40
322000 -- [-554.857] (-554.635) (-551.610) (-551.291) * (-552.624) (-553.192) [-552.117] (-551.383) -- 0:00:40
322500 -- (-552.943) (-551.963) [-550.379] (-552.188) * [-551.101] (-554.022) (-552.674) (-553.859) -- 0:00:39
323000 -- (-550.499) (-550.888) (-553.400) [-551.409] * (-552.370) (-551.734) (-552.899) [-554.687] -- 0:00:39
323500 -- (-550.388) [-551.985] (-554.369) (-551.213) * (-553.399) (-550.438) [-551.239] (-552.168) -- 0:00:39
324000 -- (-552.271) [-550.830] (-553.452) (-551.533) * (-554.540) [-552.220] (-551.216) (-550.216) -- 0:00:39
324500 -- (-559.287) (-552.808) [-550.988] (-550.586) * (-553.706) [-551.378] (-551.433) (-550.413) -- 0:00:39
325000 -- [-551.604] (-554.102) (-551.227) (-551.889) * (-551.710) (-551.135) [-557.726] (-556.276) -- 0:00:39
Average standard deviation of split frequencies: 0.006805
325500 -- (-552.295) [-551.051] (-550.904) (-553.745) * [-553.250] (-551.949) (-554.591) (-553.817) -- 0:00:39
326000 -- (-555.245) [-551.028] (-551.186) (-551.709) * (-554.023) (-552.147) (-555.124) [-552.984] -- 0:00:39
326500 -- (-551.134) (-552.164) (-554.756) [-550.790] * (-550.382) (-551.278) (-552.211) [-552.429] -- 0:00:39
327000 -- [-551.085] (-552.869) (-558.964) (-551.372) * (-550.311) [-550.924] (-551.939) (-552.081) -- 0:00:39
327500 -- (-558.264) (-554.535) (-551.635) [-550.149] * [-550.496] (-551.449) (-552.317) (-549.997) -- 0:00:41
328000 -- (-556.629) (-551.479) [-550.383] (-553.298) * (-555.917) (-551.650) (-553.521) [-552.705] -- 0:00:40
328500 -- [-553.943] (-553.210) (-551.998) (-551.313) * [-555.971] (-550.239) (-554.486) (-550.644) -- 0:00:40
329000 -- [-553.767] (-552.439) (-550.044) (-549.936) * (-552.749) [-551.938] (-550.398) (-550.727) -- 0:00:40
329500 -- (-552.702) (-553.038) [-550.714] (-551.156) * (-552.571) (-552.534) (-550.283) [-552.339] -- 0:00:40
330000 -- (-552.709) (-556.242) [-550.371] (-552.606) * [-551.283] (-553.788) (-550.274) (-556.012) -- 0:00:40
Average standard deviation of split frequencies: 0.006457
330500 -- (-552.286) (-551.290) (-552.809) [-551.435] * (-552.313) (-554.957) (-550.644) [-555.557] -- 0:00:40
331000 -- [-554.485] (-552.586) (-550.527) (-550.489) * (-553.775) (-551.206) [-551.550] (-554.008) -- 0:00:40
331500 -- (-552.940) (-551.327) [-550.449] (-552.889) * (-552.099) (-552.583) [-552.943] (-552.480) -- 0:00:40
332000 -- [-552.477] (-553.798) (-551.913) (-551.901) * [-550.547] (-551.414) (-550.868) (-553.262) -- 0:00:40
332500 -- (-553.801) [-552.983] (-552.929) (-553.188) * (-550.950) (-557.104) [-553.259] (-552.485) -- 0:00:40
333000 -- [-551.925] (-557.304) (-551.908) (-551.824) * (-558.314) (-556.388) [-551.641] (-553.545) -- 0:00:40
333500 -- (-552.028) [-551.386] (-554.928) (-551.938) * (-553.272) (-553.474) (-554.416) [-551.232] -- 0:00:39
334000 -- [-550.646] (-552.342) (-554.152) (-552.823) * (-552.761) (-549.956) (-555.302) [-551.968] -- 0:00:39
334500 -- (-550.852) [-551.064] (-555.168) (-553.682) * (-550.743) (-550.198) [-550.480] (-550.736) -- 0:00:39
335000 -- [-554.950] (-551.191) (-553.891) (-552.036) * [-551.766] (-551.894) (-550.487) (-551.900) -- 0:00:39
Average standard deviation of split frequencies: 0.006355
335500 -- [-550.803] (-552.548) (-553.530) (-552.595) * (-552.229) (-554.345) [-551.249] (-553.328) -- 0:00:39
336000 -- [-550.794] (-553.896) (-550.699) (-556.290) * [-551.850] (-554.519) (-552.285) (-554.464) -- 0:00:39
336500 -- (-551.230) (-551.126) [-557.284] (-552.252) * (-551.193) [-552.007] (-553.795) (-554.187) -- 0:00:39
337000 -- [-550.495] (-552.125) (-553.134) (-551.145) * (-550.735) [-551.427] (-554.399) (-556.401) -- 0:00:39
337500 -- [-550.890] (-551.859) (-555.521) (-551.922) * (-550.320) (-551.576) [-553.002] (-555.083) -- 0:00:39
338000 -- (-555.242) (-554.592) (-553.781) [-551.099] * [-550.499] (-553.971) (-550.736) (-555.804) -- 0:00:39
338500 -- (-553.929) (-553.874) (-554.650) [-550.677] * (-552.807) (-553.685) [-550.741] (-557.936) -- 0:00:39
339000 -- (-555.575) (-551.477) (-550.521) [-554.240] * (-552.262) (-553.932) (-552.926) [-552.834] -- 0:00:38
339500 -- [-553.047] (-551.596) (-556.646) (-554.204) * (-555.884) (-551.412) (-557.639) [-551.973] -- 0:00:38
340000 -- [-551.136] (-550.906) (-553.803) (-550.793) * (-553.059) [-553.137] (-553.547) (-553.404) -- 0:00:38
Average standard deviation of split frequencies: 0.007082
340500 -- [-552.474] (-555.077) (-556.041) (-551.808) * (-552.987) [-552.647] (-552.749) (-551.759) -- 0:00:38
341000 -- [-552.169] (-552.380) (-552.020) (-555.247) * (-553.772) [-550.947] (-550.832) (-554.845) -- 0:00:38
341500 -- (-554.159) [-551.464] (-552.640) (-551.858) * (-550.578) (-550.603) (-551.231) [-552.778] -- 0:00:38
342000 -- (-551.489) (-552.559) [-551.681] (-551.510) * (-552.332) (-556.069) (-550.814) [-552.338] -- 0:00:38
342500 -- (-551.092) [-551.710] (-556.249) (-553.268) * (-551.931) [-552.314] (-552.679) (-552.443) -- 0:00:38
343000 -- (-558.470) (-554.907) [-552.233] (-554.392) * (-555.205) [-552.247] (-552.320) (-553.291) -- 0:00:38
343500 -- (-550.650) (-553.093) [-554.759] (-554.066) * (-550.844) (-551.990) (-555.627) [-550.074] -- 0:00:38
344000 -- (-551.254) (-551.287) [-553.661] (-550.167) * [-550.487] (-555.141) (-551.736) (-551.188) -- 0:00:40
344500 -- (-551.720) [-552.125] (-551.541) (-552.960) * (-551.139) [-552.677] (-551.638) (-551.465) -- 0:00:39
345000 -- (-552.900) (-552.498) [-550.835] (-555.195) * [-553.128] (-550.736) (-550.488) (-557.387) -- 0:00:39
Average standard deviation of split frequencies: 0.007533
345500 -- [-555.525] (-551.297) (-552.262) (-550.986) * [-550.563] (-553.699) (-550.708) (-555.446) -- 0:00:39
346000 -- (-551.430) (-555.573) (-551.516) [-558.312] * [-552.185] (-551.794) (-551.766) (-551.471) -- 0:00:39
346500 -- (-550.308) (-553.027) [-551.239] (-550.908) * (-553.779) (-554.293) (-550.965) [-550.669] -- 0:00:39
347000 -- (-556.708) (-564.329) [-550.122] (-550.526) * (-551.774) (-556.521) (-556.652) [-554.469] -- 0:00:39
347500 -- (-552.303) [-551.157] (-550.656) (-551.416) * [-550.971] (-554.398) (-551.572) (-551.497) -- 0:00:39
348000 -- [-554.195] (-551.056) (-551.968) (-552.486) * (-550.775) (-559.320) (-553.052) [-551.054] -- 0:00:39
348500 -- (-554.895) [-553.612] (-551.872) (-550.427) * (-550.813) (-551.929) [-550.363] (-550.900) -- 0:00:39
349000 -- (-551.636) (-556.368) (-551.980) [-551.102] * (-550.337) (-554.763) [-552.027] (-554.761) -- 0:00:39
349500 -- (-551.401) (-550.512) [-553.852] (-554.679) * (-558.996) (-552.309) [-552.708] (-552.385) -- 0:00:39
350000 -- (-550.382) (-556.790) (-554.746) [-553.554] * [-551.585] (-552.033) (-554.922) (-557.931) -- 0:00:39
Average standard deviation of split frequencies: 0.007829
350500 -- (-553.414) (-552.211) (-551.345) [-552.004] * (-552.055) (-555.795) (-554.037) [-552.790] -- 0:00:38
351000 -- [-554.905] (-551.090) (-550.490) (-551.446) * (-553.787) (-553.167) (-552.605) [-552.346] -- 0:00:38
351500 -- (-555.751) (-550.853) [-550.618] (-550.946) * (-550.433) (-553.708) (-552.437) [-551.413] -- 0:00:38
352000 -- [-550.611] (-550.667) (-550.596) (-551.282) * (-552.628) (-554.753) (-551.531) [-552.147] -- 0:00:38
352500 -- [-550.821] (-550.151) (-551.549) (-550.443) * [-551.481] (-556.206) (-552.919) (-556.968) -- 0:00:38
353000 -- (-552.805) (-551.984) (-553.270) [-552.431] * (-550.856) [-553.441] (-553.863) (-551.174) -- 0:00:38
353500 -- (-553.909) (-551.593) (-551.649) [-553.482] * [-552.049] (-552.265) (-553.492) (-554.031) -- 0:00:38
354000 -- (-551.851) (-551.454) [-551.719] (-550.497) * (-552.150) [-551.571] (-553.368) (-554.061) -- 0:00:38
354500 -- (-552.819) (-551.678) (-551.467) [-551.424] * (-550.810) (-551.593) (-556.943) [-551.598] -- 0:00:38
355000 -- (-550.015) (-551.511) [-551.554] (-551.718) * [-552.526] (-555.269) (-552.432) (-551.423) -- 0:00:38
Average standard deviation of split frequencies: 0.007789
355500 -- (-554.862) [-552.633] (-555.256) (-554.326) * (-552.627) (-551.852) (-551.436) [-551.607] -- 0:00:38
356000 -- [-550.621] (-550.324) (-553.985) (-553.086) * [-550.278] (-552.910) (-551.160) (-551.495) -- 0:00:37
356500 -- (-552.406) (-552.078) (-551.326) [-551.438] * (-551.849) [-551.157] (-551.508) (-551.942) -- 0:00:37
357000 -- (-550.935) (-553.184) (-551.214) [-551.909] * [-550.678] (-550.036) (-553.189) (-551.411) -- 0:00:37
357500 -- (-554.073) (-556.235) (-553.994) [-551.164] * (-552.713) [-553.456] (-552.129) (-556.056) -- 0:00:37
358000 -- (-553.939) (-556.540) [-554.595] (-551.110) * (-551.132) (-551.370) [-551.031] (-553.380) -- 0:00:37
358500 -- (-552.655) [-555.110] (-557.667) (-551.722) * (-551.798) (-552.545) [-552.643] (-552.751) -- 0:00:37
359000 -- (-550.887) (-555.526) [-553.645] (-552.715) * (-560.182) (-555.255) (-552.738) [-553.920] -- 0:00:37
359500 -- (-552.057) [-552.904] (-552.197) (-552.832) * (-551.986) [-552.322] (-553.425) (-552.536) -- 0:00:37
360000 -- (-551.828) [-551.071] (-552.889) (-551.730) * (-554.944) [-555.126] (-551.571) (-558.048) -- 0:00:37
Average standard deviation of split frequencies: 0.008765
360500 -- (-550.669) (-553.898) (-554.576) [-551.931] * (-553.218) (-552.590) [-550.199] (-551.590) -- 0:00:37
361000 -- (-550.332) [-551.183] (-555.723) (-550.943) * (-551.230) (-552.809) [-552.641] (-551.039) -- 0:00:38
361500 -- (-551.761) [-551.329] (-555.259) (-554.618) * (-550.994) (-553.337) [-551.791] (-552.535) -- 0:00:38
362000 -- (-556.735) (-551.098) [-552.737] (-553.673) * [-552.523] (-551.183) (-550.435) (-550.760) -- 0:00:38
362500 -- (-551.342) (-552.244) [-555.715] (-553.147) * [-556.860] (-555.248) (-551.223) (-553.699) -- 0:00:38
363000 -- (-550.481) [-549.980] (-557.117) (-553.263) * (-559.460) (-552.067) [-551.676] (-553.727) -- 0:00:38
363500 -- (-550.211) (-552.331) [-552.532] (-551.408) * (-560.780) (-551.222) [-551.759] (-553.888) -- 0:00:38
364000 -- [-550.998] (-552.077) (-552.326) (-551.415) * (-553.625) [-550.892] (-556.071) (-551.208) -- 0:00:38
364500 -- [-550.692] (-554.112) (-551.993) (-552.164) * (-554.857) (-552.977) (-557.547) [-551.704] -- 0:00:38
365000 -- (-551.002) (-552.905) (-555.974) [-551.750] * (-551.105) (-552.449) [-550.792] (-552.499) -- 0:00:38
Average standard deviation of split frequencies: 0.008658
365500 -- (-552.117) [-555.414] (-554.597) (-555.690) * [-551.509] (-551.409) (-550.467) (-554.893) -- 0:00:38
366000 -- [-552.089] (-550.654) (-554.038) (-560.046) * (-551.214) [-550.660] (-550.503) (-553.750) -- 0:00:38
366500 -- [-551.190] (-550.486) (-550.897) (-553.065) * (-551.163) (-550.493) (-552.898) [-551.940] -- 0:00:38
367000 -- (-552.662) (-555.920) [-553.699] (-555.701) * (-550.803) (-554.360) (-550.536) [-552.707] -- 0:00:37
367500 -- (-553.596) (-556.333) (-559.730) [-553.081] * (-550.343) (-554.696) [-550.630] (-554.747) -- 0:00:37
368000 -- (-550.326) [-554.286] (-552.029) (-552.237) * (-550.555) (-554.692) [-551.070] (-554.340) -- 0:00:37
368500 -- (-552.078) (-557.788) [-552.508] (-554.963) * (-550.150) (-552.113) [-550.691] (-551.910) -- 0:00:37
369000 -- [-552.146] (-553.338) (-550.983) (-551.399) * (-551.464) (-551.696) [-551.741] (-554.682) -- 0:00:37
369500 -- [-552.916] (-553.129) (-552.330) (-553.199) * (-551.244) [-552.533] (-553.458) (-552.863) -- 0:00:37
370000 -- (-553.296) (-553.796) (-550.787) [-550.325] * [-551.776] (-552.131) (-553.750) (-552.321) -- 0:00:37
Average standard deviation of split frequencies: 0.008154
370500 -- (-550.880) (-553.461) [-552.736] (-553.006) * [-552.975] (-550.556) (-553.074) (-553.391) -- 0:00:37
371000 -- (-550.746) (-555.954) [-553.616] (-552.943) * (-550.595) (-550.542) (-550.592) [-551.775] -- 0:00:37
371500 -- (-552.357) (-553.112) (-550.954) [-553.466] * (-553.746) (-551.225) [-552.018] (-553.177) -- 0:00:37
372000 -- (-551.140) [-550.050] (-550.753) (-554.647) * (-552.766) (-551.110) [-551.329] (-556.162) -- 0:00:37
372500 -- [-554.170] (-552.238) (-562.368) (-553.152) * (-552.414) [-551.933] (-552.313) (-553.192) -- 0:00:37
373000 -- (-558.397) (-551.365) [-551.744] (-552.196) * [-552.404] (-551.503) (-551.712) (-552.673) -- 0:00:36
373500 -- (-552.007) (-551.380) (-550.594) [-553.675] * [-552.178] (-552.431) (-551.593) (-554.402) -- 0:00:36
374000 -- (-552.109) [-552.735] (-551.190) (-558.157) * [-550.710] (-554.771) (-554.011) (-552.609) -- 0:00:36
374500 -- (-554.391) (-552.666) [-552.191] (-557.170) * (-551.379) (-552.124) (-555.406) [-550.923] -- 0:00:36
375000 -- (-551.174) (-553.252) (-553.696) [-552.070] * (-550.602) [-551.299] (-552.721) (-550.595) -- 0:00:36
Average standard deviation of split frequencies: 0.008149
375500 -- (-552.156) (-552.779) (-559.256) [-551.474] * (-550.843) (-551.673) [-554.336] (-553.428) -- 0:00:36
376000 -- [-551.561] (-551.523) (-550.474) (-551.796) * (-551.251) (-554.687) (-552.569) [-553.287] -- 0:00:36
376500 -- (-552.395) (-550.845) (-553.987) [-550.851] * (-552.701) (-555.601) (-552.009) [-554.563] -- 0:00:36
377000 -- [-550.890] (-552.252) (-551.237) (-553.101) * (-552.881) [-553.807] (-553.315) (-552.229) -- 0:00:36
377500 -- (-554.100) [-550.980] (-553.819) (-553.066) * (-551.291) [-551.167] (-559.760) (-551.844) -- 0:00:37
378000 -- (-552.952) (-552.551) (-554.276) [-554.643] * (-560.281) [-552.235] (-554.223) (-553.152) -- 0:00:37
378500 -- (-555.121) (-551.412) (-555.238) [-551.472] * (-550.557) [-551.344] (-553.442) (-552.379) -- 0:00:37
379000 -- (-552.815) (-556.792) (-554.728) [-554.422] * (-550.708) [-551.352] (-553.863) (-551.472) -- 0:00:37
379500 -- [-552.525] (-558.188) (-553.438) (-552.982) * (-551.967) (-551.370) [-556.914] (-552.636) -- 0:00:37
380000 -- (-552.296) [-552.523] (-550.685) (-550.712) * (-554.230) [-551.213] (-553.315) (-558.036) -- 0:00:37
Average standard deviation of split frequencies: 0.009033
380500 -- (-552.666) (-551.461) [-551.139] (-554.499) * [-553.431] (-551.932) (-552.681) (-551.643) -- 0:00:37
381000 -- [-556.743] (-552.315) (-556.360) (-553.234) * (-552.635) (-552.022) [-553.271] (-552.662) -- 0:00:37
381500 -- (-558.560) (-550.779) [-552.294] (-551.365) * [-551.410] (-553.451) (-550.682) (-552.609) -- 0:00:37
382000 -- (-551.510) (-552.971) (-550.692) [-552.819] * (-550.545) [-550.499] (-556.961) (-553.073) -- 0:00:37
382500 -- (-550.946) (-552.357) (-560.448) [-552.791] * (-551.947) (-552.116) [-550.463] (-553.569) -- 0:00:37
383000 -- (-551.472) [-554.963] (-554.053) (-553.282) * (-551.422) (-552.136) (-555.859) [-551.051] -- 0:00:37
383500 -- (-552.334) (-552.257) [-550.688] (-553.292) * (-554.792) (-551.571) (-552.419) [-550.947] -- 0:00:36
384000 -- (-553.402) (-551.416) [-551.796] (-555.144) * (-551.067) (-551.966) (-551.124) [-552.987] -- 0:00:36
384500 -- [-553.952] (-550.901) (-550.793) (-552.232) * [-552.393] (-551.036) (-552.986) (-554.473) -- 0:00:36
385000 -- (-551.024) (-551.061) [-555.349] (-552.572) * [-550.715] (-551.567) (-552.605) (-550.904) -- 0:00:36
Average standard deviation of split frequencies: 0.008621
385500 -- [-551.704] (-552.437) (-552.470) (-556.642) * (-558.245) (-550.276) [-550.963] (-550.792) -- 0:00:36
386000 -- (-552.816) (-553.762) [-554.073] (-552.636) * (-553.059) (-551.722) [-552.101] (-551.602) -- 0:00:36
386500 -- (-550.798) (-554.535) (-556.597) [-551.097] * [-551.028] (-553.501) (-553.960) (-551.789) -- 0:00:36
387000 -- (-552.227) (-561.547) (-553.938) [-552.790] * (-553.169) (-552.011) (-552.846) [-551.898] -- 0:00:36
387500 -- [-551.706] (-556.643) (-555.359) (-550.051) * (-552.479) [-552.537] (-557.347) (-550.281) -- 0:00:36
388000 -- (-553.050) (-556.334) [-553.191] (-552.282) * [-552.536] (-551.909) (-552.315) (-551.523) -- 0:00:36
388500 -- (-553.822) (-554.348) [-550.333] (-551.656) * (-551.546) [-552.209] (-550.576) (-553.764) -- 0:00:36
389000 -- (-553.570) [-553.440] (-551.988) (-555.003) * (-551.213) (-551.124) (-551.276) [-552.129] -- 0:00:36
389500 -- (-552.865) (-551.682) [-552.457] (-553.248) * (-551.854) [-550.960] (-551.861) (-552.128) -- 0:00:36
390000 -- (-553.539) (-554.726) [-551.663] (-550.749) * [-554.415] (-552.597) (-553.055) (-553.003) -- 0:00:35
Average standard deviation of split frequencies: 0.007453
390500 -- (-555.000) (-554.151) [-553.605] (-551.179) * [-554.269] (-555.550) (-551.673) (-551.232) -- 0:00:35
391000 -- (-551.853) (-556.134) [-551.024] (-554.413) * (-555.016) (-554.909) [-552.009] (-551.187) -- 0:00:35
391500 -- (-552.456) (-552.975) (-558.028) [-552.065] * (-554.252) [-551.710] (-550.794) (-553.427) -- 0:00:35
392000 -- (-555.436) (-550.288) (-556.643) [-554.121] * (-552.828) (-558.477) (-551.455) [-552.871] -- 0:00:35
392500 -- (-553.190) [-551.341] (-553.540) (-551.745) * (-551.484) [-550.594] (-551.763) (-550.816) -- 0:00:35
393000 -- (-550.937) (-551.937) (-551.633) [-551.367] * [-550.662] (-558.847) (-551.671) (-550.402) -- 0:00:35
393500 -- (-551.929) (-553.947) (-554.851) [-550.774] * (-551.156) (-551.716) [-551.223] (-550.932) -- 0:00:35
394000 -- [-552.503] (-551.038) (-552.750) (-552.566) * (-551.054) [-554.645] (-552.591) (-553.003) -- 0:00:35
394500 -- [-550.882] (-553.647) (-553.427) (-552.776) * (-551.188) [-551.922] (-556.117) (-552.619) -- 0:00:36
395000 -- (-551.137) (-555.336) (-551.178) [-554.791] * (-552.779) [-550.329] (-554.930) (-551.791) -- 0:00:36
Average standard deviation of split frequencies: 0.007493
395500 -- (-553.571) (-551.464) (-554.227) [-551.493] * [-550.530] (-552.499) (-553.457) (-552.398) -- 0:00:36
396000 -- (-552.508) (-555.467) (-555.392) [-551.330] * (-552.328) (-555.333) [-550.243] (-552.483) -- 0:00:36
396500 -- (-551.109) (-554.393) [-556.766] (-550.672) * (-553.635) (-557.502) (-550.215) [-552.156] -- 0:00:36
397000 -- [-550.652] (-551.909) (-550.977) (-552.202) * (-552.457) (-552.324) [-550.818] (-551.673) -- 0:00:36
397500 -- (-550.307) [-554.746] (-551.689) (-552.258) * [-552.325] (-551.860) (-552.357) (-551.389) -- 0:00:36
398000 -- (-551.779) (-552.666) [-551.254] (-555.289) * (-550.514) (-550.348) (-553.255) [-551.798] -- 0:00:36
398500 -- (-553.301) (-550.478) [-550.809] (-556.446) * [-551.700] (-550.461) (-553.726) (-551.644) -- 0:00:36
399000 -- [-553.356] (-551.426) (-551.072) (-550.576) * (-554.345) (-551.805) [-553.999] (-551.842) -- 0:00:36
399500 -- [-555.070] (-552.405) (-555.080) (-550.554) * (-553.536) (-557.968) (-554.989) [-552.710] -- 0:00:36
400000 -- [-552.208] (-553.528) (-551.888) (-550.359) * (-551.292) [-553.480] (-555.883) (-552.602) -- 0:00:36
Average standard deviation of split frequencies: 0.007890
400500 -- (-551.802) (-553.734) [-550.892] (-552.431) * (-550.936) (-551.196) (-553.456) [-550.833] -- 0:00:35
401000 -- (-550.719) (-551.216) (-553.179) [-550.501] * (-550.842) [-551.572] (-554.067) (-552.089) -- 0:00:35
401500 -- [-551.604] (-551.362) (-550.590) (-550.646) * (-551.960) (-551.038) [-553.183] (-552.299) -- 0:00:35
402000 -- [-551.549] (-553.715) (-550.853) (-552.599) * (-551.957) (-552.162) (-551.349) [-550.838] -- 0:00:35
402500 -- [-550.934] (-553.560) (-552.832) (-553.254) * (-551.280) (-552.522) [-552.230] (-551.254) -- 0:00:35
403000 -- (-551.396) (-553.789) [-551.519] (-550.531) * (-553.926) (-552.331) [-551.714] (-554.417) -- 0:00:35
403500 -- (-553.140) [-554.813] (-551.216) (-550.603) * [-552.243] (-556.629) (-551.946) (-550.689) -- 0:00:35
404000 -- [-551.911] (-553.188) (-552.104) (-550.603) * (-553.632) (-555.114) (-553.923) [-550.386] -- 0:00:35
404500 -- (-551.962) (-552.153) (-553.827) [-550.376] * (-556.049) (-555.566) [-552.835] (-552.098) -- 0:00:35
405000 -- [-550.616] (-550.457) (-552.359) (-551.306) * (-551.404) (-551.201) (-555.320) [-551.697] -- 0:00:35
Average standard deviation of split frequencies: 0.008773
405500 -- [-550.845] (-551.065) (-559.261) (-551.249) * (-554.441) (-551.788) (-553.305) [-552.718] -- 0:00:35
406000 -- (-551.705) [-552.451] (-551.793) (-549.994) * (-553.887) [-553.468] (-552.071) (-551.552) -- 0:00:35
406500 -- (-555.800) (-550.771) (-552.140) [-551.424] * (-550.370) [-552.343] (-550.434) (-550.185) -- 0:00:35
407000 -- (-551.090) (-552.921) [-552.107] (-556.913) * (-551.518) [-552.595] (-551.348) (-552.285) -- 0:00:34
407500 -- (-551.206) (-552.168) [-551.390] (-550.803) * (-552.120) (-552.073) [-551.395] (-550.879) -- 0:00:34
408000 -- [-551.787] (-551.944) (-551.591) (-551.408) * [-559.037] (-554.678) (-553.987) (-550.677) -- 0:00:34
408500 -- (-550.741) (-551.123) (-553.241) [-551.561] * (-553.489) (-555.082) [-556.855] (-554.111) -- 0:00:34
409000 -- (-553.251) (-553.248) [-555.341] (-551.785) * [-552.535] (-552.768) (-552.432) (-554.648) -- 0:00:34
409500 -- (-551.838) [-551.801] (-551.523) (-550.930) * (-551.107) (-554.404) [-553.461] (-550.947) -- 0:00:34
410000 -- (-552.758) (-553.757) (-553.841) [-550.754] * (-552.741) (-551.743) [-551.740] (-551.478) -- 0:00:34
Average standard deviation of split frequencies: 0.009056
410500 -- (-551.454) [-552.099] (-551.039) (-552.344) * [-553.035] (-551.968) (-553.761) (-550.586) -- 0:00:34
411000 -- (-552.208) [-550.395] (-552.618) (-553.217) * (-556.353) [-552.074] (-553.686) (-551.093) -- 0:00:35
411500 -- (-551.844) (-553.763) [-550.829] (-551.864) * [-551.407] (-550.728) (-554.548) (-552.452) -- 0:00:35
412000 -- (-553.019) (-553.496) [-552.049] (-551.824) * (-552.251) (-551.852) (-554.361) [-551.926] -- 0:00:35
412500 -- (-551.295) (-554.796) [-555.179] (-553.220) * [-553.617] (-554.017) (-554.654) (-553.601) -- 0:00:35
413000 -- (-550.571) [-550.509] (-554.733) (-553.002) * (-551.856) (-553.995) [-554.005] (-551.513) -- 0:00:35
413500 -- [-551.877] (-551.442) (-554.089) (-551.958) * [-551.405] (-551.290) (-549.861) (-551.860) -- 0:00:35
414000 -- (-551.571) [-554.349] (-552.081) (-555.694) * (-553.712) (-552.650) [-549.991] (-558.140) -- 0:00:35
414500 -- (-552.206) (-551.086) (-553.497) [-552.339] * [-552.129] (-551.632) (-551.227) (-551.286) -- 0:00:35
415000 -- [-551.827] (-551.344) (-553.859) (-551.154) * (-551.909) (-553.532) (-550.746) [-551.256] -- 0:00:35
Average standard deviation of split frequencies: 0.009254
415500 -- [-551.500] (-550.362) (-550.815) (-552.272) * (-550.345) (-551.631) (-550.521) [-550.963] -- 0:00:35
416000 -- [-553.625] (-551.200) (-550.040) (-555.439) * (-552.603) (-551.182) [-551.581] (-552.298) -- 0:00:35
416500 -- (-556.054) (-552.584) [-550.750] (-553.292) * [-551.368] (-553.605) (-553.760) (-550.948) -- 0:00:35
417000 -- (-552.966) [-555.402] (-552.181) (-553.950) * (-551.414) (-558.003) (-553.657) [-551.186] -- 0:00:34
417500 -- [-552.919] (-551.446) (-551.923) (-553.486) * (-551.045) (-553.119) (-558.088) [-551.386] -- 0:00:34
418000 -- [-553.889] (-553.841) (-552.475) (-552.424) * [-551.869] (-553.770) (-551.143) (-557.465) -- 0:00:34
418500 -- (-552.167) (-551.454) [-554.273] (-552.500) * (-552.411) (-554.263) (-550.936) [-550.769] -- 0:00:34
419000 -- (-557.182) (-551.857) (-550.976) [-550.875] * (-554.263) (-559.384) (-552.768) [-551.109] -- 0:00:34
419500 -- [-553.241] (-551.369) (-550.399) (-550.519) * (-552.518) (-555.368) (-556.807) [-551.077] -- 0:00:34
420000 -- (-554.017) [-552.961] (-551.200) (-552.152) * (-552.619) (-551.762) (-554.896) [-551.530] -- 0:00:34
Average standard deviation of split frequencies: 0.008903
420500 -- (-554.787) (-551.971) [-556.459] (-552.980) * (-553.434) [-551.330] (-551.768) (-555.764) -- 0:00:34
421000 -- (-550.599) (-551.422) (-554.800) [-551.721] * (-551.546) [-550.408] (-551.644) (-553.068) -- 0:00:34
421500 -- [-554.223] (-556.474) (-554.497) (-550.816) * (-551.207) (-552.287) (-552.974) [-553.282] -- 0:00:34
422000 -- [-553.907] (-550.932) (-557.780) (-550.397) * [-552.487] (-552.473) (-554.944) (-552.487) -- 0:00:34
422500 -- (-550.397) (-551.475) [-554.697] (-553.983) * (-552.520) [-550.809] (-553.193) (-558.860) -- 0:00:34
423000 -- (-552.500) (-550.434) (-551.196) [-551.283] * [-551.843] (-558.965) (-555.313) (-551.866) -- 0:00:34
423500 -- (-551.454) (-551.797) [-554.001] (-549.947) * (-551.516) (-556.834) (-555.940) [-553.556] -- 0:00:34
424000 -- (-554.567) (-553.116) (-552.448) [-550.937] * (-551.486) (-553.772) (-550.670) [-550.638] -- 0:00:33
424500 -- [-551.673] (-552.002) (-551.116) (-551.415) * (-553.046) (-550.762) (-552.005) [-552.527] -- 0:00:33
425000 -- (-551.250) (-550.443) [-552.085] (-554.529) * (-551.456) (-552.023) (-560.144) [-551.134] -- 0:00:33
Average standard deviation of split frequencies: 0.009283
425500 -- (-550.389) [-552.575] (-551.659) (-555.761) * (-557.320) (-550.091) (-551.330) [-551.132] -- 0:00:33
426000 -- (-551.200) (-554.459) (-551.139) [-551.523] * (-556.893) (-550.242) [-552.653] (-552.962) -- 0:00:33
426500 -- (-550.360) (-550.248) (-553.772) [-551.318] * (-554.987) (-550.248) (-552.145) [-551.264] -- 0:00:33
427000 -- [-552.141] (-551.957) (-553.126) (-552.465) * (-552.017) (-552.139) [-553.192] (-553.538) -- 0:00:33
427500 -- (-551.130) [-550.690] (-552.011) (-550.620) * (-552.686) (-552.200) [-558.017] (-556.285) -- 0:00:34
428000 -- (-549.993) (-553.762) (-552.308) [-551.980] * (-553.896) (-550.597) [-550.639] (-552.674) -- 0:00:34
428500 -- [-551.292] (-551.601) (-552.269) (-556.055) * (-551.305) (-551.898) (-552.002) [-550.851] -- 0:00:34
429000 -- (-551.916) [-556.214] (-550.496) (-555.364) * [-550.708] (-552.303) (-550.910) (-552.154) -- 0:00:34
429500 -- (-551.948) (-551.864) (-551.497) [-553.401] * [-551.251] (-550.976) (-550.442) (-552.418) -- 0:00:34
430000 -- (-553.806) (-556.643) (-553.663) [-551.856] * (-553.940) (-550.976) (-549.995) [-552.115] -- 0:00:34
Average standard deviation of split frequencies: 0.008757
430500 -- (-551.268) (-555.554) [-554.071] (-551.749) * (-555.055) (-552.544) [-552.941] (-551.784) -- 0:00:34
431000 -- [-551.672] (-552.779) (-552.260) (-550.712) * (-551.133) (-555.725) [-551.760] (-553.163) -- 0:00:34
431500 -- [-551.872] (-552.715) (-553.237) (-554.698) * (-551.975) [-551.826] (-551.790) (-554.774) -- 0:00:34
432000 -- (-554.933) [-552.518] (-552.322) (-551.579) * [-550.937] (-553.540) (-551.176) (-551.267) -- 0:00:34
432500 -- [-551.478] (-553.200) (-550.736) (-550.709) * (-554.012) (-551.684) (-550.174) [-549.996] -- 0:00:34
433000 -- (-552.657) (-554.302) [-550.852] (-552.359) * [-551.302] (-550.430) (-551.125) (-550.551) -- 0:00:34
433500 -- (-553.762) (-554.756) [-551.752] (-551.384) * [-550.689] (-551.145) (-552.758) (-551.653) -- 0:00:33
434000 -- (-554.128) [-550.350] (-551.876) (-553.756) * (-555.714) (-550.616) (-554.455) [-551.140] -- 0:00:33
434500 -- (-554.290) (-551.227) (-550.983) [-556.999] * (-551.474) (-551.586) [-550.551] (-553.905) -- 0:00:33
435000 -- (-555.986) [-551.824] (-552.670) (-552.488) * (-551.475) (-551.618) (-551.723) [-552.737] -- 0:00:33
Average standard deviation of split frequencies: 0.008763
435500 -- [-552.554] (-550.625) (-552.777) (-554.693) * [-552.198] (-552.984) (-551.069) (-556.107) -- 0:00:33
436000 -- [-552.876] (-553.284) (-551.110) (-555.066) * (-550.360) (-552.351) (-551.029) [-551.368] -- 0:00:33
436500 -- (-553.847) [-551.224] (-551.306) (-559.297) * (-550.054) (-552.819) (-551.593) [-550.859] -- 0:00:33
437000 -- (-551.443) (-556.443) [-550.782] (-553.822) * (-553.519) (-554.587) (-553.025) [-555.018] -- 0:00:33
437500 -- [-551.921] (-552.675) (-551.099) (-552.006) * (-552.428) [-551.564] (-550.842) (-554.728) -- 0:00:33
438000 -- [-552.363] (-553.383) (-551.377) (-553.848) * (-553.416) (-551.919) (-553.921) [-552.985] -- 0:00:33
438500 -- (-553.771) (-554.318) (-550.774) [-551.958] * (-552.868) (-551.406) [-553.743] (-551.565) -- 0:00:33
439000 -- (-551.775) (-556.550) [-552.397] (-551.563) * [-552.603] (-552.135) (-552.960) (-551.123) -- 0:00:33
439500 -- [-551.865] (-552.730) (-550.885) (-554.773) * [-551.607] (-552.479) (-552.169) (-553.404) -- 0:00:33
440000 -- [-553.978] (-553.702) (-551.416) (-554.954) * [-550.782] (-553.568) (-554.544) (-557.239) -- 0:00:33
Average standard deviation of split frequencies: 0.008840
440500 -- (-551.698) (-556.237) (-551.446) [-550.260] * (-550.692) [-556.174] (-551.956) (-551.348) -- 0:00:33
441000 -- (-554.362) (-552.154) [-551.292] (-551.179) * [-550.346] (-550.735) (-552.967) (-554.455) -- 0:00:32
441500 -- (-557.235) (-554.087) (-552.572) [-554.281] * (-552.896) (-551.521) [-550.033] (-552.324) -- 0:00:32
442000 -- [-551.250] (-553.647) (-552.350) (-552.312) * [-551.450] (-551.302) (-552.041) (-551.793) -- 0:00:32
442500 -- (-551.915) (-551.908) [-553.361] (-552.120) * (-553.601) (-556.510) [-550.712] (-552.289) -- 0:00:32
443000 -- (-552.114) (-553.123) [-551.828] (-551.012) * (-552.986) (-554.278) [-551.176] (-551.478) -- 0:00:32
443500 -- (-552.438) (-552.041) (-553.771) [-551.230] * (-551.791) [-553.995] (-551.275) (-552.254) -- 0:00:32
444000 -- (-553.264) [-551.951] (-551.809) (-554.708) * (-553.883) (-553.290) [-553.302] (-552.421) -- 0:00:32
444500 -- (-553.699) (-552.312) [-551.764] (-550.620) * (-551.084) [-550.524] (-551.177) (-552.825) -- 0:00:33
445000 -- (-553.172) (-552.463) [-552.752] (-551.103) * (-553.400) [-551.132] (-552.320) (-551.023) -- 0:00:33
Average standard deviation of split frequencies: 0.008734
445500 -- [-550.711] (-551.377) (-551.644) (-550.868) * (-552.565) (-551.378) (-556.722) [-551.772] -- 0:00:33
446000 -- [-551.658] (-552.296) (-552.959) (-551.011) * (-552.596) (-555.903) [-552.290] (-551.627) -- 0:00:33
446500 -- (-552.082) (-553.260) [-552.019] (-551.036) * (-558.452) (-556.116) [-551.203] (-553.489) -- 0:00:33
447000 -- [-554.129] (-551.248) (-550.999) (-552.922) * (-555.854) (-554.774) (-550.951) [-550.887] -- 0:00:33
447500 -- [-552.024] (-551.296) (-550.747) (-551.019) * [-551.673] (-553.232) (-552.825) (-552.489) -- 0:00:33
448000 -- (-550.871) (-550.522) (-553.271) [-550.708] * (-552.516) (-551.859) [-550.427] (-557.292) -- 0:00:33
448500 -- (-550.996) (-550.207) (-551.651) [-550.723] * (-551.939) (-550.848) (-556.710) [-552.132] -- 0:00:33
449000 -- (-552.043) [-550.904] (-551.713) (-552.451) * (-551.456) [-552.123] (-555.649) (-552.146) -- 0:00:33
449500 -- (-552.722) [-550.917] (-552.445) (-552.452) * (-554.449) (-551.837) (-554.077) [-554.313] -- 0:00:33
450000 -- (-554.538) (-552.793) (-554.335) [-551.239] * (-552.601) (-552.784) (-552.433) [-553.475] -- 0:00:33
Average standard deviation of split frequencies: 0.008891
450500 -- (-551.538) [-550.713] (-550.429) (-556.663) * (-551.293) [-550.532] (-550.757) (-554.214) -- 0:00:32
451000 -- (-552.932) (-551.683) (-551.961) [-552.478] * (-551.680) [-550.225] (-550.403) (-555.518) -- 0:00:32
451500 -- [-552.527] (-555.824) (-551.712) (-551.533) * [-554.578] (-554.243) (-550.586) (-552.143) -- 0:00:32
452000 -- (-553.279) (-553.650) (-551.760) [-552.940] * [-556.511] (-550.430) (-552.371) (-551.586) -- 0:00:32
452500 -- (-556.939) (-555.579) [-550.722] (-553.215) * (-563.717) (-550.158) [-551.516] (-553.385) -- 0:00:32
453000 -- (-553.118) (-554.061) (-550.547) [-553.319] * [-552.365] (-555.778) (-552.566) (-552.564) -- 0:00:32
453500 -- (-551.758) (-551.574) (-551.535) [-553.559] * (-552.847) [-553.834] (-551.176) (-553.431) -- 0:00:32
454000 -- (-553.676) [-553.671] (-549.932) (-551.769) * (-551.033) (-551.353) (-553.202) [-551.670] -- 0:00:32
454500 -- [-552.020] (-555.050) (-551.072) (-553.118) * (-551.930) (-554.524) (-554.027) [-553.818] -- 0:00:32
455000 -- (-550.581) [-552.516] (-550.907) (-551.183) * (-551.984) [-552.764] (-551.377) (-553.556) -- 0:00:32
Average standard deviation of split frequencies: 0.009132
455500 -- (-555.665) (-552.376) [-553.147] (-554.244) * (-550.767) [-550.462] (-552.239) (-549.826) -- 0:00:32
456000 -- (-552.074) [-551.436] (-552.147) (-555.571) * (-553.323) [-550.607] (-551.869) (-552.095) -- 0:00:32
456500 -- (-553.112) [-550.484] (-551.615) (-553.123) * (-555.550) (-551.247) (-552.336) [-551.027] -- 0:00:32
457000 -- (-557.795) (-550.332) (-550.919) [-551.014] * (-552.256) [-550.684] (-559.348) (-555.468) -- 0:00:32
457500 -- (-553.490) (-555.688) (-554.330) [-555.094] * (-552.322) [-551.299] (-551.182) (-555.319) -- 0:00:32
458000 -- (-551.639) [-554.009] (-554.486) (-554.963) * [-550.434] (-550.699) (-553.305) (-555.992) -- 0:00:31
458500 -- (-553.856) (-553.998) [-550.351] (-552.108) * (-553.794) [-552.542] (-552.955) (-554.719) -- 0:00:31
459000 -- [-554.125] (-553.998) (-551.351) (-551.959) * [-552.546] (-553.117) (-551.067) (-553.991) -- 0:00:31
459500 -- (-552.472) (-559.417) [-550.211] (-551.246) * [-553.744] (-554.943) (-550.559) (-552.795) -- 0:00:31
460000 -- (-556.024) [-552.037] (-550.643) (-552.842) * (-552.831) (-553.575) [-550.597] (-552.167) -- 0:00:31
Average standard deviation of split frequencies: 0.009608
460500 -- (-554.110) [-550.128] (-550.730) (-553.042) * (-552.274) (-550.138) (-552.441) [-550.616] -- 0:00:31
461000 -- (-551.647) (-553.433) [-550.556] (-553.982) * (-555.002) [-549.892] (-557.895) (-557.223) -- 0:00:32
461500 -- (-551.336) (-553.913) [-551.114] (-550.745) * [-554.717] (-549.979) (-551.293) (-553.229) -- 0:00:32
462000 -- (-551.183) (-552.672) [-550.824] (-551.431) * [-553.827] (-550.482) (-552.334) (-554.632) -- 0:00:32
462500 -- [-552.935] (-551.707) (-551.642) (-553.859) * (-552.469) (-551.578) (-557.403) [-554.535] -- 0:00:32
463000 -- (-550.418) [-551.970] (-552.488) (-553.814) * (-551.870) [-550.319] (-551.450) (-552.881) -- 0:00:32
463500 -- (-551.437) [-551.913] (-551.151) (-554.016) * [-554.249] (-556.949) (-553.504) (-553.618) -- 0:00:32
464000 -- (-559.802) [-554.227] (-553.336) (-551.243) * (-550.540) (-553.276) [-552.124] (-550.467) -- 0:00:32
464500 -- (-550.853) [-552.153] (-553.023) (-552.008) * (-554.001) [-553.966] (-551.942) (-552.808) -- 0:00:32
465000 -- (-553.464) (-552.586) (-552.499) [-552.930] * (-551.903) (-551.683) (-554.893) [-552.396] -- 0:00:32
Average standard deviation of split frequencies: 0.009477
465500 -- (-552.737) [-551.325] (-553.764) (-551.828) * (-551.595) (-551.968) (-552.489) [-552.462] -- 0:00:32
466000 -- (-557.130) [-550.685] (-551.424) (-551.756) * (-553.319) [-552.934] (-552.247) (-551.453) -- 0:00:32
466500 -- (-555.361) (-551.328) [-552.907] (-553.018) * (-554.253) (-551.198) (-551.690) [-552.312] -- 0:00:32
467000 -- [-552.859] (-551.525) (-553.886) (-552.301) * (-551.165) (-553.202) [-551.610] (-551.570) -- 0:00:31
467500 -- (-553.825) (-552.320) (-552.422) [-553.044] * (-552.726) (-551.543) [-555.657] (-550.502) -- 0:00:31
468000 -- (-553.265) [-550.660] (-550.318) (-552.427) * (-550.807) (-552.677) (-552.880) [-551.461] -- 0:00:31
468500 -- (-551.886) (-550.734) [-554.063] (-552.099) * (-553.630) (-550.803) (-552.861) [-551.958] -- 0:00:31
469000 -- (-552.372) [-551.054] (-553.257) (-551.084) * [-551.580] (-551.605) (-553.630) (-552.388) -- 0:00:31
469500 -- (-555.293) (-551.848) [-550.842] (-552.916) * (-553.469) [-550.917] (-552.916) (-550.622) -- 0:00:31
470000 -- (-552.570) (-552.524) (-550.670) [-558.300] * (-551.893) (-551.660) [-552.128] (-555.127) -- 0:00:31
Average standard deviation of split frequencies: 0.008958
470500 -- (-553.379) [-553.891] (-554.484) (-553.301) * (-551.525) [-554.826] (-553.626) (-558.343) -- 0:00:31
471000 -- (-550.775) [-555.606] (-553.547) (-552.495) * (-552.500) (-557.591) [-553.426] (-556.395) -- 0:00:31
471500 -- (-551.459) [-553.105] (-553.445) (-553.176) * [-555.321] (-555.268) (-552.681) (-550.365) -- 0:00:31
472000 -- (-553.367) (-551.147) [-551.988] (-554.475) * [-551.302] (-552.407) (-554.033) (-552.713) -- 0:00:31
472500 -- (-557.009) [-550.030] (-557.531) (-550.703) * [-550.983] (-553.553) (-551.651) (-553.427) -- 0:00:31
473000 -- [-550.151] (-552.913) (-553.016) (-551.999) * (-552.177) (-556.577) (-552.614) [-553.438] -- 0:00:31
473500 -- (-552.616) (-552.532) (-560.199) [-551.782] * (-563.287) (-550.866) [-551.859] (-550.816) -- 0:00:31
474000 -- (-551.217) (-550.864) (-551.127) [-552.632] * (-555.726) (-551.701) [-554.111] (-552.365) -- 0:00:31
474500 -- [-555.557] (-550.335) (-554.760) (-553.295) * [-551.496] (-551.049) (-551.168) (-552.855) -- 0:00:31
475000 -- (-551.043) [-555.571] (-552.920) (-551.137) * [-553.537] (-551.848) (-554.365) (-553.571) -- 0:00:30
Average standard deviation of split frequencies: 0.009612
475500 -- (-551.692) (-551.817) (-551.622) [-551.262] * (-551.916) (-551.051) (-550.242) [-551.963] -- 0:00:30
476000 -- (-551.556) [-551.793] (-554.545) (-553.566) * (-551.681) (-551.213) (-551.277) [-552.731] -- 0:00:30
476500 -- (-551.719) (-552.236) [-552.934] (-550.767) * (-553.053) (-551.124) (-552.014) [-551.051] -- 0:00:30
477000 -- (-551.037) (-552.721) (-550.357) [-550.755] * (-551.022) [-552.213] (-552.894) (-556.674) -- 0:00:30
477500 -- (-551.175) [-551.912] (-551.657) (-556.590) * (-554.161) [-551.429] (-554.855) (-552.892) -- 0:00:31
478000 -- [-553.023] (-552.196) (-551.317) (-558.717) * (-551.930) [-552.508] (-553.896) (-553.371) -- 0:00:31
478500 -- (-552.679) (-552.239) [-552.479] (-553.437) * [-551.312] (-555.332) (-556.308) (-553.174) -- 0:00:31
479000 -- [-550.591] (-554.721) (-550.260) (-552.170) * (-550.767) (-552.698) (-557.828) [-550.570] -- 0:00:31
479500 -- (-552.304) [-554.131] (-553.380) (-553.882) * (-552.628) (-552.772) (-552.630) [-551.595] -- 0:00:31
480000 -- (-550.957) (-553.113) [-551.143] (-551.166) * (-551.391) (-552.870) (-553.480) [-552.222] -- 0:00:31
Average standard deviation of split frequencies: 0.009208
480500 -- (-550.119) (-554.182) [-551.484] (-552.417) * (-553.832) (-551.814) (-557.305) [-553.819] -- 0:00:31
481000 -- (-553.103) (-556.202) [-550.656] (-556.020) * (-556.184) (-551.209) (-557.556) [-551.935] -- 0:00:31
481500 -- [-556.894] (-555.408) (-552.260) (-556.384) * (-552.602) [-551.404] (-552.789) (-553.014) -- 0:00:31
482000 -- [-554.327] (-551.528) (-555.234) (-555.253) * (-551.864) [-552.510] (-551.526) (-553.733) -- 0:00:31
482500 -- [-551.923] (-551.590) (-555.363) (-551.729) * (-552.618) (-550.541) (-556.408) [-550.336] -- 0:00:31
483000 -- (-551.119) (-552.673) [-552.137] (-553.912) * [-552.077] (-553.332) (-564.772) (-552.312) -- 0:00:31
483500 -- (-551.006) (-551.412) [-551.825] (-554.105) * [-554.657] (-553.945) (-554.261) (-552.657) -- 0:00:30
484000 -- (-552.372) (-553.051) (-559.021) [-553.495] * (-555.502) (-551.483) [-552.337] (-552.926) -- 0:00:30
484500 -- (-551.511) [-551.442] (-557.914) (-554.343) * (-551.548) [-550.247] (-555.747) (-552.828) -- 0:00:30
485000 -- [-553.033] (-555.618) (-550.519) (-552.361) * [-551.194] (-550.500) (-552.504) (-551.645) -- 0:00:30
Average standard deviation of split frequencies: 0.009754
485500 -- (-553.102) (-552.636) [-553.298] (-551.528) * (-553.365) (-551.184) [-550.773] (-554.555) -- 0:00:30
486000 -- (-551.451) (-550.609) (-552.883) [-552.221] * (-551.240) (-554.942) [-552.416] (-550.553) -- 0:00:30
486500 -- (-551.368) [-552.932] (-551.806) (-553.378) * [-551.832] (-551.673) (-558.447) (-551.715) -- 0:00:30
487000 -- (-550.352) (-555.804) [-552.710] (-550.958) * [-550.751] (-550.385) (-552.343) (-557.303) -- 0:00:30
487500 -- [-552.002] (-551.213) (-551.515) (-552.350) * (-552.985) [-550.604] (-555.058) (-556.040) -- 0:00:30
488000 -- (-551.541) (-550.941) [-552.114] (-551.940) * (-551.588) (-554.926) (-555.636) [-550.500] -- 0:00:30
488500 -- (-555.564) [-550.887] (-551.478) (-551.873) * (-550.188) (-551.794) (-553.258) [-553.086] -- 0:00:30
489000 -- (-552.121) (-552.006) [-551.899] (-555.167) * (-553.775) [-553.449] (-551.904) (-552.505) -- 0:00:30
489500 -- (-552.993) (-550.856) (-553.692) [-549.977] * (-554.013) (-551.464) [-551.177] (-553.406) -- 0:00:30
490000 -- (-552.322) (-551.967) [-551.479] (-552.413) * (-558.883) (-550.685) (-554.955) [-551.246] -- 0:00:30
Average standard deviation of split frequencies: 0.009661
490500 -- (-554.560) (-553.763) [-552.629] (-552.392) * [-551.085] (-552.066) (-552.221) (-552.249) -- 0:00:30
491000 -- (-551.047) (-550.024) [-550.498] (-555.134) * (-553.217) (-552.221) (-551.537) [-551.743] -- 0:00:30
491500 -- (-554.238) [-550.884] (-550.664) (-552.357) * [-552.571] (-552.114) (-552.107) (-551.425) -- 0:00:30
492000 -- [-550.872] (-550.480) (-551.627) (-551.663) * (-550.573) (-552.356) [-556.559] (-550.915) -- 0:00:29
492500 -- [-552.793] (-550.213) (-550.696) (-550.847) * (-550.546) [-550.652] (-551.714) (-553.411) -- 0:00:29
493000 -- (-555.201) (-551.161) [-552.499] (-551.684) * (-550.800) [-551.328] (-550.870) (-553.980) -- 0:00:29
493500 -- (-553.650) (-552.505) [-551.292] (-556.810) * (-551.665) [-553.519] (-553.400) (-554.201) -- 0:00:29
494000 -- (-551.374) (-554.073) (-553.827) [-551.956] * (-557.526) (-555.000) (-552.645) [-552.227] -- 0:00:29
494500 -- (-552.965) [-552.669] (-553.514) (-551.672) * [-552.313] (-555.876) (-550.578) (-552.839) -- 0:00:30
495000 -- (-552.293) (-551.816) [-551.795] (-553.099) * (-553.487) (-552.894) (-550.736) [-551.232] -- 0:00:30
Average standard deviation of split frequencies: 0.009225
495500 -- (-553.553) (-553.078) (-556.332) [-553.512] * [-553.457] (-555.520) (-553.123) (-552.006) -- 0:00:30
496000 -- [-553.001] (-555.757) (-551.880) (-555.674) * (-554.640) (-551.885) (-551.121) [-552.613] -- 0:00:30
496500 -- (-551.819) (-552.993) (-552.254) [-551.501] * (-552.455) (-551.898) (-553.197) [-551.611] -- 0:00:30
497000 -- (-552.241) (-551.963) [-552.613] (-552.752) * [-551.442] (-551.978) (-552.324) (-552.306) -- 0:00:30
497500 -- (-551.971) [-551.495] (-552.575) (-550.537) * (-555.362) (-553.236) (-556.837) [-550.458] -- 0:00:30
498000 -- (-555.812) (-551.599) (-552.947) [-553.095] * (-550.335) (-554.485) (-556.619) [-551.335] -- 0:00:30
498500 -- (-555.117) [-554.125] (-552.692) (-555.147) * (-553.175) [-553.097] (-553.435) (-552.118) -- 0:00:30
499000 -- [-553.569] (-552.172) (-552.355) (-551.074) * (-550.556) [-553.338] (-555.228) (-555.249) -- 0:00:30
499500 -- [-552.826] (-550.879) (-556.124) (-552.566) * [-551.874] (-550.393) (-551.255) (-552.494) -- 0:00:30
500000 -- (-551.968) (-552.839) [-550.135] (-553.554) * [-551.501] (-550.738) (-550.179) (-552.470) -- 0:00:30
Average standard deviation of split frequencies: 0.009139
500500 -- (-552.724) (-555.435) (-551.673) [-550.322] * [-550.934] (-553.358) (-553.924) (-552.293) -- 0:00:29
501000 -- (-552.548) [-552.426] (-550.842) (-558.226) * [-553.013] (-554.452) (-551.889) (-553.231) -- 0:00:29
501500 -- (-554.082) [-554.535] (-550.236) (-561.057) * (-551.098) [-550.644] (-552.265) (-552.133) -- 0:00:29
502000 -- (-552.026) [-552.013] (-553.966) (-554.074) * [-550.821] (-554.004) (-554.214) (-552.788) -- 0:00:29
502500 -- [-550.701] (-555.589) (-551.186) (-553.208) * (-552.002) (-555.835) [-551.943] (-550.930) -- 0:00:29
503000 -- (-558.021) [-551.595] (-553.505) (-550.352) * (-553.835) (-558.284) [-551.337] (-550.743) -- 0:00:29
503500 -- (-562.712) (-551.379) [-551.917] (-553.228) * [-552.522] (-556.761) (-553.207) (-551.872) -- 0:00:29
504000 -- [-552.165] (-555.347) (-551.697) (-551.872) * (-554.023) (-553.640) [-551.463] (-551.517) -- 0:00:29
504500 -- (-552.011) (-554.098) (-551.576) [-551.275] * (-553.840) [-552.541] (-552.438) (-552.259) -- 0:00:29
505000 -- (-556.037) (-557.741) (-557.186) [-552.245] * (-552.110) (-552.150) (-552.791) [-552.243] -- 0:00:29
Average standard deviation of split frequencies: 0.009042
505500 -- (-552.360) (-553.455) (-553.280) [-553.031] * (-550.406) [-554.925] (-551.257) (-552.487) -- 0:00:29
506000 -- (-551.879) (-551.957) (-553.162) [-552.530] * (-552.777) (-550.941) (-555.040) [-552.301] -- 0:00:29
506500 -- [-551.056] (-554.525) (-550.978) (-557.360) * (-551.820) (-555.999) (-552.218) [-550.783] -- 0:00:29
507000 -- [-551.499] (-551.900) (-550.460) (-550.506) * (-551.803) (-552.772) (-550.553) [-550.891] -- 0:00:29
507500 -- [-551.582] (-550.537) (-551.367) (-554.146) * (-551.245) [-550.757] (-550.405) (-551.454) -- 0:00:29
508000 -- (-551.156) [-553.560] (-552.401) (-551.545) * [-551.133] (-550.995) (-553.198) (-553.094) -- 0:00:29
508500 -- (-551.076) (-552.223) [-550.396] (-552.245) * (-550.647) [-554.554] (-554.249) (-552.598) -- 0:00:28
509000 -- (-550.308) [-551.758] (-551.412) (-551.295) * (-551.820) [-550.914] (-551.616) (-554.176) -- 0:00:28
509500 -- (-550.553) (-554.886) [-551.610] (-552.678) * (-552.382) (-553.632) (-552.132) [-551.471] -- 0:00:28
510000 -- (-552.801) (-556.048) [-550.964] (-551.103) * (-554.529) (-553.237) (-550.714) [-552.949] -- 0:00:28
Average standard deviation of split frequencies: 0.008851
510500 -- (-551.752) (-553.294) (-556.636) [-551.465] * (-556.494) (-549.996) [-551.648] (-550.610) -- 0:00:28
511000 -- (-550.688) (-553.806) (-556.492) [-551.640] * [-553.482] (-550.450) (-551.720) (-552.572) -- 0:00:29
511500 -- [-554.217] (-557.050) (-558.516) (-551.099) * (-552.050) (-551.709) (-552.227) [-557.641] -- 0:00:29
512000 -- (-553.805) (-553.656) (-555.763) [-550.910] * (-550.220) (-554.120) [-551.045] (-552.777) -- 0:00:29
512500 -- (-552.409) (-554.443) (-555.471) [-553.060] * (-552.641) [-552.053] (-556.245) (-550.661) -- 0:00:29
513000 -- [-554.992] (-550.763) (-555.919) (-554.863) * (-551.453) (-555.691) (-560.054) [-551.666] -- 0:00:29
513500 -- [-553.095] (-559.924) (-552.084) (-553.091) * (-551.446) (-555.513) [-554.141] (-551.610) -- 0:00:29
514000 -- [-551.600] (-560.739) (-550.661) (-553.656) * (-551.501) (-554.242) (-553.777) [-552.042] -- 0:00:29
514500 -- (-551.710) [-554.768] (-551.457) (-554.399) * (-551.087) [-550.472] (-551.180) (-551.205) -- 0:00:29
515000 -- [-552.214] (-552.985) (-550.181) (-553.618) * (-551.187) (-550.596) (-550.541) [-549.914] -- 0:00:29
Average standard deviation of split frequencies: 0.009404
515500 -- (-551.362) (-553.562) (-554.660) [-550.882] * (-552.063) (-550.976) (-550.988) [-551.277] -- 0:00:29
516000 -- (-552.215) [-553.770] (-559.614) (-553.009) * (-552.491) (-551.690) (-555.433) [-551.050] -- 0:00:29
516500 -- (-551.871) (-555.499) (-551.522) [-551.580] * (-552.788) (-552.546) [-553.758] (-551.657) -- 0:00:29
517000 -- (-552.169) (-558.730) [-551.446] (-552.830) * (-550.470) [-551.931] (-554.473) (-551.710) -- 0:00:28
517500 -- (-552.690) [-555.120] (-552.153) (-552.984) * [-550.703] (-554.014) (-553.863) (-551.893) -- 0:00:28
518000 -- (-552.687) (-552.386) (-551.360) [-553.690] * (-551.473) [-551.491] (-552.422) (-554.736) -- 0:00:28
518500 -- [-553.752] (-553.812) (-550.862) (-550.825) * [-552.127] (-550.520) (-551.531) (-550.931) -- 0:00:28
519000 -- (-555.768) [-556.510] (-554.568) (-556.520) * (-556.001) [-554.242] (-552.127) (-554.267) -- 0:00:28
519500 -- (-553.307) (-551.633) [-553.996] (-550.575) * (-553.987) [-551.786] (-551.456) (-552.419) -- 0:00:28
520000 -- [-551.616] (-553.381) (-555.536) (-551.707) * (-552.570) (-551.831) [-552.351] (-551.947) -- 0:00:28
Average standard deviation of split frequencies: 0.009640
520500 -- [-554.300] (-553.310) (-555.614) (-550.114) * (-554.210) (-552.060) (-551.703) [-553.022] -- 0:00:28
521000 -- (-561.299) [-551.104] (-553.123) (-549.980) * [-550.883] (-550.570) (-552.699) (-552.427) -- 0:00:28
521500 -- (-551.047) (-555.817) [-553.890] (-551.163) * (-554.921) [-551.418] (-554.977) (-551.980) -- 0:00:28
522000 -- (-552.581) (-557.512) [-552.015] (-550.118) * (-551.223) (-551.426) (-550.997) [-553.514] -- 0:00:28
522500 -- [-552.559] (-553.060) (-555.099) (-551.837) * (-551.379) [-550.801] (-552.595) (-553.320) -- 0:00:28
523000 -- (-551.381) [-553.738] (-552.269) (-553.035) * (-551.920) (-552.361) [-551.317] (-553.383) -- 0:00:28
523500 -- (-550.657) (-552.637) (-552.756) [-552.984] * (-555.895) [-551.590] (-552.784) (-552.350) -- 0:00:28
524000 -- (-551.157) (-552.174) (-553.241) [-551.159] * (-555.021) (-550.493) (-550.871) [-552.284] -- 0:00:28
524500 -- (-554.083) (-553.159) (-551.537) [-551.361] * (-554.374) (-550.841) (-552.157) [-553.527] -- 0:00:28
525000 -- (-555.195) [-553.068] (-551.804) (-553.225) * (-552.480) [-552.191] (-554.825) (-553.169) -- 0:00:28
Average standard deviation of split frequencies: 0.009908
525500 -- (-553.779) (-551.901) [-552.589] (-554.266) * (-556.002) [-553.292] (-553.388) (-556.812) -- 0:00:27
526000 -- (-552.516) (-552.997) (-552.498) [-550.130] * (-552.535) (-556.727) [-554.263] (-556.684) -- 0:00:27
526500 -- [-555.835] (-554.134) (-550.645) (-550.994) * (-553.418) (-555.604) (-556.811) [-554.080] -- 0:00:27
527000 -- (-554.007) [-552.590] (-555.418) (-550.718) * (-551.891) (-552.231) (-552.789) [-552.189] -- 0:00:27
527500 -- (-553.280) [-553.138] (-556.742) (-554.090) * (-550.474) (-553.306) (-551.525) [-550.483] -- 0:00:28
528000 -- (-552.515) (-551.091) (-555.399) [-552.175] * (-553.072) (-551.331) (-550.520) [-550.358] -- 0:00:28
528500 -- (-552.099) (-556.089) [-555.170] (-550.663) * (-552.283) [-550.750] (-551.567) (-551.242) -- 0:00:28
529000 -- (-551.967) [-550.886] (-552.604) (-550.793) * (-553.107) (-553.258) (-552.301) [-552.597] -- 0:00:28
529500 -- (-552.753) (-551.390) [-551.798] (-552.968) * (-551.742) (-553.733) (-552.865) [-559.054] -- 0:00:28
530000 -- (-551.897) (-552.894) [-551.676] (-553.840) * (-550.686) (-553.937) [-551.771] (-554.589) -- 0:00:28
Average standard deviation of split frequencies: 0.009031
530500 -- [-552.800] (-553.952) (-551.472) (-551.925) * (-552.969) [-554.283] (-550.985) (-555.964) -- 0:00:28
531000 -- [-551.433] (-551.117) (-552.120) (-552.535) * (-551.811) (-555.144) [-553.515] (-555.695) -- 0:00:28
531500 -- [-551.433] (-551.163) (-550.574) (-555.208) * (-552.338) (-551.285) [-554.533] (-554.166) -- 0:00:28
532000 -- (-554.606) (-550.576) [-550.865] (-552.990) * (-554.416) (-552.071) [-551.805] (-552.975) -- 0:00:28
532500 -- (-551.217) (-552.940) [-554.829] (-550.854) * [-553.144] (-551.867) (-555.732) (-550.919) -- 0:00:28
533000 -- (-551.246) [-551.601] (-552.374) (-550.558) * (-552.088) [-550.904] (-551.052) (-555.005) -- 0:00:28
533500 -- (-550.819) (-553.282) (-553.937) [-555.050] * (-554.072) (-553.719) (-553.293) [-550.116] -- 0:00:27
534000 -- (-554.229) (-552.939) [-555.795] (-554.413) * (-551.937) (-551.330) (-556.516) [-554.607] -- 0:00:27
534500 -- (-557.346) [-553.000] (-558.044) (-552.513) * (-551.003) (-551.235) [-553.325] (-551.505) -- 0:00:27
535000 -- [-554.925] (-550.690) (-553.019) (-554.423) * (-556.907) [-553.998] (-553.061) (-556.051) -- 0:00:27
Average standard deviation of split frequencies: 0.009088
535500 -- (-551.867) [-550.747] (-552.186) (-554.198) * (-554.562) (-556.707) (-550.745) [-551.208] -- 0:00:27
536000 -- (-550.683) [-550.595] (-550.121) (-552.193) * (-551.403) [-553.935] (-551.112) (-555.489) -- 0:00:27
536500 -- [-551.664] (-551.456) (-550.974) (-555.941) * [-551.285] (-553.049) (-555.233) (-550.956) -- 0:00:27
537000 -- (-551.084) (-554.835) [-553.534] (-550.514) * (-551.309) (-554.074) (-552.556) [-552.259] -- 0:00:27
537500 -- [-550.348] (-552.639) (-552.476) (-550.551) * (-554.366) (-552.160) [-551.025] (-553.352) -- 0:00:27
538000 -- [-551.998] (-556.064) (-550.558) (-552.301) * [-551.381] (-551.806) (-551.435) (-553.171) -- 0:00:27
538500 -- [-550.226] (-553.345) (-550.989) (-550.288) * (-550.147) (-552.377) [-551.067] (-553.520) -- 0:00:27
539000 -- (-550.188) (-552.077) (-552.706) [-549.842] * (-552.417) (-551.964) (-553.968) [-552.257] -- 0:00:27
539500 -- [-551.405] (-552.931) (-551.486) (-550.447) * (-555.647) (-558.084) [-552.830] (-555.279) -- 0:00:27
540000 -- (-551.170) [-551.629] (-552.759) (-550.723) * (-551.627) (-551.675) [-551.917] (-551.997) -- 0:00:27
Average standard deviation of split frequencies: 0.009349
540500 -- (-550.997) (-553.660) [-550.650] (-551.603) * (-553.733) (-550.355) (-551.909) [-550.576] -- 0:00:27
541000 -- (-552.802) [-550.990] (-552.954) (-551.418) * [-552.725] (-553.037) (-552.684) (-553.819) -- 0:00:27
541500 -- [-552.150] (-551.284) (-556.006) (-554.066) * (-551.036) (-552.726) [-553.298] (-558.706) -- 0:00:27
542000 -- [-551.576] (-554.124) (-550.394) (-556.306) * [-552.238] (-551.852) (-552.882) (-555.639) -- 0:00:27
542500 -- (-551.564) [-550.730] (-550.311) (-550.078) * [-549.945] (-552.474) (-550.452) (-552.299) -- 0:00:26
543000 -- (-553.462) [-550.693] (-551.140) (-550.127) * (-554.820) [-550.871] (-553.746) (-553.345) -- 0:00:27
543500 -- (-550.104) [-556.513] (-551.274) (-550.829) * (-554.069) (-552.661) [-553.004] (-551.268) -- 0:00:27
544000 -- (-551.994) (-553.330) (-552.786) [-552.201] * [-551.331] (-552.241) (-551.248) (-553.253) -- 0:00:27
544500 -- (-552.700) (-554.251) (-553.177) [-552.791] * (-553.108) [-550.951] (-550.348) (-552.154) -- 0:00:27
545000 -- [-554.678] (-555.295) (-555.083) (-552.441) * [-551.391] (-550.610) (-551.699) (-553.173) -- 0:00:27
Average standard deviation of split frequencies: 0.009161
545500 -- [-550.506] (-553.930) (-553.220) (-551.294) * [-551.775] (-551.812) (-551.684) (-556.318) -- 0:00:27
546000 -- (-553.218) [-550.881] (-555.188) (-551.813) * (-555.568) (-555.352) [-552.083] (-556.036) -- 0:00:27
546500 -- (-554.143) (-551.474) (-553.218) [-552.682] * [-553.560] (-551.910) (-554.595) (-552.981) -- 0:00:27
547000 -- (-552.522) (-551.510) (-551.825) [-552.459] * [-554.525] (-551.891) (-553.635) (-552.327) -- 0:00:27
547500 -- (-552.643) (-550.859) [-558.735] (-552.567) * (-552.961) [-552.111] (-554.319) (-551.316) -- 0:00:27
548000 -- (-558.082) [-552.475] (-557.343) (-551.551) * (-551.890) [-551.486] (-554.282) (-554.220) -- 0:00:27
548500 -- (-551.297) (-552.346) [-552.209] (-550.812) * (-553.000) (-551.211) [-553.160] (-552.582) -- 0:00:27
549000 -- (-551.332) [-555.203] (-552.285) (-553.083) * (-553.993) (-551.087) [-551.051] (-553.980) -- 0:00:27
549500 -- (-551.140) (-553.237) (-552.622) [-551.369] * (-551.851) (-551.677) [-551.508] (-553.757) -- 0:00:27
550000 -- [-551.703] (-552.279) (-554.167) (-551.264) * (-552.027) [-552.452] (-554.224) (-554.205) -- 0:00:27
Average standard deviation of split frequencies: 0.009512
550500 -- (-551.640) (-553.818) (-552.390) [-551.673] * (-552.852) (-556.347) [-550.120] (-553.146) -- 0:00:26
551000 -- (-553.459) [-550.964] (-550.923) (-552.188) * (-550.628) [-552.622] (-553.074) (-550.587) -- 0:00:26
551500 -- (-552.759) [-551.828] (-553.607) (-554.684) * [-552.285] (-552.801) (-550.914) (-554.755) -- 0:00:26
552000 -- [-552.530] (-551.214) (-554.020) (-552.158) * (-550.596) (-550.509) [-551.712] (-551.240) -- 0:00:26
552500 -- (-551.445) [-550.311] (-550.374) (-551.053) * (-552.464) [-551.416] (-551.350) (-553.653) -- 0:00:26
553000 -- (-552.328) (-552.625) [-551.043] (-550.310) * (-552.034) [-553.697] (-550.782) (-551.873) -- 0:00:26
553500 -- (-553.046) (-550.824) [-550.442] (-551.704) * (-550.904) (-553.128) (-553.527) [-552.875] -- 0:00:26
554000 -- (-550.636) [-550.804] (-553.580) (-553.741) * [-556.445] (-554.940) (-550.980) (-550.776) -- 0:00:26
554500 -- (-550.959) (-555.384) (-558.148) [-554.407] * (-558.099) (-553.205) (-552.067) [-551.875] -- 0:00:26
555000 -- (-551.455) (-557.141) (-559.189) [-552.793] * (-553.119) [-557.438] (-552.153) (-553.752) -- 0:00:26
Average standard deviation of split frequencies: 0.009468
555500 -- (-552.798) [-551.095] (-558.450) (-550.914) * (-551.515) [-552.183] (-552.201) (-550.662) -- 0:00:26
556000 -- (-558.539) [-550.445] (-550.556) (-554.272) * [-551.966] (-552.409) (-553.576) (-553.798) -- 0:00:26
556500 -- (-551.681) (-550.431) [-552.216] (-552.332) * (-551.746) (-552.630) (-551.393) [-552.625] -- 0:00:26
557000 -- (-552.046) (-552.671) [-550.529] (-552.629) * (-554.973) (-551.749) [-550.157] (-554.787) -- 0:00:27
557500 -- (-552.268) (-553.834) (-554.376) [-552.270] * [-554.217] (-553.086) (-550.151) (-552.056) -- 0:00:26
558000 -- (-552.367) [-555.912] (-555.357) (-550.414) * (-553.673) (-551.611) (-551.650) [-551.898] -- 0:00:26
558500 -- (-552.127) (-557.914) (-552.376) [-550.682] * (-551.533) (-552.886) (-555.292) [-551.333] -- 0:00:26
559000 -- [-551.916] (-560.877) (-555.341) (-551.696) * [-551.955] (-550.063) (-555.018) (-550.606) -- 0:00:26
559500 -- [-552.294] (-551.964) (-552.524) (-550.973) * (-550.960) [-554.959] (-557.937) (-552.425) -- 0:00:26
560000 -- [-554.426] (-553.999) (-551.824) (-552.701) * (-551.338) (-552.316) [-551.837] (-552.303) -- 0:00:26
Average standard deviation of split frequencies: 0.008968
560500 -- [-552.756] (-555.093) (-552.849) (-554.345) * (-551.723) (-550.373) [-551.159] (-553.129) -- 0:00:26
561000 -- (-550.740) (-552.863) [-551.414] (-555.354) * [-552.101] (-554.799) (-552.205) (-556.004) -- 0:00:26
561500 -- (-550.631) (-551.968) (-550.582) [-552.014] * (-554.611) (-558.062) (-555.414) [-558.229] -- 0:00:26
562000 -- (-550.338) [-551.449] (-552.285) (-550.258) * (-551.920) (-554.354) (-551.723) [-555.982] -- 0:00:26
562500 -- [-550.946] (-551.395) (-553.783) (-552.334) * (-550.506) [-561.814] (-553.145) (-551.051) -- 0:00:26
563000 -- (-551.282) [-551.604] (-551.323) (-553.305) * (-552.148) [-554.947] (-552.684) (-551.047) -- 0:00:26
563500 -- (-552.316) (-556.758) [-551.179] (-552.782) * (-550.290) (-557.966) (-551.966) [-551.148] -- 0:00:26
564000 -- (-550.755) (-553.671) [-550.224] (-555.284) * (-553.196) [-551.146] (-551.534) (-550.624) -- 0:00:26
564500 -- (-551.236) (-551.993) (-552.274) [-550.528] * [-553.382] (-551.380) (-553.046) (-551.120) -- 0:00:26
565000 -- (-558.054) (-551.853) (-550.500) [-552.588] * (-551.668) [-550.392] (-555.452) (-551.236) -- 0:00:26
Average standard deviation of split frequencies: 0.008653
565500 -- (-555.901) (-554.207) (-550.892) [-552.119] * (-551.814) (-551.930) (-553.140) [-551.751] -- 0:00:26
566000 -- [-552.937] (-553.918) (-557.606) (-553.882) * (-550.645) (-553.724) (-553.832) [-553.116] -- 0:00:26
566500 -- (-552.093) [-557.339] (-554.611) (-559.040) * (-551.926) (-555.365) [-550.808] (-555.445) -- 0:00:26
567000 -- (-553.631) (-554.764) (-553.868) [-552.366] * (-554.139) (-552.297) (-550.671) [-552.323] -- 0:00:25
567500 -- (-555.476) (-551.849) [-554.944] (-553.612) * (-550.280) [-551.291] (-551.581) (-550.198) -- 0:00:25
568000 -- (-551.322) [-551.711] (-552.111) (-552.997) * [-551.198] (-552.789) (-553.608) (-555.765) -- 0:00:25
568500 -- [-552.286] (-557.842) (-551.306) (-552.457) * (-551.216) (-553.944) (-550.981) [-554.151] -- 0:00:25
569000 -- (-552.406) (-552.589) [-552.132] (-552.717) * [-550.528] (-553.385) (-551.589) (-553.820) -- 0:00:25
569500 -- (-557.095) (-549.983) (-552.207) [-554.227] * [-551.341] (-554.921) (-551.531) (-551.072) -- 0:00:25
570000 -- [-551.693] (-550.965) (-553.417) (-556.265) * [-551.676] (-554.275) (-551.673) (-551.230) -- 0:00:25
Average standard deviation of split frequencies: 0.008261
570500 -- (-553.629) (-552.166) (-555.169) [-552.265] * (-556.226) (-551.199) [-553.072] (-551.154) -- 0:00:25
571000 -- (-553.052) [-550.920] (-551.040) (-551.593) * (-553.716) (-551.207) (-551.026) [-554.934] -- 0:00:25
571500 -- (-550.928) (-551.052) [-551.851] (-550.834) * (-556.798) (-550.268) [-553.149] (-552.907) -- 0:00:25
572000 -- [-554.600] (-551.938) (-554.885) (-550.982) * (-550.784) [-556.671] (-556.276) (-551.501) -- 0:00:25
572500 -- (-552.432) (-552.116) [-551.148] (-553.274) * (-551.248) (-553.951) [-550.449] (-552.329) -- 0:00:25
573000 -- (-552.200) (-550.404) [-551.145] (-551.933) * (-550.544) [-552.218] (-551.817) (-550.543) -- 0:00:25
573500 -- [-550.882] (-550.366) (-551.237) (-552.278) * (-552.140) [-555.623] (-552.672) (-555.357) -- 0:00:25
574000 -- (-550.781) (-552.442) [-551.718] (-552.202) * (-552.030) (-550.848) (-554.790) [-552.791] -- 0:00:25
574500 -- (-553.223) (-550.600) [-553.589] (-551.400) * (-553.266) (-551.982) (-550.686) [-551.438] -- 0:00:25
575000 -- (-551.329) [-550.800] (-552.545) (-554.091) * [-555.028] (-553.621) (-550.775) (-551.147) -- 0:00:25
Average standard deviation of split frequencies: 0.008473
575500 -- [-550.501] (-551.626) (-553.800) (-551.625) * (-553.654) (-554.020) [-551.303] (-551.174) -- 0:00:25
576000 -- (-550.794) [-551.286] (-550.547) (-551.373) * (-551.835) (-557.252) (-550.701) [-552.594] -- 0:00:25
576500 -- [-551.387] (-553.371) (-551.521) (-550.975) * (-558.149) [-554.582] (-556.172) (-553.621) -- 0:00:25
577000 -- (-551.599) [-552.513] (-556.217) (-551.130) * [-554.486] (-551.635) (-552.263) (-554.442) -- 0:00:25
577500 -- (-550.282) (-551.212) (-555.711) [-552.185] * (-556.548) (-551.073) (-551.357) [-557.668] -- 0:00:25
578000 -- (-552.046) (-554.185) [-552.056] (-554.226) * (-551.486) (-553.665) [-551.979] (-554.036) -- 0:00:25
578500 -- (-551.764) (-552.934) [-552.605] (-552.181) * (-552.446) (-558.839) (-553.279) [-551.244] -- 0:00:25
579000 -- (-555.347) (-551.308) (-551.207) [-553.971] * (-551.347) (-553.307) (-552.326) [-550.044] -- 0:00:25
579500 -- (-553.389) (-551.525) [-558.858] (-551.898) * (-552.631) (-554.349) (-550.642) [-551.583] -- 0:00:25
580000 -- (-550.538) (-551.406) (-552.333) [-552.564] * (-554.120) (-553.585) (-551.662) [-552.039] -- 0:00:25
Average standard deviation of split frequencies: 0.008309
580500 -- (-550.890) (-553.555) (-553.555) [-551.219] * (-550.033) (-553.970) (-554.658) [-552.237] -- 0:00:25
581000 -- (-551.202) (-553.533) [-551.238] (-556.521) * [-551.530] (-558.587) (-550.529) (-550.551) -- 0:00:25
581500 -- (-552.453) (-551.037) (-553.726) [-551.916] * (-550.906) (-555.929) [-550.610] (-552.010) -- 0:00:25
582000 -- (-552.592) (-551.084) (-550.932) [-550.722] * (-551.767) (-551.835) [-553.305] (-552.256) -- 0:00:25
582500 -- (-557.251) [-551.698] (-554.382) (-552.791) * [-551.790] (-551.664) (-551.759) (-553.498) -- 0:00:25
583000 -- [-552.374] (-551.399) (-553.334) (-554.693) * (-551.216) (-552.744) [-551.304] (-552.165) -- 0:00:25
583500 -- (-557.472) [-552.447] (-551.127) (-550.810) * (-552.873) (-551.217) (-554.163) [-550.901] -- 0:00:24
584000 -- (-551.179) (-550.509) (-553.000) [-552.731] * (-550.299) (-550.758) (-555.943) [-549.792] -- 0:00:24
584500 -- [-551.127] (-550.499) (-551.278) (-550.936) * (-552.633) (-551.491) (-553.618) [-551.154] -- 0:00:24
585000 -- (-551.256) (-551.865) [-551.400] (-552.226) * (-550.865) [-552.144] (-550.635) (-553.455) -- 0:00:24
Average standard deviation of split frequencies: 0.008470
585500 -- (-554.785) (-556.053) [-551.567] (-553.029) * (-556.888) [-551.442] (-550.687) (-556.904) -- 0:00:24
586000 -- [-550.437] (-552.816) (-551.511) (-553.996) * (-556.992) [-556.150] (-551.428) (-550.939) -- 0:00:24
586500 -- (-550.883) (-551.663) (-554.735) [-552.502] * (-551.929) (-554.278) [-553.284] (-555.657) -- 0:00:24
587000 -- [-553.277] (-552.499) (-551.963) (-550.446) * (-553.421) [-554.388] (-553.941) (-553.424) -- 0:00:24
587500 -- (-551.102) (-550.600) (-551.151) [-556.405] * (-552.768) (-554.035) (-551.240) [-550.293] -- 0:00:24
588000 -- [-554.066] (-550.341) (-551.986) (-550.343) * (-551.548) (-556.382) [-551.674] (-553.311) -- 0:00:24
588500 -- (-554.446) [-551.480] (-554.773) (-554.222) * (-554.419) (-552.665) [-552.753] (-554.019) -- 0:00:24
589000 -- (-551.609) (-550.523) (-551.243) [-553.638] * (-554.427) (-555.722) [-550.526] (-553.064) -- 0:00:24
589500 -- [-553.772] (-556.493) (-554.002) (-551.949) * (-552.836) (-554.721) [-551.512] (-551.585) -- 0:00:24
590000 -- (-554.460) (-561.733) [-550.670] (-552.880) * (-552.713) (-550.756) (-554.407) [-550.620] -- 0:00:24
Average standard deviation of split frequencies: 0.008638
590500 -- [-552.826] (-554.765) (-551.127) (-552.974) * (-551.153) (-553.774) (-558.755) [-551.497] -- 0:00:24
591000 -- (-550.245) (-550.413) [-551.060] (-551.130) * (-553.644) [-553.723] (-550.911) (-551.138) -- 0:00:24
591500 -- (-552.750) (-550.527) (-551.531) [-553.572] * (-554.294) [-553.359] (-552.746) (-551.212) -- 0:00:24
592000 -- [-550.416] (-551.236) (-551.274) (-551.490) * (-550.089) (-552.811) (-554.401) [-553.933] -- 0:00:24
592500 -- (-555.384) (-554.373) (-553.459) [-551.144] * (-554.394) [-550.930] (-550.302) (-554.647) -- 0:00:24
593000 -- (-551.968) (-551.030) [-551.064] (-555.104) * (-551.980) (-550.528) [-550.016] (-555.638) -- 0:00:24
593500 -- (-554.631) [-553.982] (-555.133) (-554.835) * (-553.500) (-553.660) [-550.467] (-553.086) -- 0:00:24
594000 -- [-551.542] (-552.134) (-551.860) (-554.341) * (-551.967) [-552.058] (-552.249) (-550.561) -- 0:00:24
594500 -- (-553.322) (-553.541) (-555.498) [-553.256] * [-550.357] (-553.720) (-552.192) (-551.774) -- 0:00:24
595000 -- (-552.303) (-554.420) (-551.223) [-553.217] * [-550.081] (-557.477) (-555.655) (-552.294) -- 0:00:24
Average standard deviation of split frequencies: 0.008747
595500 -- (-553.218) (-552.197) (-552.708) [-550.610] * [-551.165] (-553.381) (-554.476) (-552.181) -- 0:00:24
596000 -- [-552.311] (-553.785) (-554.140) (-550.755) * (-552.432) (-553.167) (-554.027) [-551.377] -- 0:00:24
596500 -- [-550.816] (-554.607) (-554.126) (-554.420) * (-550.880) (-554.141) [-551.154] (-550.686) -- 0:00:24
597000 -- (-554.622) (-551.441) [-551.122] (-551.363) * (-553.337) (-553.198) (-553.676) [-550.624] -- 0:00:24
597500 -- (-554.137) (-552.875) (-551.430) [-551.373] * (-555.816) [-552.421] (-550.084) (-551.999) -- 0:00:24
598000 -- (-555.136) (-550.498) [-550.708] (-554.784) * (-559.396) (-552.911) (-553.852) [-551.363] -- 0:00:24
598500 -- (-553.508) (-553.185) [-556.273] (-550.834) * [-550.728] (-552.836) (-551.752) (-551.741) -- 0:00:24
599000 -- (-552.048) [-553.847] (-552.173) (-552.147) * (-552.564) (-556.370) (-553.079) [-551.729] -- 0:00:24
599500 -- [-551.969] (-550.894) (-552.705) (-550.805) * [-549.972] (-555.510) (-551.010) (-553.267) -- 0:00:24
600000 -- (-551.581) [-551.785] (-552.541) (-550.212) * (-554.941) (-551.851) [-550.825] (-552.431) -- 0:00:24
Average standard deviation of split frequencies: 0.008771
600500 -- [-552.802] (-555.228) (-550.677) (-551.119) * (-552.553) (-552.805) (-551.327) [-551.160] -- 0:00:23
601000 -- (-554.156) (-553.679) [-551.182] (-550.627) * (-552.311) (-550.982) [-552.180] (-554.448) -- 0:00:23
601500 -- [-551.696] (-552.671) (-554.837) (-550.367) * (-551.531) (-552.295) [-551.952] (-551.927) -- 0:00:23
602000 -- (-553.992) [-552.504] (-550.605) (-553.075) * (-552.176) [-555.207] (-551.710) (-550.604) -- 0:00:23
602500 -- [-551.411] (-551.710) (-550.820) (-552.163) * [-551.348] (-554.584) (-551.188) (-550.168) -- 0:00:23
603000 -- (-555.056) [-556.142] (-551.221) (-554.271) * [-550.692] (-554.386) (-553.663) (-555.005) -- 0:00:23
603500 -- (-552.341) (-557.442) [-552.025] (-554.666) * (-559.593) (-553.513) [-552.961] (-553.684) -- 0:00:23
604000 -- (-550.034) (-556.353) [-551.969] (-554.487) * (-558.152) [-550.284] (-556.398) (-551.349) -- 0:00:23
604500 -- [-550.663] (-551.507) (-553.794) (-552.238) * (-550.619) (-550.326) [-549.910] (-550.417) -- 0:00:23
605000 -- (-552.105) (-554.492) (-552.341) [-550.760] * (-550.442) [-552.962] (-553.275) (-549.997) -- 0:00:23
Average standard deviation of split frequencies: 0.009426
605500 -- (-552.997) (-556.465) (-551.670) [-551.596] * (-553.249) (-553.175) (-553.899) [-552.370] -- 0:00:23
606000 -- (-551.772) [-553.677] (-551.674) (-551.959) * (-551.791) (-557.086) [-552.383] (-551.795) -- 0:00:23
606500 -- [-550.807] (-552.592) (-552.654) (-550.292) * (-551.862) (-553.500) [-553.856] (-552.232) -- 0:00:23
607000 -- (-551.268) (-554.001) (-554.684) [-552.002] * (-552.147) (-554.458) [-551.054] (-551.867) -- 0:00:23
607500 -- [-552.107] (-552.591) (-554.251) (-551.893) * (-552.005) (-553.594) (-552.312) [-554.343] -- 0:00:23
608000 -- (-552.652) (-555.861) (-554.395) [-552.080] * [-550.910] (-551.157) (-550.343) (-552.531) -- 0:00:23
608500 -- (-550.309) [-551.521] (-555.856) (-552.341) * (-550.273) (-554.856) (-550.982) [-549.909] -- 0:00:23
609000 -- [-553.203] (-553.561) (-555.699) (-550.033) * (-556.715) (-551.882) [-551.885] (-551.771) -- 0:00:23
609500 -- (-551.958) (-556.647) (-553.363) [-552.264] * (-552.338) [-553.957] (-553.451) (-553.609) -- 0:00:23
610000 -- (-555.121) (-551.309) (-554.140) [-552.433] * [-555.526] (-552.562) (-551.426) (-551.057) -- 0:00:23
Average standard deviation of split frequencies: 0.009400
610500 -- [-555.951] (-552.842) (-557.292) (-554.010) * (-554.036) (-553.283) (-558.888) [-551.100] -- 0:00:23
611000 -- [-554.322] (-554.105) (-552.696) (-554.120) * (-552.672) (-554.345) (-552.061) [-551.754] -- 0:00:23
611500 -- (-551.822) [-551.992] (-551.674) (-550.454) * (-553.406) (-552.455) (-552.691) [-551.602] -- 0:00:23
612000 -- (-550.862) [-551.658] (-551.269) (-551.138) * (-552.202) [-555.115] (-552.604) (-551.388) -- 0:00:23
612500 -- [-551.108] (-551.274) (-554.052) (-560.991) * (-552.339) (-554.782) (-552.345) [-551.825] -- 0:00:23
613000 -- (-552.171) [-553.031] (-553.406) (-551.805) * (-553.268) (-550.547) (-550.820) [-555.703] -- 0:00:23
613500 -- (-553.157) (-550.592) (-553.720) [-551.552] * (-553.806) (-550.644) (-551.113) [-551.743] -- 0:00:23
614000 -- (-555.048) (-553.061) (-551.865) [-550.226] * (-554.859) (-553.399) [-552.517] (-550.729) -- 0:00:23
614500 -- (-553.831) (-550.339) (-555.013) [-550.817] * [-554.627] (-553.809) (-554.094) (-552.103) -- 0:00:23
615000 -- [-551.469] (-554.889) (-550.572) (-551.122) * (-556.377) [-552.224] (-552.311) (-553.943) -- 0:00:23
Average standard deviation of split frequencies: 0.009183
615500 -- (-552.402) (-552.358) (-553.280) [-552.046] * [-551.956] (-555.789) (-550.615) (-552.892) -- 0:00:23
616000 -- (-553.875) (-551.438) [-552.095] (-554.284) * (-553.346) (-550.587) [-552.785] (-550.932) -- 0:00:23
616500 -- [-553.832] (-553.132) (-553.632) (-552.599) * (-551.859) (-550.731) [-551.310] (-551.906) -- 0:00:23
617000 -- [-555.291] (-553.405) (-556.441) (-552.100) * [-556.430] (-555.444) (-551.375) (-552.066) -- 0:00:22
617500 -- [-551.588] (-550.053) (-557.414) (-554.642) * (-555.312) [-552.334] (-553.412) (-550.560) -- 0:00:22
618000 -- (-552.353) (-551.205) (-556.686) [-551.419] * (-553.072) (-552.538) (-551.167) [-550.938] -- 0:00:22
618500 -- [-552.778] (-552.205) (-553.126) (-550.947) * (-552.807) (-551.316) (-551.361) [-550.528] -- 0:00:22
619000 -- [-550.526] (-553.424) (-555.477) (-552.965) * [-551.084] (-551.490) (-553.016) (-552.124) -- 0:00:22
619500 -- [-550.250] (-551.997) (-553.432) (-553.503) * (-552.003) (-551.907) [-551.682] (-557.705) -- 0:00:22
620000 -- (-558.503) [-551.538] (-554.558) (-554.865) * (-552.024) [-550.441] (-552.785) (-551.318) -- 0:00:22
Average standard deviation of split frequencies: 0.009382
620500 -- [-552.516] (-552.404) (-553.299) (-560.588) * (-553.500) (-550.657) [-553.263] (-552.433) -- 0:00:22
621000 -- (-558.179) (-553.228) (-552.025) [-553.069] * (-552.200) [-551.146] (-554.759) (-556.937) -- 0:00:22
621500 -- [-551.148] (-551.085) (-551.134) (-550.572) * [-551.396] (-550.800) (-554.147) (-550.699) -- 0:00:22
622000 -- (-551.633) (-552.549) (-552.190) [-551.612] * (-552.348) (-551.751) (-552.706) [-551.660] -- 0:00:22
622500 -- (-550.872) (-554.944) (-552.353) [-553.847] * (-553.370) [-553.570] (-552.437) (-551.923) -- 0:00:22
623000 -- (-551.245) (-553.060) [-550.510] (-557.476) * (-551.862) (-556.910) (-550.475) [-552.112] -- 0:00:22
623500 -- (-551.580) (-554.389) [-551.230] (-552.354) * (-554.444) (-554.821) [-551.145] (-553.131) -- 0:00:22
624000 -- [-551.556] (-553.852) (-549.999) (-551.909) * (-552.869) (-555.075) [-550.905] (-551.873) -- 0:00:22
624500 -- (-554.628) (-553.966) [-550.215] (-552.081) * (-552.266) (-556.637) (-557.532) [-556.859] -- 0:00:22
625000 -- (-552.077) (-554.890) [-550.206] (-552.503) * (-551.557) [-554.095] (-552.451) (-551.779) -- 0:00:22
Average standard deviation of split frequencies: 0.009347
625500 -- (-550.013) (-550.764) [-550.158] (-558.853) * (-550.091) [-554.174] (-550.891) (-552.586) -- 0:00:22
626000 -- [-556.229] (-550.859) (-554.757) (-553.029) * (-550.994) [-551.261] (-551.358) (-552.116) -- 0:00:22
626500 -- [-555.387] (-551.594) (-550.579) (-550.215) * (-552.943) (-552.511) (-550.558) [-550.661] -- 0:00:22
627000 -- (-553.636) (-550.480) [-552.058] (-554.042) * [-553.693] (-551.979) (-551.764) (-554.646) -- 0:00:22
627500 -- (-552.793) (-551.675) (-554.319) [-554.973] * (-555.419) (-553.103) [-550.402] (-558.103) -- 0:00:22
628000 -- (-554.460) (-551.209) (-556.571) [-552.289] * (-552.193) [-554.432] (-552.609) (-553.745) -- 0:00:22
628500 -- (-552.688) (-555.440) (-552.063) [-551.697] * [-554.183] (-552.321) (-553.125) (-551.542) -- 0:00:22
629000 -- (-550.804) (-552.062) (-550.346) [-552.836] * (-552.843) (-551.445) [-551.457] (-551.972) -- 0:00:22
629500 -- (-552.898) (-553.495) (-553.488) [-552.200] * (-553.534) [-551.752] (-551.733) (-552.522) -- 0:00:22
630000 -- (-555.196) (-554.200) [-551.698] (-553.186) * (-550.638) (-550.649) (-551.117) [-552.481] -- 0:00:22
Average standard deviation of split frequencies: 0.009146
630500 -- (-551.927) [-552.424] (-552.020) (-551.172) * (-551.243) (-551.950) [-551.852] (-554.703) -- 0:00:22
631000 -- (-554.550) (-554.246) [-552.514] (-552.642) * (-554.273) [-551.875] (-551.615) (-552.728) -- 0:00:22
631500 -- (-553.091) [-550.387] (-554.564) (-553.194) * [-552.984] (-550.640) (-551.677) (-551.570) -- 0:00:22
632000 -- (-552.386) (-552.574) (-550.976) [-552.071] * (-550.537) (-551.681) (-556.254) [-550.281] -- 0:00:22
632500 -- (-552.635) (-554.762) [-550.182] (-553.758) * [-552.623] (-550.445) (-553.731) (-552.870) -- 0:00:22
633000 -- (-550.939) (-553.947) [-550.521] (-553.909) * (-551.339) (-552.631) (-554.513) [-552.848] -- 0:00:22
633500 -- (-552.568) [-551.845] (-551.303) (-550.295) * [-550.711] (-551.964) (-551.440) (-554.402) -- 0:00:21
634000 -- (-552.268) (-550.945) [-550.647] (-553.250) * (-551.406) (-552.518) (-552.295) [-551.923] -- 0:00:21
634500 -- (-553.256) (-550.842) [-552.687] (-551.575) * (-551.057) (-551.927) (-554.122) [-552.440] -- 0:00:21
635000 -- (-550.651) [-551.616] (-551.382) (-550.066) * (-556.239) (-552.113) [-550.604] (-552.127) -- 0:00:21
Average standard deviation of split frequencies: 0.009126
635500 -- (-550.488) (-555.054) [-553.540] (-554.256) * [-551.990] (-552.050) (-552.445) (-552.505) -- 0:00:21
636000 -- [-551.504] (-552.642) (-553.486) (-551.224) * [-552.370] (-554.302) (-551.178) (-551.079) -- 0:00:21
636500 -- (-552.230) (-551.921) (-551.815) [-551.382] * (-553.493) (-550.362) (-557.787) [-551.561] -- 0:00:21
637000 -- (-552.247) [-550.973] (-550.258) (-552.129) * (-552.776) (-550.633) [-554.606] (-553.588) -- 0:00:21
637500 -- [-552.223] (-552.220) (-550.476) (-552.415) * (-550.261) (-552.102) (-557.440) [-552.107] -- 0:00:21
638000 -- (-551.895) (-552.810) [-550.958] (-553.816) * (-551.079) (-553.304) [-552.446] (-555.828) -- 0:00:21
638500 -- (-551.078) (-554.171) [-552.794] (-550.301) * (-551.770) (-551.386) [-552.475] (-553.146) -- 0:00:21
639000 -- (-551.909) [-552.574] (-550.667) (-551.346) * [-553.572] (-553.999) (-552.158) (-551.987) -- 0:00:21
639500 -- [-554.143] (-553.745) (-550.801) (-553.174) * (-550.424) (-557.034) [-554.663] (-553.690) -- 0:00:21
640000 -- (-554.135) [-555.775] (-551.152) (-552.608) * (-550.599) (-551.645) (-552.592) [-552.786] -- 0:00:21
Average standard deviation of split frequencies: 0.009795
640500 -- (-557.560) (-552.868) (-552.441) [-552.088] * [-551.829] (-553.643) (-552.918) (-550.793) -- 0:00:21
641000 -- (-553.880) (-551.044) [-552.743] (-551.903) * [-550.834] (-553.175) (-551.799) (-550.234) -- 0:00:21
641500 -- [-553.862] (-551.254) (-551.657) (-555.591) * (-552.383) [-552.456] (-551.063) (-550.828) -- 0:00:21
642000 -- (-551.298) (-552.764) (-553.732) [-550.671] * (-551.815) (-552.713) [-551.522] (-552.636) -- 0:00:21
642500 -- [-552.102] (-554.225) (-551.678) (-550.354) * (-555.930) (-554.353) [-551.582] (-550.209) -- 0:00:21
643000 -- [-552.238] (-552.042) (-550.498) (-551.407) * (-554.985) [-552.330] (-555.250) (-550.387) -- 0:00:21
643500 -- (-554.009) (-551.592) [-551.683] (-551.015) * (-554.055) (-554.640) [-551.563] (-552.362) -- 0:00:21
644000 -- (-553.978) [-551.921] (-551.139) (-551.014) * (-552.373) (-555.078) (-551.178) [-552.361] -- 0:00:21
644500 -- (-552.532) (-552.966) (-551.042) [-551.047] * [-552.548] (-552.507) (-559.085) (-550.912) -- 0:00:21
645000 -- (-552.545) [-552.607] (-550.930) (-550.843) * (-552.619) (-553.029) [-553.211] (-550.776) -- 0:00:21
Average standard deviation of split frequencies: 0.010034
645500 -- (-556.121) (-552.620) [-551.339] (-551.887) * (-550.859) (-552.650) (-553.197) [-553.410] -- 0:00:21
646000 -- [-552.648] (-552.356) (-550.731) (-553.622) * (-551.660) (-553.570) [-549.841] (-552.049) -- 0:00:21
646500 -- [-552.518] (-552.215) (-551.500) (-551.585) * (-556.081) (-551.663) (-552.826) [-554.688] -- 0:00:21
647000 -- (-552.149) (-552.332) (-551.514) [-551.577] * (-551.352) (-551.649) [-552.368] (-554.177) -- 0:00:21
647500 -- (-553.083) (-552.310) [-551.996] (-550.331) * [-550.429] (-554.242) (-551.687) (-553.954) -- 0:00:21
648000 -- (-550.493) [-553.180] (-551.066) (-551.027) * (-550.325) (-554.874) (-552.782) [-551.030] -- 0:00:21
648500 -- (-551.001) (-557.475) [-551.710] (-550.754) * (-550.322) [-554.208] (-554.169) (-550.432) -- 0:00:21
649000 -- (-551.145) [-550.903] (-550.677) (-552.340) * (-550.332) [-551.919] (-555.048) (-551.858) -- 0:00:21
649500 -- [-550.870] (-550.584) (-552.840) (-552.224) * (-550.054) [-550.183] (-554.322) (-555.154) -- 0:00:21
650000 -- (-554.227) [-553.643] (-552.812) (-555.359) * (-550.206) [-551.113] (-555.456) (-552.134) -- 0:00:21
Average standard deviation of split frequencies: 0.009283
650500 -- (-554.487) [-550.914] (-554.537) (-553.939) * (-551.440) (-554.685) [-550.938] (-551.432) -- 0:00:20
651000 -- [-552.300] (-553.824) (-553.776) (-552.715) * [-550.333] (-552.399) (-552.251) (-552.150) -- 0:00:20
651500 -- (-551.499) [-553.253] (-552.132) (-552.042) * (-550.327) (-550.999) [-550.301] (-553.234) -- 0:00:20
652000 -- [-552.350] (-550.278) (-551.846) (-552.831) * (-551.454) (-551.445) (-554.973) [-552.086] -- 0:00:20
652500 -- (-552.361) (-550.944) (-550.732) [-552.089] * (-551.336) (-551.321) (-550.863) [-551.768] -- 0:00:20
653000 -- (-552.597) (-551.074) [-550.712] (-552.299) * (-552.695) [-550.395] (-550.515) (-551.495) -- 0:00:20
653500 -- (-551.561) [-550.457] (-551.756) (-551.168) * [-552.760] (-551.333) (-551.189) (-551.728) -- 0:00:20
654000 -- (-552.999) (-555.730) (-551.008) [-550.834] * (-551.643) (-553.740) (-552.630) [-551.150] -- 0:00:20
654500 -- (-552.955) (-556.990) [-551.955] (-551.860) * (-551.748) [-552.084] (-551.694) (-552.222) -- 0:00:20
655000 -- [-552.095] (-557.302) (-553.462) (-552.278) * (-553.733) (-551.200) (-552.714) [-551.352] -- 0:00:20
Average standard deviation of split frequencies: 0.009701
655500 -- (-551.181) [-550.611] (-554.906) (-550.639) * (-553.669) (-551.305) (-555.146) [-552.144] -- 0:00:20
656000 -- [-550.414] (-552.725) (-555.486) (-550.770) * [-552.713] (-560.548) (-555.443) (-551.036) -- 0:00:20
656500 -- (-555.466) [-557.413] (-557.668) (-551.287) * (-552.214) [-551.764] (-553.961) (-551.905) -- 0:00:20
657000 -- (-551.810) (-551.872) (-552.634) [-552.719] * (-552.515) (-561.315) (-552.095) [-552.031] -- 0:00:20
657500 -- (-555.441) (-552.762) (-553.820) [-551.095] * (-550.607) (-555.439) [-552.055] (-551.368) -- 0:00:20
658000 -- (-553.305) (-553.692) (-552.579) [-552.296] * [-553.625] (-551.866) (-552.876) (-553.252) -- 0:00:20
658500 -- [-552.152] (-551.473) (-553.860) (-552.008) * [-553.913] (-552.585) (-555.570) (-552.644) -- 0:00:20
659000 -- (-551.844) (-552.944) [-553.966] (-557.550) * (-553.984) [-555.027] (-553.750) (-555.754) -- 0:00:20
659500 -- (-553.785) [-554.633] (-551.348) (-556.031) * (-552.188) (-551.575) [-552.462] (-552.280) -- 0:00:20
660000 -- (-552.372) (-552.390) [-551.654] (-551.074) * (-551.890) (-552.440) [-551.446] (-550.111) -- 0:00:20
Average standard deviation of split frequencies: 0.009410
660500 -- [-550.391] (-550.914) (-551.739) (-550.874) * (-552.315) (-551.382) [-551.865] (-550.675) -- 0:00:20
661000 -- (-552.286) [-551.828] (-552.435) (-551.124) * (-553.647) (-552.268) (-552.630) [-552.347] -- 0:00:20
661500 -- (-552.187) (-551.966) (-552.148) [-553.811] * (-559.055) [-550.392] (-551.078) (-551.722) -- 0:00:20
662000 -- (-551.617) [-551.550] (-554.246) (-552.389) * (-550.458) (-551.634) [-553.501] (-553.457) -- 0:00:20
662500 -- [-551.822] (-550.829) (-553.248) (-554.215) * (-558.829) [-551.155] (-551.798) (-553.131) -- 0:00:20
663000 -- [-552.549] (-553.722) (-553.489) (-557.065) * (-554.835) (-554.030) [-553.056] (-554.542) -- 0:00:20
663500 -- (-550.001) (-553.650) (-553.250) [-552.223] * (-550.446) (-554.714) [-551.545] (-552.172) -- 0:00:20
664000 -- (-550.389) [-551.534] (-553.554) (-551.527) * [-552.177] (-554.117) (-551.915) (-551.849) -- 0:00:20
664500 -- (-552.754) (-553.205) (-551.026) [-553.089] * [-553.357] (-551.648) (-555.956) (-551.719) -- 0:00:20
665000 -- (-552.961) (-557.382) [-552.895] (-552.745) * (-553.783) (-553.894) [-555.728] (-553.757) -- 0:00:20
Average standard deviation of split frequencies: 0.009290
665500 -- [-552.366] (-554.976) (-551.478) (-554.392) * [-550.510] (-552.366) (-553.765) (-551.968) -- 0:00:20
666000 -- (-552.117) [-552.046] (-552.864) (-556.239) * [-553.389] (-555.487) (-553.615) (-550.253) -- 0:00:20
666500 -- (-552.562) (-557.808) [-550.889] (-559.161) * (-556.841) [-553.699] (-551.008) (-551.539) -- 0:00:20
667000 -- [-551.912] (-551.238) (-553.740) (-552.887) * (-551.507) (-551.079) [-554.856] (-552.187) -- 0:00:19
667500 -- [-552.818] (-550.290) (-556.185) (-551.639) * (-553.085) (-551.479) [-552.368] (-550.785) -- 0:00:19
668000 -- [-550.189] (-553.723) (-553.385) (-551.201) * [-552.344] (-554.092) (-553.147) (-550.895) -- 0:00:19
668500 -- (-551.753) (-552.301) [-550.696] (-552.459) * (-554.049) (-552.229) (-551.160) [-551.016] -- 0:00:19
669000 -- [-550.944] (-551.645) (-551.679) (-552.130) * (-553.561) (-550.579) (-550.706) [-551.417] -- 0:00:19
669500 -- [-553.197] (-553.950) (-551.302) (-552.688) * (-554.647) (-551.179) [-550.919] (-551.317) -- 0:00:19
670000 -- (-552.261) (-552.174) (-552.576) [-550.297] * (-550.653) (-553.070) [-550.864] (-559.958) -- 0:00:19
Average standard deviation of split frequencies: 0.009138
670500 -- (-551.628) [-550.872] (-551.793) (-551.970) * (-551.131) (-554.756) (-553.480) [-551.181] -- 0:00:19
671000 -- (-552.941) (-552.643) [-551.215] (-553.231) * (-551.353) (-553.411) [-551.678] (-554.857) -- 0:00:19
671500 -- [-551.006] (-554.304) (-552.601) (-552.160) * (-554.258) [-550.235] (-551.403) (-551.988) -- 0:00:19
672000 -- [-550.932] (-558.858) (-551.207) (-556.924) * (-552.648) (-551.125) (-551.847) [-554.021] -- 0:00:19
672500 -- [-551.466] (-556.427) (-556.289) (-551.278) * (-552.506) (-550.113) (-553.048) [-551.434] -- 0:00:19
673000 -- [-551.073] (-553.228) (-557.403) (-550.557) * (-550.156) (-550.063) [-553.444] (-553.959) -- 0:00:19
673500 -- (-552.548) [-551.033] (-554.120) (-550.614) * (-551.151) (-553.030) (-558.071) [-551.224] -- 0:00:19
674000 -- (-550.645) (-550.791) (-553.087) [-551.386] * [-552.380] (-554.039) (-552.796) (-552.556) -- 0:00:19
674500 -- [-555.305] (-550.887) (-553.586) (-550.512) * [-551.292] (-555.495) (-551.269) (-550.011) -- 0:00:19
675000 -- (-559.631) (-550.713) [-550.561] (-550.348) * (-551.888) [-552.496] (-551.817) (-550.011) -- 0:00:19
Average standard deviation of split frequencies: 0.008891
675500 -- [-553.254] (-551.531) (-550.750) (-553.551) * (-551.805) (-553.216) [-551.599] (-552.289) -- 0:00:19
676000 -- (-553.889) (-552.814) [-552.111] (-552.686) * (-553.249) (-554.853) (-550.587) [-550.530] -- 0:00:19
676500 -- [-553.022] (-554.345) (-554.307) (-552.235) * (-551.766) (-550.635) [-551.564] (-553.641) -- 0:00:19
677000 -- [-554.619] (-553.621) (-551.740) (-553.316) * (-555.647) (-551.706) (-550.510) [-551.239] -- 0:00:19
677500 -- (-553.787) [-550.762] (-551.114) (-553.576) * (-551.607) [-551.168] (-552.170) (-553.490) -- 0:00:19
678000 -- (-553.482) (-553.325) [-550.603] (-552.737) * (-554.624) [-551.520] (-551.062) (-552.018) -- 0:00:19
678500 -- (-553.288) (-552.759) [-552.101] (-554.378) * (-552.004) [-551.534] (-550.053) (-553.757) -- 0:00:19
679000 -- (-555.803) (-552.753) (-551.424) [-552.494] * (-553.476) (-551.226) [-554.794] (-555.714) -- 0:00:19
679500 -- (-553.080) [-552.072] (-556.510) (-555.477) * (-552.790) (-551.278) (-551.129) [-551.913] -- 0:00:19
680000 -- (-559.778) (-557.355) (-551.328) [-554.740] * (-554.520) (-555.338) [-550.709] (-551.808) -- 0:00:19
Average standard deviation of split frequencies: 0.008744
680500 -- [-556.254] (-552.290) (-553.284) (-555.642) * (-552.003) [-553.816] (-550.742) (-551.559) -- 0:00:19
681000 -- [-552.540] (-552.195) (-550.673) (-555.186) * (-553.110) [-551.808] (-551.334) (-554.104) -- 0:00:19
681500 -- (-554.787) (-555.783) [-554.175] (-554.375) * (-553.452) (-552.777) (-553.163) [-551.366] -- 0:00:19
682000 -- (-552.012) [-554.279] (-553.266) (-551.665) * (-553.913) (-555.980) (-553.151) [-552.897] -- 0:00:19
682500 -- (-554.471) (-556.526) (-553.823) [-553.160] * (-553.027) (-553.147) [-550.964] (-554.616) -- 0:00:19
683000 -- [-551.039] (-551.531) (-554.023) (-555.030) * [-551.711] (-552.811) (-554.609) (-556.563) -- 0:00:19
683500 -- (-552.908) (-552.274) [-550.731] (-553.554) * (-552.519) (-552.675) [-550.798] (-557.586) -- 0:00:18
684000 -- (-551.142) [-552.756] (-550.544) (-553.640) * (-553.557) (-550.291) [-552.041] (-552.787) -- 0:00:18
684500 -- (-553.433) [-557.294] (-550.962) (-551.467) * (-554.569) (-552.044) [-554.089] (-551.365) -- 0:00:18
685000 -- (-555.348) (-559.303) (-550.445) [-550.237] * [-552.406] (-552.792) (-550.729) (-552.229) -- 0:00:18
Average standard deviation of split frequencies: 0.008719
685500 -- (-552.616) (-553.660) (-550.835) [-550.599] * [-552.041] (-555.133) (-550.625) (-551.638) -- 0:00:18
686000 -- (-550.458) (-552.109) (-550.305) [-553.929] * (-552.727) (-552.973) (-556.693) [-554.247] -- 0:00:18
686500 -- [-551.298] (-552.455) (-551.376) (-554.666) * (-551.067) [-551.851] (-553.867) (-556.923) -- 0:00:18
687000 -- [-552.656] (-555.984) (-552.547) (-551.694) * (-552.893) [-552.056] (-555.396) (-552.048) -- 0:00:19
687500 -- (-552.250) [-552.584] (-552.572) (-551.838) * (-552.201) (-552.810) (-555.056) [-551.821] -- 0:00:19
688000 -- (-559.114) (-553.172) (-551.382) [-550.389] * (-552.186) [-550.846] (-557.145) (-551.112) -- 0:00:19
688500 -- [-550.900] (-550.510) (-556.671) (-552.034) * (-552.064) [-553.155] (-551.418) (-550.800) -- 0:00:19
689000 -- (-551.498) [-551.799] (-552.916) (-553.694) * (-552.775) (-553.818) [-554.149] (-550.818) -- 0:00:18
689500 -- (-551.293) [-550.871] (-552.666) (-552.317) * (-552.705) (-552.901) [-552.805] (-552.085) -- 0:00:18
690000 -- (-551.554) [-555.455] (-555.931) (-552.252) * [-551.225] (-555.104) (-552.065) (-560.258) -- 0:00:18
Average standard deviation of split frequencies: 0.009129
690500 -- [-555.517] (-552.657) (-554.863) (-551.432) * (-550.274) (-552.066) [-552.228] (-554.302) -- 0:00:18
691000 -- (-553.673) (-551.477) [-553.574] (-553.434) * (-550.441) [-551.922] (-551.065) (-551.952) -- 0:00:18
691500 -- (-553.261) [-551.492] (-555.365) (-551.167) * (-551.506) [-551.309] (-553.735) (-553.923) -- 0:00:18
692000 -- [-552.413] (-553.740) (-553.745) (-551.702) * (-551.356) [-555.919] (-550.907) (-551.131) -- 0:00:18
692500 -- (-552.034) [-554.032] (-552.923) (-553.195) * (-556.286) (-551.005) (-550.764) [-550.739] -- 0:00:18
693000 -- (-550.890) [-551.448] (-551.810) (-553.291) * (-551.659) (-551.354) (-560.149) [-551.154] -- 0:00:18
693500 -- (-553.606) (-552.550) (-555.917) [-551.303] * (-552.000) [-549.964] (-559.790) (-551.708) -- 0:00:18
694000 -- [-552.675] (-550.157) (-551.820) (-551.404) * (-553.645) [-553.358] (-556.776) (-550.925) -- 0:00:18
694500 -- [-551.631] (-550.415) (-554.903) (-551.549) * (-552.860) [-550.797] (-550.841) (-553.612) -- 0:00:18
695000 -- (-550.936) [-553.102] (-556.061) (-553.196) * (-554.427) (-552.061) [-551.745] (-554.000) -- 0:00:18
Average standard deviation of split frequencies: 0.009398
695500 -- [-550.724] (-555.758) (-552.088) (-550.669) * [-552.937] (-552.515) (-551.156) (-553.967) -- 0:00:18
696000 -- (-552.388) (-552.704) (-551.955) [-552.469] * (-551.338) (-551.014) [-551.881] (-551.223) -- 0:00:18
696500 -- (-551.026) [-551.188] (-551.333) (-551.600) * (-551.427) (-551.407) [-551.923] (-550.687) -- 0:00:18
697000 -- [-551.597] (-553.350) (-550.654) (-551.126) * [-550.709] (-554.057) (-551.566) (-552.771) -- 0:00:18
697500 -- [-551.457] (-552.082) (-551.079) (-554.235) * (-551.863) (-551.469) [-551.056] (-555.588) -- 0:00:18
698000 -- (-551.629) [-552.231] (-554.000) (-553.480) * [-553.746] (-551.005) (-550.174) (-551.420) -- 0:00:18
698500 -- (-554.188) (-551.925) [-556.769] (-550.146) * (-552.428) (-550.745) [-551.685] (-552.147) -- 0:00:18
699000 -- (-554.529) (-551.547) (-552.374) [-551.500] * [-551.356] (-551.684) (-551.763) (-550.976) -- 0:00:18
699500 -- [-551.651] (-552.141) (-551.130) (-554.930) * [-551.389] (-552.222) (-550.898) (-552.050) -- 0:00:18
700000 -- [-553.063] (-550.748) (-552.644) (-550.662) * (-552.316) (-552.486) (-552.740) [-551.015] -- 0:00:18
Average standard deviation of split frequencies: 0.010008
700500 -- (-552.307) (-550.774) (-552.514) [-550.540] * (-553.624) (-551.212) [-551.463] (-550.513) -- 0:00:17
701000 -- (-551.236) (-552.799) [-552.182] (-553.963) * [-550.612] (-553.661) (-552.186) (-551.782) -- 0:00:17
701500 -- [-552.571] (-551.033) (-551.533) (-552.684) * (-550.458) [-550.337] (-551.833) (-553.563) -- 0:00:17
702000 -- (-554.452) [-554.677] (-552.257) (-554.452) * (-551.798) (-550.513) [-551.604] (-554.583) -- 0:00:18
702500 -- [-551.421] (-555.260) (-552.309) (-552.028) * [-554.006] (-552.080) (-553.496) (-556.373) -- 0:00:18
703000 -- (-552.409) (-551.766) [-550.890] (-554.704) * (-550.827) (-551.259) [-552.342] (-552.305) -- 0:00:18
703500 -- (-551.656) (-552.474) [-553.208] (-552.419) * (-551.208) [-550.634] (-554.707) (-550.940) -- 0:00:18
704000 -- (-556.256) [-552.293] (-555.160) (-550.798) * (-551.806) [-552.273] (-552.503) (-550.633) -- 0:00:18
704500 -- [-550.690] (-554.431) (-554.277) (-555.764) * (-551.393) (-559.000) (-553.429) [-551.753] -- 0:00:18
705000 -- (-550.913) [-552.258] (-553.395) (-553.750) * [-552.088] (-551.581) (-554.337) (-551.905) -- 0:00:17
Average standard deviation of split frequencies: 0.010016
705500 -- (-552.036) (-551.250) (-552.759) [-551.976] * (-555.748) [-552.709] (-551.317) (-550.605) -- 0:00:17
706000 -- (-554.399) (-552.256) [-553.584] (-553.034) * (-552.688) (-555.103) [-550.769] (-552.320) -- 0:00:17
706500 -- (-557.224) (-550.949) (-550.851) [-552.348] * (-553.224) (-554.405) (-550.078) [-550.614] -- 0:00:17
707000 -- [-552.105] (-553.214) (-551.214) (-550.564) * (-551.531) (-550.832) [-550.776] (-550.839) -- 0:00:17
707500 -- [-553.119] (-551.339) (-555.439) (-555.098) * (-550.840) (-551.688) (-550.127) [-553.325] -- 0:00:17
708000 -- (-551.860) [-551.271] (-554.632) (-552.286) * (-552.686) [-551.012] (-552.969) (-556.608) -- 0:00:17
708500 -- (-559.371) [-550.899] (-560.084) (-551.721) * (-552.914) (-551.002) (-551.325) [-555.903] -- 0:00:17
709000 -- (-559.904) [-551.555] (-552.560) (-552.324) * (-550.481) (-549.990) [-551.670] (-554.015) -- 0:00:17
709500 -- (-552.608) [-551.735] (-552.545) (-557.678) * [-552.655] (-551.714) (-551.067) (-554.571) -- 0:00:17
710000 -- [-551.808] (-550.632) (-552.126) (-552.619) * [-552.137] (-553.443) (-551.502) (-554.202) -- 0:00:17
Average standard deviation of split frequencies: 0.010033
710500 -- (-551.041) (-552.267) [-550.637] (-551.809) * (-552.306) [-552.484] (-550.727) (-553.295) -- 0:00:17
711000 -- (-551.079) (-552.944) [-551.982] (-553.380) * (-553.330) (-552.986) (-550.524) [-552.161] -- 0:00:17
711500 -- (-550.494) [-551.815] (-551.327) (-550.270) * [-551.491] (-552.540) (-552.993) (-553.046) -- 0:00:17
712000 -- (-550.766) (-551.768) (-550.394) [-551.553] * [-550.859] (-552.181) (-559.398) (-551.119) -- 0:00:17
712500 -- (-559.085) [-554.380] (-553.112) (-554.220) * (-552.351) [-550.733] (-552.664) (-554.047) -- 0:00:17
713000 -- [-551.855] (-553.644) (-555.346) (-551.310) * (-551.825) (-550.550) [-551.449] (-551.923) -- 0:00:17
713500 -- (-550.943) [-551.656] (-557.327) (-551.654) * (-552.917) (-551.753) [-551.624] (-557.422) -- 0:00:17
714000 -- [-550.294] (-551.960) (-551.484) (-550.679) * (-550.205) (-550.576) (-554.164) [-551.109] -- 0:00:17
714500 -- (-550.684) (-553.703) (-551.708) [-549.949] * (-553.487) (-553.745) [-550.043] (-553.926) -- 0:00:17
715000 -- [-550.534] (-551.747) (-552.153) (-550.291) * (-552.120) (-558.574) [-553.285] (-551.843) -- 0:00:17
Average standard deviation of split frequencies: 0.009752
715500 -- [-553.737] (-552.288) (-553.170) (-550.795) * (-552.416) [-554.059] (-552.057) (-552.700) -- 0:00:17
716000 -- (-551.724) [-553.652] (-557.497) (-553.045) * (-551.360) (-552.675) (-553.430) [-558.220] -- 0:00:17
716500 -- (-552.575) (-552.631) [-552.022] (-554.071) * (-552.569) [-551.292] (-552.440) (-551.260) -- 0:00:17
717000 -- (-550.444) (-555.031) [-551.324] (-554.349) * (-552.005) (-552.526) [-551.667] (-551.683) -- 0:00:17
717500 -- [-552.086] (-552.256) (-550.673) (-555.419) * (-553.252) (-550.857) [-551.653] (-553.516) -- 0:00:17
718000 -- (-553.778) (-550.970) (-551.889) [-552.143] * (-554.573) (-551.082) [-551.664] (-551.249) -- 0:00:17
718500 -- [-556.493] (-552.253) (-552.938) (-554.907) * (-553.353) (-553.796) (-551.743) [-551.192] -- 0:00:17
719000 -- (-553.955) [-550.475] (-551.472) (-555.860) * [-550.856] (-552.841) (-550.062) (-550.710) -- 0:00:17
719500 -- (-550.159) [-551.330] (-552.552) (-554.216) * (-553.548) (-551.121) (-553.784) [-553.612] -- 0:00:17
720000 -- (-553.511) (-555.408) (-550.030) [-553.070] * [-552.829] (-551.697) (-555.474) (-556.421) -- 0:00:17
Average standard deviation of split frequencies: 0.009648
720500 -- (-550.158) (-553.663) (-550.314) [-550.763] * (-551.902) (-554.007) (-552.491) [-557.419] -- 0:00:17
721000 -- (-555.002) (-551.974) [-550.307] (-550.781) * (-550.718) [-552.244] (-552.857) (-552.653) -- 0:00:17
721500 -- (-550.286) (-551.640) [-550.414] (-552.630) * [-550.275] (-552.588) (-552.107) (-552.541) -- 0:00:16
722000 -- [-550.191] (-551.425) (-552.281) (-551.306) * [-550.649] (-554.823) (-551.114) (-550.916) -- 0:00:16
722500 -- [-552.829] (-551.336) (-551.263) (-550.538) * (-550.507) (-553.346) [-551.616] (-552.749) -- 0:00:16
723000 -- [-551.780] (-553.724) (-552.519) (-552.812) * (-553.832) (-550.426) (-552.122) [-552.126] -- 0:00:16
723500 -- (-552.608) (-552.758) (-551.046) [-553.080] * (-555.268) (-550.028) [-551.842] (-550.560) -- 0:00:16
724000 -- [-552.394] (-552.559) (-551.158) (-560.088) * (-552.439) [-553.106] (-550.887) (-553.112) -- 0:00:16
724500 -- (-551.802) [-551.188] (-551.488) (-551.269) * (-553.958) [-554.056] (-550.604) (-552.644) -- 0:00:16
725000 -- (-551.494) [-551.562] (-551.458) (-550.505) * [-553.644] (-552.028) (-550.760) (-554.728) -- 0:00:16
Average standard deviation of split frequencies: 0.009293
725500 -- (-550.588) [-553.240] (-557.189) (-552.720) * (-556.282) [-551.728] (-551.995) (-556.862) -- 0:00:16
726000 -- (-553.295) [-553.189] (-550.944) (-551.221) * (-552.324) (-550.857) [-551.618] (-551.397) -- 0:00:16
726500 -- (-551.624) (-552.928) [-550.999] (-554.225) * (-551.844) [-552.154] (-551.171) (-550.346) -- 0:00:16
727000 -- (-550.685) (-550.322) [-551.651] (-550.923) * (-552.609) (-553.129) (-550.721) [-559.233] -- 0:00:16
727500 -- (-557.088) [-551.826] (-553.714) (-552.825) * (-551.306) (-550.348) (-552.934) [-552.199] -- 0:00:16
728000 -- (-551.374) [-553.076] (-555.148) (-550.604) * (-551.741) [-553.555] (-551.699) (-551.373) -- 0:00:16
728500 -- (-553.507) (-552.798) (-556.122) [-550.517] * [-550.200] (-556.633) (-551.675) (-551.835) -- 0:00:16
729000 -- (-554.682) (-553.909) [-554.119] (-552.450) * [-550.674] (-551.196) (-558.309) (-554.537) -- 0:00:16
729500 -- [-552.278] (-551.961) (-552.764) (-552.039) * [-553.659] (-554.182) (-558.743) (-552.970) -- 0:00:16
730000 -- [-552.865] (-551.800) (-556.746) (-554.539) * [-550.362] (-551.437) (-551.860) (-553.850) -- 0:00:16
Average standard deviation of split frequencies: 0.009799
730500 -- (-552.547) (-552.296) (-557.399) [-550.494] * [-550.156] (-551.992) (-552.608) (-550.337) -- 0:00:16
731000 -- [-551.482] (-552.275) (-553.555) (-553.127) * (-553.013) (-552.060) [-552.964] (-551.416) -- 0:00:16
731500 -- (-557.602) [-552.556] (-552.914) (-551.330) * (-553.637) (-552.494) (-551.445) [-551.310] -- 0:00:16
732000 -- (-553.645) (-551.302) (-552.092) [-550.665] * (-553.472) (-556.509) [-551.489] (-551.330) -- 0:00:16
732500 -- (-551.727) (-552.734) [-553.852] (-551.133) * (-552.345) (-552.957) [-552.689] (-552.586) -- 0:00:16
733000 -- (-553.346) (-555.452) (-554.855) [-551.064] * (-552.177) (-553.223) (-556.202) [-551.673] -- 0:00:16
733500 -- (-550.587) (-553.381) [-551.468] (-551.274) * (-556.860) (-553.802) [-550.849] (-553.109) -- 0:00:16
734000 -- (-552.191) (-550.405) [-552.618] (-554.402) * (-555.216) (-565.638) [-553.311] (-553.238) -- 0:00:16
734500 -- [-550.376] (-552.007) (-550.936) (-552.299) * [-552.090] (-561.355) (-550.521) (-556.913) -- 0:00:16
735000 -- (-551.431) (-554.875) [-556.675] (-552.027) * [-553.459] (-553.235) (-551.385) (-550.879) -- 0:00:16
Average standard deviation of split frequencies: 0.009487
735500 -- (-550.503) [-553.201] (-557.866) (-552.072) * (-553.073) (-554.576) [-550.907] (-554.119) -- 0:00:16
736000 -- (-554.057) [-551.865] (-551.967) (-554.153) * (-550.886) (-553.616) [-552.792] (-551.943) -- 0:00:16
736500 -- (-553.403) (-553.735) [-550.922] (-551.073) * (-554.719) [-550.804] (-552.719) (-551.214) -- 0:00:16
737000 -- (-552.013) (-551.075) [-554.211] (-550.733) * (-554.635) (-553.547) (-551.297) [-552.236] -- 0:00:16
737500 -- [-551.429] (-550.943) (-553.795) (-551.213) * (-550.844) (-550.609) [-554.430] (-550.621) -- 0:00:16
738000 -- (-551.247) (-558.237) [-557.132] (-552.247) * (-550.027) [-554.685] (-554.615) (-551.858) -- 0:00:15
738500 -- (-551.294) (-552.097) [-553.178] (-552.326) * (-552.082) [-551.747] (-552.643) (-554.823) -- 0:00:15
739000 -- (-555.239) [-551.807] (-553.511) (-551.908) * (-551.298) [-555.220] (-554.924) (-554.964) -- 0:00:15
739500 -- (-551.340) (-552.952) [-551.015] (-550.299) * [-551.089] (-552.477) (-553.073) (-553.824) -- 0:00:15
740000 -- (-550.487) [-553.723] (-549.912) (-553.325) * (-551.778) [-550.743] (-551.286) (-556.092) -- 0:00:15
Average standard deviation of split frequencies: 0.009507
740500 -- [-551.102] (-553.126) (-552.380) (-552.820) * (-553.460) [-551.672] (-552.923) (-557.104) -- 0:00:15
741000 -- (-553.329) (-553.130) [-553.223] (-554.394) * (-550.898) (-552.099) [-552.910] (-551.882) -- 0:00:15
741500 -- (-550.714) (-552.067) [-553.219] (-550.969) * (-555.216) (-552.761) (-552.021) [-551.055] -- 0:00:15
742000 -- (-551.418) (-550.376) (-552.820) [-551.125] * (-555.305) [-551.619] (-552.352) (-550.059) -- 0:00:15
742500 -- (-551.830) (-553.311) [-550.917] (-552.626) * (-551.526) [-550.897] (-552.164) (-553.456) -- 0:00:15
743000 -- (-551.097) (-556.052) (-550.977) [-554.082] * (-553.855) [-551.510] (-551.608) (-551.063) -- 0:00:15
743500 -- [-552.368] (-556.082) (-551.791) (-553.854) * (-554.361) [-552.518] (-552.639) (-559.940) -- 0:00:15
744000 -- (-556.577) (-557.943) (-551.409) [-550.281] * (-555.284) [-550.280] (-555.614) (-550.624) -- 0:00:15
744500 -- (-557.464) (-553.216) [-551.220] (-550.736) * [-551.591] (-550.469) (-552.931) (-551.950) -- 0:00:15
745000 -- [-551.737] (-556.077) (-556.005) (-560.479) * [-551.769] (-551.391) (-550.896) (-550.857) -- 0:00:15
Average standard deviation of split frequencies: 0.009637
745500 -- (-555.342) (-550.783) [-551.667] (-558.820) * (-550.167) (-555.103) [-552.689] (-553.565) -- 0:00:15
746000 -- (-553.070) [-553.086] (-551.125) (-551.420) * (-558.916) [-555.349] (-552.359) (-553.320) -- 0:00:15
746500 -- [-551.133] (-554.972) (-551.045) (-556.666) * (-552.231) [-551.771] (-557.440) (-551.856) -- 0:00:15
747000 -- [-551.544] (-551.279) (-550.558) (-555.164) * (-550.479) [-552.641] (-553.506) (-553.089) -- 0:00:15
747500 -- (-558.952) [-550.890] (-550.597) (-551.927) * (-554.021) (-553.988) (-552.715) [-552.909] -- 0:00:15
748000 -- (-551.420) [-550.638] (-555.907) (-554.550) * (-553.913) (-551.490) [-554.436] (-553.438) -- 0:00:15
748500 -- (-551.311) [-553.500] (-558.730) (-553.380) * [-553.142] (-551.331) (-554.314) (-566.584) -- 0:00:15
749000 -- [-555.338] (-550.158) (-555.656) (-551.743) * [-558.222] (-551.553) (-553.386) (-552.566) -- 0:00:15
749500 -- (-554.083) (-551.033) (-557.142) [-551.280] * [-558.142] (-553.758) (-551.676) (-557.662) -- 0:00:15
750000 -- [-555.633] (-558.646) (-553.739) (-552.634) * (-552.181) [-551.435] (-552.273) (-553.453) -- 0:00:15
Average standard deviation of split frequencies: 0.009066
750500 -- (-554.806) (-558.211) [-552.742] (-554.922) * (-551.714) (-552.598) (-553.042) [-552.003] -- 0:00:15
751000 -- (-554.072) [-551.349] (-551.070) (-553.833) * (-555.625) [-552.953] (-552.420) (-551.146) -- 0:00:15
751500 -- [-550.251] (-550.181) (-551.503) (-550.645) * [-554.000] (-551.953) (-553.224) (-551.843) -- 0:00:15
752000 -- (-554.537) (-550.221) [-551.533] (-553.012) * [-553.326] (-552.756) (-550.955) (-553.370) -- 0:00:15
752500 -- (-551.720) (-551.945) [-552.437] (-552.937) * (-550.364) (-550.272) [-553.719] (-551.594) -- 0:00:15
753000 -- (-551.388) [-551.685] (-553.130) (-550.266) * (-550.382) (-551.220) [-551.039] (-550.650) -- 0:00:15
753500 -- (-555.647) (-554.178) [-551.605] (-551.421) * (-551.414) [-551.126] (-555.159) (-550.747) -- 0:00:15
754000 -- (-552.175) (-552.060) (-551.796) [-552.182] * (-550.530) [-550.523] (-554.127) (-554.805) -- 0:00:15
754500 -- (-554.100) (-550.728) [-551.339] (-550.522) * (-551.636) (-551.697) [-552.202] (-551.525) -- 0:00:14
755000 -- [-551.224] (-552.473) (-551.494) (-553.051) * (-551.300) [-554.034] (-550.250) (-552.037) -- 0:00:14
Average standard deviation of split frequencies: 0.009236
755500 -- (-553.187) [-551.655] (-553.013) (-550.889) * (-555.069) [-553.392] (-550.772) (-551.117) -- 0:00:14
756000 -- (-554.417) (-551.175) (-551.727) [-550.649] * (-554.321) [-551.570] (-551.170) (-565.164) -- 0:00:14
756500 -- (-553.253) (-552.028) [-551.274] (-553.921) * (-550.492) [-551.169] (-553.339) (-551.164) -- 0:00:14
757000 -- (-553.077) (-552.530) (-550.614) [-551.564] * (-550.770) (-552.494) (-552.153) [-550.680] -- 0:00:14
757500 -- [-552.325] (-553.734) (-552.384) (-550.779) * [-553.405] (-554.154) (-550.860) (-551.884) -- 0:00:14
758000 -- (-551.079) (-553.526) (-551.573) [-550.705] * (-552.263) [-551.952] (-550.832) (-551.132) -- 0:00:14
758500 -- (-551.185) [-551.009] (-550.820) (-552.048) * [-552.870] (-550.412) (-555.274) (-555.739) -- 0:00:14
759000 -- [-551.333] (-550.668) (-550.628) (-550.205) * (-553.024) (-550.254) [-551.935] (-553.521) -- 0:00:14
759500 -- (-552.318) (-553.002) [-554.625] (-549.840) * (-555.035) [-553.530] (-550.176) (-550.779) -- 0:00:14
760000 -- [-552.140] (-550.885) (-557.492) (-552.049) * [-551.638] (-554.976) (-551.287) (-550.682) -- 0:00:14
Average standard deviation of split frequencies: 0.008986
760500 -- [-556.429] (-551.507) (-557.489) (-551.644) * (-551.795) (-551.399) (-555.092) [-550.824] -- 0:00:14
761000 -- (-551.133) [-553.000] (-554.240) (-551.175) * (-553.338) [-552.242] (-554.486) (-550.358) -- 0:00:14
761500 -- (-553.771) (-552.586) (-550.878) [-551.676] * [-552.883] (-554.362) (-554.014) (-551.968) -- 0:00:14
762000 -- (-552.521) (-553.153) [-552.116] (-550.350) * [-552.858] (-551.616) (-555.300) (-555.318) -- 0:00:14
762500 -- (-552.416) (-553.004) [-553.326] (-550.165) * (-551.528) (-550.866) (-554.629) [-556.291] -- 0:00:14
763000 -- [-552.599] (-554.374) (-550.843) (-551.063) * [-552.239] (-551.263) (-550.842) (-554.736) -- 0:00:14
763500 -- [-551.906] (-553.638) (-550.286) (-553.600) * [-557.409] (-555.052) (-551.399) (-550.344) -- 0:00:14
764000 -- [-550.493] (-551.654) (-550.654) (-556.260) * (-555.438) (-553.162) [-554.197] (-551.195) -- 0:00:14
764500 -- [-550.458] (-551.511) (-553.805) (-553.859) * (-552.531) (-553.338) (-551.238) [-553.862] -- 0:00:14
765000 -- [-551.857] (-554.088) (-550.999) (-552.747) * (-553.542) (-553.038) (-551.796) [-551.903] -- 0:00:14
Average standard deviation of split frequencies: 0.008847
765500 -- (-551.922) [-553.685] (-551.557) (-550.601) * [-553.853] (-551.272) (-550.671) (-552.272) -- 0:00:14
766000 -- (-551.567) [-554.232] (-552.654) (-551.781) * [-552.326] (-555.753) (-552.540) (-553.809) -- 0:00:14
766500 -- (-553.030) (-553.177) [-555.441] (-554.017) * (-552.007) (-553.488) (-552.230) [-550.611] -- 0:00:14
767000 -- (-553.087) (-554.966) [-550.539] (-551.339) * (-556.759) (-551.921) [-551.423] (-551.618) -- 0:00:14
767500 -- (-554.268) [-554.144] (-551.611) (-551.067) * (-555.699) (-551.611) (-553.939) [-553.344] -- 0:00:14
768000 -- [-551.178] (-558.282) (-552.902) (-557.146) * (-552.105) (-551.229) (-550.158) [-550.415] -- 0:00:14
768500 -- (-551.051) (-554.536) [-552.804] (-551.426) * (-550.770) (-553.753) (-554.132) [-556.039] -- 0:00:14
769000 -- (-552.293) [-551.114] (-552.494) (-553.197) * (-554.692) (-551.973) (-550.839) [-550.773] -- 0:00:14
769500 -- [-552.578] (-550.882) (-551.735) (-555.185) * (-555.093) (-553.218) (-551.932) [-554.704] -- 0:00:14
770000 -- (-552.162) (-550.363) [-551.374] (-550.539) * (-553.214) (-555.212) [-553.004] (-553.839) -- 0:00:14
Average standard deviation of split frequencies: 0.008143
770500 -- (-553.939) [-551.153] (-550.917) (-551.547) * (-556.334) [-550.809] (-551.083) (-554.531) -- 0:00:13
771000 -- [-553.233] (-552.863) (-556.463) (-551.409) * (-554.366) (-554.724) (-552.488) [-552.626] -- 0:00:13
771500 -- [-553.303] (-554.169) (-556.400) (-551.651) * (-551.347) (-554.531) (-551.883) [-551.879] -- 0:00:13
772000 -- (-555.385) (-556.054) [-550.620] (-551.395) * (-550.958) (-554.935) (-552.511) [-551.303] -- 0:00:13
772500 -- (-554.956) [-553.621] (-558.081) (-554.076) * (-552.221) (-553.629) [-554.342] (-553.836) -- 0:00:13
773000 -- (-554.020) [-550.512] (-552.610) (-552.581) * (-552.919) (-554.494) [-554.567] (-552.575) -- 0:00:13
773500 -- [-551.611] (-550.379) (-551.555) (-552.045) * [-550.742] (-555.427) (-554.618) (-553.895) -- 0:00:13
774000 -- (-551.882) (-551.661) (-555.033) [-553.255] * [-551.579] (-552.303) (-553.481) (-552.175) -- 0:00:14
774500 -- (-553.265) [-550.365] (-553.568) (-553.198) * (-551.898) (-551.378) (-550.339) [-550.847] -- 0:00:13
775000 -- (-552.627) (-551.037) (-550.931) [-553.314] * (-551.438) (-551.374) [-550.436] (-551.657) -- 0:00:13
Average standard deviation of split frequencies: 0.007821
775500 -- (-553.481) (-550.969) [-553.554] (-551.015) * (-550.481) [-550.455] (-555.214) (-553.241) -- 0:00:13
776000 -- (-551.060) [-551.023] (-551.716) (-551.017) * (-550.387) (-553.243) [-553.608] (-557.587) -- 0:00:13
776500 -- (-550.583) (-554.410) (-555.074) [-553.657] * (-551.170) (-553.043) [-552.400] (-554.345) -- 0:00:13
777000 -- (-554.039) [-553.768] (-557.144) (-550.509) * (-552.174) [-555.709] (-559.851) (-554.517) -- 0:00:13
777500 -- [-550.983] (-552.253) (-553.262) (-553.357) * (-552.973) (-551.227) [-551.358] (-555.369) -- 0:00:13
778000 -- (-553.704) (-553.088) (-552.891) [-556.143] * (-552.518) [-551.686] (-555.471) (-553.349) -- 0:00:13
778500 -- (-552.307) [-552.453] (-551.926) (-553.702) * (-554.157) [-555.458] (-554.049) (-552.493) -- 0:00:13
779000 -- (-553.610) [-555.929] (-552.530) (-552.419) * [-552.711] (-551.212) (-552.847) (-554.576) -- 0:00:13
779500 -- [-553.107] (-560.415) (-551.960) (-553.212) * (-551.810) [-553.184] (-551.869) (-550.863) -- 0:00:13
780000 -- [-550.887] (-558.652) (-555.990) (-551.727) * [-551.058] (-551.223) (-551.939) (-550.798) -- 0:00:13
Average standard deviation of split frequencies: 0.007661
780500 -- (-554.053) [-553.574] (-552.349) (-552.722) * (-551.271) [-553.402] (-555.063) (-554.594) -- 0:00:13
781000 -- (-551.011) (-553.540) (-554.172) [-550.840] * (-553.078) (-554.121) (-550.711) [-552.116] -- 0:00:13
781500 -- (-554.267) (-554.653) [-550.824] (-552.778) * [-556.252] (-551.496) (-554.769) (-553.553) -- 0:00:13
782000 -- (-551.922) (-553.795) (-551.210) [-553.848] * [-551.904] (-551.670) (-553.084) (-552.202) -- 0:00:13
782500 -- [-552.234] (-551.862) (-551.060) (-550.808) * (-553.290) (-552.345) [-551.246] (-552.558) -- 0:00:13
783000 -- (-551.939) [-551.509] (-554.053) (-550.944) * (-551.589) (-554.063) [-551.837] (-553.931) -- 0:00:13
783500 -- (-551.957) (-551.507) (-553.708) [-551.560] * (-551.915) (-550.863) [-552.066] (-553.994) -- 0:00:13
784000 -- (-553.360) [-553.263] (-554.578) (-551.844) * [-550.355] (-551.650) (-554.728) (-551.561) -- 0:00:13
784500 -- (-559.383) [-552.981] (-552.465) (-556.975) * (-551.492) [-556.798] (-550.196) (-550.603) -- 0:00:13
785000 -- (-550.472) (-550.549) (-551.976) [-552.200] * (-551.584) (-551.624) [-551.749] (-550.274) -- 0:00:13
Average standard deviation of split frequencies: 0.007309
785500 -- (-550.948) [-551.940] (-551.262) (-555.781) * (-554.637) (-552.538) (-552.477) [-551.805] -- 0:00:13
786000 -- (-553.123) (-550.525) [-550.310] (-553.348) * (-549.950) (-551.919) [-552.561] (-551.197) -- 0:00:13
786500 -- (-554.442) (-557.967) [-555.456] (-551.713) * (-553.403) (-555.167) [-550.906] (-551.657) -- 0:00:13
787000 -- (-551.852) [-554.719] (-553.212) (-551.658) * [-551.091] (-555.176) (-553.046) (-551.650) -- 0:00:12
787500 -- (-556.737) [-554.796] (-550.792) (-551.350) * (-551.262) (-550.888) (-554.454) [-552.026] -- 0:00:12
788000 -- (-555.292) (-553.840) (-552.030) [-551.759] * (-551.893) (-553.388) [-552.275] (-552.286) -- 0:00:12
788500 -- [-552.119] (-555.858) (-552.226) (-552.236) * (-551.783) [-552.598] (-556.467) (-551.749) -- 0:00:13
789000 -- (-552.498) (-552.267) [-552.825] (-552.247) * [-552.370] (-557.702) (-553.357) (-552.291) -- 0:00:13
789500 -- (-554.025) (-552.168) (-552.871) [-553.067] * (-551.433) (-551.446) [-554.998] (-552.291) -- 0:00:13
790000 -- (-552.086) [-553.217] (-553.353) (-555.820) * [-551.477] (-552.239) (-552.952) (-553.767) -- 0:00:13
Average standard deviation of split frequencies: 0.007676
790500 -- (-551.074) (-553.064) [-551.424] (-550.671) * (-559.319) [-554.745] (-550.344) (-550.129) -- 0:00:12
791000 -- (-550.575) (-550.831) (-552.649) [-550.825] * (-552.784) (-552.797) (-552.360) [-552.869] -- 0:00:12
791500 -- [-550.472] (-551.690) (-551.109) (-550.806) * (-556.393) [-550.796] (-554.076) (-551.461) -- 0:00:12
792000 -- [-550.914] (-553.036) (-554.109) (-552.267) * (-551.551) (-553.406) [-551.748] (-552.043) -- 0:00:12
792500 -- (-551.323) (-552.365) (-556.976) [-550.455] * (-549.866) [-551.793] (-554.450) (-550.901) -- 0:00:12
793000 -- [-556.634] (-551.816) (-552.566) (-552.646) * (-551.915) (-551.688) (-559.337) [-550.951] -- 0:00:12
793500 -- (-550.707) [-551.012] (-557.455) (-553.611) * (-550.520) (-555.215) (-555.241) [-551.809] -- 0:00:12
794000 -- (-551.343) (-556.219) (-554.275) [-551.525] * [-551.925] (-554.230) (-552.847) (-551.172) -- 0:00:12
794500 -- (-553.080) [-550.446] (-550.535) (-556.359) * [-554.806] (-550.590) (-552.119) (-552.894) -- 0:00:12
795000 -- (-550.900) [-552.888] (-551.013) (-552.238) * [-551.365] (-551.852) (-552.567) (-550.801) -- 0:00:12
Average standard deviation of split frequencies: 0.007403
795500 -- [-550.767] (-552.173) (-551.079) (-552.046) * (-553.360) [-552.677] (-551.437) (-550.201) -- 0:00:12
796000 -- [-551.911] (-552.043) (-550.421) (-550.853) * [-552.266] (-553.010) (-554.412) (-550.846) -- 0:00:12
796500 -- (-550.309) (-553.701) [-550.384] (-550.824) * (-554.102) (-550.489) (-557.613) [-553.085] -- 0:00:12
797000 -- (-551.191) (-552.616) (-553.501) [-551.140] * (-556.529) (-550.663) [-554.212] (-550.555) -- 0:00:12
797500 -- (-550.101) (-552.811) (-552.968) [-550.812] * [-550.001] (-551.428) (-553.035) (-550.493) -- 0:00:12
798000 -- [-553.832] (-552.580) (-550.930) (-551.005) * (-554.418) [-550.934] (-552.779) (-551.535) -- 0:00:12
798500 -- (-551.797) (-550.741) [-553.217] (-552.637) * (-554.701) (-552.454) [-551.441] (-554.445) -- 0:00:12
799000 -- (-551.238) (-550.734) [-553.676] (-551.469) * (-552.906) (-552.680) [-551.475] (-552.209) -- 0:00:12
799500 -- (-551.647) (-553.571) (-551.469) [-550.092] * [-550.468] (-550.345) (-553.330) (-551.596) -- 0:00:12
800000 -- (-550.244) [-551.743] (-556.456) (-552.120) * (-553.594) (-552.105) (-552.141) [-551.227] -- 0:00:12
Average standard deviation of split frequencies: 0.007728
800500 -- (-550.578) [-555.203] (-554.677) (-556.402) * (-552.960) [-552.434] (-550.851) (-551.256) -- 0:00:12
801000 -- (-551.091) (-551.447) (-555.108) [-555.277] * (-552.093) (-551.975) (-552.922) [-550.880] -- 0:00:12
801500 -- (-551.925) [-551.233] (-552.136) (-555.249) * (-551.357) (-551.299) (-553.477) [-553.312] -- 0:00:12
802000 -- (-555.052) (-552.260) [-550.860] (-555.520) * (-553.879) [-553.383] (-554.895) (-554.367) -- 0:00:12
802500 -- (-555.559) [-551.804] (-554.595) (-552.457) * (-553.847) (-551.361) [-553.775] (-550.994) -- 0:00:12
803000 -- (-554.166) (-553.793) (-553.955) [-552.011] * (-551.590) [-555.701] (-554.074) (-554.128) -- 0:00:12
803500 -- (-551.596) (-550.897) (-551.970) [-551.830] * (-553.261) (-553.627) (-553.271) [-550.867] -- 0:00:12
804000 -- (-556.380) [-555.646] (-551.885) (-552.675) * (-554.552) [-553.736] (-553.106) (-557.116) -- 0:00:12
804500 -- (-551.625) [-553.145] (-552.572) (-553.041) * (-556.773) (-552.640) [-550.412] (-552.085) -- 0:00:12
805000 -- [-551.566] (-551.303) (-552.954) (-554.001) * (-551.113) (-552.507) (-552.031) [-551.649] -- 0:00:12
Average standard deviation of split frequencies: 0.008005
805500 -- (-550.849) (-553.734) [-555.447] (-553.969) * (-551.762) (-551.220) [-554.607] (-553.005) -- 0:00:12
806000 -- (-553.715) (-552.313) [-553.281] (-550.905) * (-550.771) (-551.238) [-551.675] (-552.489) -- 0:00:12
806500 -- [-554.955] (-550.661) (-554.028) (-554.820) * (-552.843) (-552.209) (-553.502) [-551.423] -- 0:00:11
807000 -- (-552.412) [-551.417] (-550.839) (-551.865) * (-552.165) [-552.260] (-551.095) (-551.375) -- 0:00:11
807500 -- (-552.772) (-552.260) [-550.473] (-551.194) * [-550.878] (-550.936) (-552.304) (-551.382) -- 0:00:11
808000 -- (-553.548) (-552.286) [-551.831] (-551.108) * (-552.948) (-551.301) (-555.131) [-550.434] -- 0:00:11
808500 -- [-554.252] (-551.444) (-551.963) (-551.960) * [-552.865] (-553.001) (-554.331) (-551.342) -- 0:00:11
809000 -- [-552.526] (-553.628) (-552.826) (-553.363) * (-553.695) (-557.476) (-550.830) [-551.392] -- 0:00:11
809500 -- (-553.624) (-555.457) (-553.010) [-554.675] * [-551.107] (-554.420) (-551.032) (-554.441) -- 0:00:11
810000 -- (-556.729) (-550.197) (-552.269) [-556.266] * (-550.536) (-551.526) [-551.609] (-553.846) -- 0:00:11
Average standard deviation of split frequencies: 0.007341
810500 -- (-558.450) (-551.144) (-553.015) [-552.116] * (-550.512) (-552.984) [-552.231] (-552.914) -- 0:00:11
811000 -- (-556.137) [-551.089] (-550.250) (-552.235) * (-553.251) (-551.172) [-551.529] (-550.866) -- 0:00:11
811500 -- (-551.845) (-551.992) [-550.334] (-551.490) * (-552.345) (-556.956) (-553.528) [-550.743] -- 0:00:11
812000 -- (-551.748) [-553.898] (-555.557) (-552.925) * (-551.905) [-551.571] (-557.269) (-552.466) -- 0:00:11
812500 -- (-552.381) [-552.940] (-553.551) (-553.663) * (-552.390) [-551.664] (-555.087) (-552.573) -- 0:00:11
813000 -- (-551.438) (-550.320) [-553.164] (-553.059) * (-554.588) (-553.693) [-551.690] (-552.282) -- 0:00:11
813500 -- (-554.946) (-555.017) (-553.791) [-552.889] * (-554.366) (-554.017) (-553.904) [-550.194] -- 0:00:11
814000 -- (-553.579) (-554.697) [-552.828] (-559.071) * (-554.000) (-552.241) (-553.556) [-551.543] -- 0:00:11
814500 -- (-553.926) (-550.882) (-552.044) [-554.801] * (-552.645) (-553.261) (-551.517) [-552.840] -- 0:00:11
815000 -- (-552.041) (-550.771) (-550.729) [-550.208] * [-552.811] (-553.036) (-552.031) (-553.774) -- 0:00:11
Average standard deviation of split frequencies: 0.007546
815500 -- (-553.909) (-551.767) [-558.502] (-551.875) * (-554.136) [-553.464] (-551.275) (-552.313) -- 0:00:11
816000 -- (-552.141) (-554.085) (-551.276) [-552.466] * [-556.636] (-554.166) (-552.492) (-551.300) -- 0:00:11
816500 -- [-551.953] (-555.887) (-549.900) (-550.636) * (-551.681) (-552.120) (-553.075) [-554.244] -- 0:00:11
817000 -- (-553.544) (-555.019) [-551.335] (-554.112) * [-551.969] (-551.370) (-553.266) (-550.924) -- 0:00:11
817500 -- (-551.472) (-553.348) (-552.855) [-549.934] * (-552.872) [-553.380] (-551.630) (-552.249) -- 0:00:11
818000 -- [-551.522] (-554.073) (-558.329) (-551.530) * (-553.979) (-550.534) [-550.813] (-552.757) -- 0:00:11
818500 -- (-551.570) [-552.648] (-554.289) (-553.681) * (-553.760) (-551.633) [-550.492] (-551.038) -- 0:00:11
819000 -- [-555.905] (-551.258) (-555.076) (-550.561) * [-551.925] (-551.485) (-555.865) (-551.541) -- 0:00:11
819500 -- [-550.333] (-551.988) (-554.818) (-552.355) * [-551.850] (-550.932) (-554.773) (-553.433) -- 0:00:11
820000 -- (-550.564) [-550.082] (-552.674) (-553.134) * [-550.794] (-553.110) (-555.113) (-553.451) -- 0:00:11
Average standard deviation of split frequencies: 0.007647
820500 -- (-552.324) (-550.023) (-551.502) [-555.244] * (-551.259) (-553.749) (-555.942) [-553.803] -- 0:00:11
821000 -- (-550.690) [-550.665] (-556.497) (-553.288) * (-554.068) (-553.691) (-555.191) [-555.114] -- 0:00:11
821500 -- (-551.444) [-550.484] (-552.039) (-551.216) * (-555.916) (-552.694) (-552.623) [-552.207] -- 0:00:11
822000 -- (-551.188) (-553.259) (-554.834) [-551.987] * (-551.810) (-553.687) [-553.114] (-552.577) -- 0:00:11
822500 -- (-553.617) (-554.266) [-552.584] (-550.486) * (-552.640) (-551.440) [-555.044] (-553.295) -- 0:00:11
823000 -- [-552.158] (-550.750) (-550.806) (-553.110) * [-552.337] (-550.803) (-554.297) (-551.292) -- 0:00:10
823500 -- [-551.376] (-550.150) (-551.350) (-554.368) * (-552.136) [-553.139] (-552.493) (-553.149) -- 0:00:10
824000 -- (-552.506) [-552.011] (-552.940) (-550.921) * (-552.309) (-552.925) [-550.775] (-551.818) -- 0:00:10
824500 -- (-558.486) [-551.213] (-553.642) (-550.779) * (-553.498) [-550.660] (-553.183) (-551.365) -- 0:00:10
825000 -- (-553.190) [-551.876] (-552.192) (-554.453) * (-552.423) (-552.785) [-551.864] (-552.136) -- 0:00:10
Average standard deviation of split frequencies: 0.007990
825500 -- (-552.483) (-554.611) [-552.692] (-550.059) * [-551.252] (-550.335) (-554.258) (-554.217) -- 0:00:10
826000 -- [-554.802] (-552.995) (-552.373) (-550.832) * (-552.041) (-551.630) [-551.422] (-555.636) -- 0:00:10
826500 -- (-552.942) (-551.878) [-553.321] (-550.354) * (-551.064) [-551.262] (-553.462) (-551.246) -- 0:00:10
827000 -- (-551.381) (-553.793) (-551.299) [-551.698] * (-551.420) [-550.897] (-550.447) (-551.170) -- 0:00:10
827500 -- (-550.972) [-553.388] (-550.729) (-551.690) * (-551.446) (-552.893) (-551.923) [-553.675] -- 0:00:10
828000 -- [-551.221] (-554.204) (-552.224) (-551.687) * [-552.682] (-555.073) (-551.884) (-551.473) -- 0:00:10
828500 -- [-551.549] (-552.435) (-551.506) (-551.154) * (-550.832) (-554.524) [-554.464] (-551.238) -- 0:00:10
829000 -- (-551.830) [-552.426] (-551.682) (-552.171) * (-551.660) (-553.501) [-551.092] (-550.652) -- 0:00:10
829500 -- (-554.522) (-551.010) [-551.935] (-554.722) * (-552.059) (-553.932) (-553.342) [-550.050] -- 0:00:10
830000 -- [-552.958] (-554.013) (-550.975) (-555.120) * (-551.708) (-552.284) (-551.728) [-552.697] -- 0:00:10
Average standard deviation of split frequencies: 0.008016
830500 -- (-550.227) (-552.247) (-551.662) [-554.776] * (-554.691) (-554.388) (-553.313) [-552.884] -- 0:00:10
831000 -- (-550.373) (-554.073) [-551.376] (-550.222) * [-550.667] (-551.143) (-555.554) (-555.404) -- 0:00:10
831500 -- (-553.934) (-552.318) [-551.545] (-550.972) * (-551.015) (-553.769) [-550.567] (-552.459) -- 0:00:10
832000 -- [-552.346] (-550.912) (-554.097) (-554.499) * [-551.179] (-552.102) (-556.542) (-553.509) -- 0:00:10
832500 -- (-551.734) (-553.219) [-551.541] (-552.708) * (-553.225) (-551.568) [-556.430] (-552.010) -- 0:00:10
833000 -- (-553.207) [-552.627] (-552.456) (-556.151) * (-551.527) (-550.455) (-550.795) [-552.653] -- 0:00:10
833500 -- (-554.864) (-550.635) [-550.792] (-554.563) * [-551.333] (-553.149) (-550.213) (-552.578) -- 0:00:10
834000 -- (-554.006) [-555.844] (-551.099) (-552.681) * (-552.425) (-555.310) [-552.355] (-551.145) -- 0:00:10
834500 -- [-550.900] (-552.477) (-551.347) (-552.458) * [-553.152] (-557.340) (-553.740) (-553.195) -- 0:00:10
835000 -- (-550.995) (-554.716) (-550.752) [-556.597] * (-554.836) [-555.533] (-552.757) (-552.695) -- 0:00:10
Average standard deviation of split frequencies: 0.008292
835500 -- (-550.597) [-554.324] (-552.196) (-559.515) * (-551.769) [-551.007] (-559.497) (-551.705) -- 0:00:10
836000 -- (-554.895) (-550.323) (-551.806) [-553.674] * (-551.592) [-552.766] (-554.164) (-557.810) -- 0:00:10
836500 -- [-553.475] (-550.396) (-552.795) (-550.146) * (-553.306) (-552.123) (-551.306) [-552.710] -- 0:00:10
837000 -- (-551.649) [-555.350] (-550.862) (-551.767) * (-554.806) (-550.225) [-552.995] (-551.743) -- 0:00:10
837500 -- (-553.759) (-553.782) [-552.016] (-550.440) * [-554.586] (-551.914) (-554.555) (-551.518) -- 0:00:10
838000 -- [-551.561] (-551.725) (-556.511) (-551.121) * (-553.365) [-552.818] (-550.410) (-551.621) -- 0:00:10
838500 -- (-552.239) [-550.462] (-550.379) (-552.779) * (-551.738) [-552.530] (-552.339) (-551.136) -- 0:00:10
839000 -- (-554.115) (-551.101) [-552.954] (-552.564) * (-553.201) (-551.101) (-551.483) [-552.960] -- 0:00:09
839500 -- (-555.590) [-550.472] (-552.712) (-552.760) * [-551.374] (-553.524) (-550.759) (-551.133) -- 0:00:09
840000 -- (-554.587) [-552.430] (-551.527) (-551.355) * (-551.113) (-549.957) (-551.611) [-550.951] -- 0:00:09
Average standard deviation of split frequencies: 0.007675
840500 -- (-553.008) [-550.679] (-554.164) (-555.570) * (-552.438) (-550.307) [-551.615] (-557.227) -- 0:00:09
841000 -- (-552.433) [-552.018] (-552.153) (-554.917) * (-553.227) [-550.478] (-552.830) (-553.551) -- 0:00:09
841500 -- (-555.597) (-554.454) [-553.836] (-553.803) * (-550.170) (-552.910) (-552.576) [-556.219] -- 0:00:09
842000 -- (-554.431) [-550.384] (-552.497) (-553.226) * (-551.762) [-552.222] (-553.130) (-554.585) -- 0:00:09
842500 -- (-555.061) [-552.841] (-554.537) (-552.933) * (-551.561) (-553.721) [-551.470] (-556.146) -- 0:00:09
843000 -- (-553.061) (-552.108) (-553.606) [-553.955] * [-551.279] (-553.766) (-550.943) (-558.814) -- 0:00:09
843500 -- (-551.371) (-550.563) [-554.844] (-554.221) * (-553.692) (-553.271) (-551.226) [-553.055] -- 0:00:09
844000 -- (-552.191) (-552.404) (-554.646) [-551.272] * (-556.478) (-551.478) (-550.602) [-550.403] -- 0:00:09
844500 -- (-552.293) (-555.051) [-554.609] (-550.829) * [-554.923] (-551.319) (-553.509) (-551.788) -- 0:00:09
845000 -- (-552.233) (-552.586) [-551.178] (-554.022) * (-554.016) (-553.124) [-552.948] (-550.576) -- 0:00:09
Average standard deviation of split frequencies: 0.007703
845500 -- [-552.195] (-552.373) (-550.574) (-552.932) * [-552.175] (-550.920) (-553.710) (-551.083) -- 0:00:09
846000 -- (-552.290) (-555.420) (-552.915) [-552.714] * (-552.608) (-549.882) (-554.944) [-552.069] -- 0:00:09
846500 -- (-552.303) [-553.808] (-552.396) (-551.766) * (-553.439) (-553.717) (-555.349) [-554.598] -- 0:00:09
847000 -- [-551.706] (-552.096) (-552.397) (-552.583) * (-553.968) (-554.845) [-551.651] (-554.273) -- 0:00:09
847500 -- (-554.341) (-551.965) (-554.589) [-554.430] * (-551.864) [-551.967] (-554.397) (-555.120) -- 0:00:09
848000 -- (-554.285) (-553.076) (-553.457) [-550.498] * [-554.775] (-552.011) (-552.084) (-552.671) -- 0:00:09
848500 -- (-551.057) (-552.143) [-552.583] (-551.391) * [-552.641] (-550.922) (-555.244) (-552.728) -- 0:00:09
849000 -- [-551.521] (-552.108) (-553.360) (-551.073) * (-551.275) (-552.378) [-551.557] (-555.509) -- 0:00:09
849500 -- (-552.503) [-553.953] (-551.286) (-552.665) * (-550.308) (-551.498) [-550.825] (-552.600) -- 0:00:09
850000 -- (-551.982) [-554.728] (-551.303) (-552.867) * (-552.354) (-552.589) [-550.814] (-553.860) -- 0:00:09
Average standard deviation of split frequencies: 0.007204
850500 -- (-555.541) (-554.753) (-552.114) [-550.665] * (-554.827) [-552.938] (-551.900) (-554.610) -- 0:00:09
851000 -- (-552.343) (-556.631) [-554.137] (-552.547) * (-557.171) (-551.235) [-550.878] (-553.715) -- 0:00:09
851500 -- (-553.411) (-552.111) [-553.526] (-551.129) * (-552.041) (-552.828) [-550.676] (-553.346) -- 0:00:09
852000 -- (-555.447) (-550.646) [-555.250] (-553.616) * (-552.858) (-553.088) [-551.124] (-553.705) -- 0:00:09
852500 -- (-551.539) [-552.772] (-554.628) (-552.071) * (-552.671) (-551.603) [-552.758] (-551.443) -- 0:00:09
853000 -- (-553.887) [-551.370] (-551.462) (-552.638) * (-550.629) [-550.075] (-552.371) (-552.638) -- 0:00:09
853500 -- (-554.135) (-553.826) (-551.934) [-552.106] * (-550.762) (-550.404) [-551.246] (-554.402) -- 0:00:09
854000 -- (-552.318) (-552.566) (-552.223) [-554.417] * (-551.236) (-550.402) (-552.245) [-553.324] -- 0:00:09
854500 -- [-553.392] (-552.706) (-553.306) (-551.940) * (-550.063) (-550.294) (-552.346) [-552.251] -- 0:00:09
855000 -- [-552.866] (-554.825) (-550.886) (-552.747) * [-555.651] (-550.504) (-554.174) (-553.619) -- 0:00:08
Average standard deviation of split frequencies: 0.007321
855500 -- (-556.493) (-552.069) [-552.235] (-552.061) * [-552.125] (-553.735) (-553.111) (-555.238) -- 0:00:08
856000 -- [-555.888] (-555.619) (-551.253) (-550.861) * [-551.194] (-555.491) (-555.478) (-552.438) -- 0:00:08
856500 -- (-554.362) (-552.126) (-550.857) [-553.323] * (-555.704) (-553.183) (-552.299) [-550.612] -- 0:00:08
857000 -- (-551.974) (-551.703) [-554.429] (-550.893) * (-553.158) (-552.833) (-551.839) [-550.676] -- 0:00:08
857500 -- (-559.462) (-555.456) (-551.400) [-552.271] * (-554.188) (-552.390) [-550.795] (-554.573) -- 0:00:08
858000 -- [-552.930] (-554.292) (-551.036) (-551.676) * (-553.485) [-553.488] (-553.567) (-552.337) -- 0:00:08
858500 -- (-555.342) (-552.853) [-552.908] (-552.598) * [-552.533] (-552.066) (-552.328) (-550.001) -- 0:00:08
859000 -- (-555.599) (-551.054) (-555.331) [-551.499] * (-555.837) (-551.387) (-553.812) [-550.220] -- 0:00:08
859500 -- (-553.996) [-552.594] (-553.025) (-553.626) * [-551.339] (-551.582) (-554.574) (-553.315) -- 0:00:08
860000 -- (-554.018) (-556.465) [-554.334] (-554.427) * (-550.221) (-552.298) (-552.439) [-551.962] -- 0:00:08
Average standard deviation of split frequencies: 0.006881
860500 -- (-552.843) [-554.716] (-554.774) (-552.983) * (-552.413) (-551.526) (-550.874) [-551.037] -- 0:00:08
861000 -- (-551.648) (-555.917) (-555.531) [-552.189] * (-550.934) (-557.540) [-550.910] (-553.028) -- 0:00:08
861500 -- [-551.464] (-551.984) (-550.434) (-552.087) * (-552.098) [-553.754] (-553.753) (-551.212) -- 0:00:08
862000 -- (-552.250) (-552.446) (-550.737) [-550.677] * (-552.006) (-551.188) [-552.536] (-553.367) -- 0:00:08
862500 -- (-553.289) (-554.522) (-556.208) [-550.610] * [-552.073] (-551.579) (-555.925) (-555.741) -- 0:00:08
863000 -- (-551.665) (-550.835) (-551.237) [-550.090] * (-552.736) (-550.848) [-551.732] (-556.176) -- 0:00:08
863500 -- (-552.216) (-551.872) [-550.850] (-550.243) * (-555.145) (-554.414) (-553.755) [-552.401] -- 0:00:08
864000 -- [-551.753] (-551.414) (-551.060) (-550.924) * (-551.953) (-557.104) (-553.911) [-552.504] -- 0:00:08
864500 -- (-552.168) [-552.377] (-550.730) (-551.190) * (-550.665) (-553.418) [-553.644] (-557.243) -- 0:00:08
865000 -- [-552.170] (-551.451) (-551.830) (-551.349) * (-551.196) (-550.822) [-550.692] (-551.008) -- 0:00:08
Average standard deviation of split frequencies: 0.007365
865500 -- (-551.445) (-550.596) [-551.232] (-552.327) * [-552.157] (-552.371) (-552.084) (-552.298) -- 0:00:08
866000 -- (-550.685) (-550.202) [-551.854] (-553.271) * (-554.700) (-552.269) (-552.639) [-553.569] -- 0:00:08
866500 -- (-553.617) (-550.297) [-551.691] (-554.311) * (-556.460) [-551.127] (-552.402) (-552.540) -- 0:00:08
867000 -- (-550.824) (-551.371) [-551.583] (-551.449) * [-551.741] (-553.899) (-551.523) (-554.829) -- 0:00:08
867500 -- (-553.334) (-552.353) (-552.543) [-553.767] * [-552.190] (-550.545) (-552.448) (-551.511) -- 0:00:08
868000 -- (-550.625) (-550.606) [-551.777] (-551.639) * (-552.734) [-550.146] (-550.642) (-553.814) -- 0:00:08
868500 -- (-554.737) [-550.489] (-550.942) (-553.836) * (-553.111) (-551.326) (-552.877) [-550.488] -- 0:00:08
869000 -- (-554.641) (-552.026) (-550.293) [-550.709] * (-554.574) (-551.431) [-550.910] (-552.797) -- 0:00:08
869500 -- [-551.677] (-551.666) (-550.932) (-550.443) * (-552.459) (-552.850) [-552.331] (-550.970) -- 0:00:08
870000 -- [-554.077] (-553.909) (-551.620) (-550.529) * (-556.378) (-552.792) (-551.981) [-553.730] -- 0:00:08
Average standard deviation of split frequencies: 0.007389
870500 -- (-557.512) (-550.803) (-551.469) [-552.086] * (-555.147) [-551.605] (-551.486) (-552.232) -- 0:00:08
871000 -- (-551.142) (-551.344) (-552.299) [-551.736] * (-552.130) (-553.255) (-550.558) [-553.618] -- 0:00:07
871500 -- (-553.508) (-552.197) (-552.174) [-551.014] * (-551.828) (-551.826) (-551.563) [-551.511] -- 0:00:07
872000 -- (-553.240) (-551.896) (-551.366) [-552.990] * [-550.978] (-556.305) (-551.870) (-551.659) -- 0:00:07
872500 -- [-550.793] (-550.390) (-552.508) (-552.072) * (-551.739) (-552.677) (-550.130) [-551.511] -- 0:00:07
873000 -- (-552.621) (-550.601) (-551.318) [-552.485] * [-550.202] (-550.688) (-550.443) (-552.169) -- 0:00:07
873500 -- [-551.444] (-552.010) (-552.077) (-554.988) * (-551.670) (-551.654) [-550.964] (-553.965) -- 0:00:07
874000 -- (-551.649) (-550.552) [-552.873] (-552.403) * (-553.203) (-554.503) (-553.569) [-553.566] -- 0:00:07
874500 -- (-550.745) [-551.749] (-553.003) (-552.172) * (-550.781) [-551.219] (-557.335) (-553.461) -- 0:00:07
875000 -- [-551.319] (-553.420) (-555.627) (-556.107) * [-550.801] (-550.597) (-552.153) (-555.618) -- 0:00:07
Average standard deviation of split frequencies: 0.006794
875500 -- [-550.501] (-553.507) (-552.563) (-551.304) * [-554.271] (-551.520) (-552.682) (-552.090) -- 0:00:07
876000 -- [-550.717] (-554.337) (-552.382) (-553.362) * (-550.962) (-551.130) [-550.262] (-550.283) -- 0:00:07
876500 -- (-551.268) (-551.753) [-552.564] (-553.874) * (-552.354) (-552.758) (-554.866) [-551.604] -- 0:00:07
877000 -- (-553.259) (-555.240) [-550.941] (-551.979) * (-552.117) (-553.241) (-551.881) [-551.380] -- 0:00:07
877500 -- (-551.235) (-553.681) [-553.159] (-550.919) * (-553.949) (-552.317) (-556.301) [-552.771] -- 0:00:07
878000 -- (-554.554) (-553.493) [-551.987] (-550.806) * [-551.011] (-554.028) (-550.562) (-550.845) -- 0:00:07
878500 -- (-551.174) (-551.960) (-553.446) [-550.234] * [-552.636] (-553.127) (-551.473) (-551.193) -- 0:00:07
879000 -- (-551.116) (-559.136) (-552.209) [-552.603] * (-553.913) (-552.853) (-557.070) [-550.782] -- 0:00:07
879500 -- (-551.690) (-551.659) [-553.494] (-550.727) * (-554.363) (-552.801) (-550.769) [-550.664] -- 0:00:07
880000 -- (-557.180) (-551.967) [-551.998] (-555.666) * (-555.173) (-554.437) (-550.712) [-553.388] -- 0:00:07
Average standard deviation of split frequencies: 0.006758
880500 -- (-550.830) (-552.573) (-558.546) [-550.993] * (-551.404) (-551.591) (-557.069) [-552.515] -- 0:00:07
881000 -- (-551.318) (-551.534) [-552.518] (-552.376) * (-552.453) (-555.677) (-550.561) [-550.242] -- 0:00:07
881500 -- (-552.434) (-550.352) [-555.244] (-551.380) * (-553.418) (-551.060) [-550.674] (-551.242) -- 0:00:07
882000 -- (-550.871) [-551.652] (-552.218) (-551.099) * (-552.666) (-550.374) [-550.720] (-551.862) -- 0:00:07
882500 -- (-552.728) [-556.865] (-559.452) (-554.119) * (-554.807) (-550.446) (-551.678) [-551.292] -- 0:00:07
883000 -- [-553.343] (-550.076) (-555.709) (-553.473) * (-551.050) [-550.674] (-550.719) (-553.739) -- 0:00:07
883500 -- (-551.501) (-553.042) (-554.433) [-550.895] * (-557.064) [-550.920] (-552.004) (-550.910) -- 0:00:07
884000 -- (-553.522) (-553.102) [-552.483] (-554.948) * (-557.937) [-551.673] (-554.847) (-550.854) -- 0:00:07
884500 -- [-550.274] (-551.799) (-551.523) (-553.594) * (-552.580) (-551.610) (-555.483) [-550.274] -- 0:00:07
885000 -- (-552.682) (-554.726) (-553.056) [-554.042] * (-551.472) (-552.503) (-553.649) [-552.138] -- 0:00:07
Average standard deviation of split frequencies: 0.007511
885500 -- (-552.315) (-551.037) [-550.812] (-554.569) * [-551.288] (-551.758) (-554.454) (-555.432) -- 0:00:07
886000 -- (-558.866) (-552.961) [-552.769] (-551.456) * (-551.454) [-551.336] (-551.546) (-551.937) -- 0:00:07
886500 -- (-550.654) (-552.905) (-551.894) [-552.837] * (-551.671) [-555.470] (-555.269) (-552.779) -- 0:00:07
887000 -- [-550.691] (-552.785) (-553.096) (-559.431) * (-551.601) (-552.627) (-553.335) [-559.397] -- 0:00:07
887500 -- (-553.141) [-550.808] (-552.125) (-555.168) * (-553.769) [-552.444] (-554.004) (-556.109) -- 0:00:06
888000 -- [-552.936] (-551.982) (-550.825) (-551.190) * [-553.732] (-553.653) (-552.430) (-552.277) -- 0:00:06
888500 -- (-550.469) [-550.667] (-551.658) (-557.353) * [-551.465] (-554.348) (-550.751) (-550.331) -- 0:00:06
889000 -- (-551.895) (-554.655) (-552.447) [-555.927] * [-551.181] (-553.314) (-551.938) (-552.590) -- 0:00:06
889500 -- (-552.122) (-553.105) [-551.332] (-550.778) * (-551.819) (-550.728) (-552.548) [-552.319] -- 0:00:06
890000 -- (-554.604) (-550.750) (-552.521) [-552.987] * (-552.649) [-554.097] (-552.879) (-553.767) -- 0:00:06
Average standard deviation of split frequencies: 0.007628
890500 -- (-550.526) [-556.321] (-552.525) (-552.444) * [-550.683] (-551.714) (-552.426) (-552.450) -- 0:00:06
891000 -- (-553.472) [-552.619] (-550.998) (-558.825) * (-552.262) (-551.400) (-552.781) [-554.032] -- 0:00:06
891500 -- (-550.288) (-555.391) (-550.277) [-555.381] * (-552.024) (-556.068) [-550.385] (-552.520) -- 0:00:06
892000 -- (-550.723) [-551.044] (-553.645) (-556.128) * (-551.882) (-551.378) (-550.613) [-552.164] -- 0:00:06
892500 -- (-553.390) [-550.609] (-553.651) (-556.225) * [-554.436] (-550.578) (-551.226) (-555.365) -- 0:00:06
893000 -- (-553.115) [-551.002] (-551.059) (-555.970) * (-555.652) (-551.476) [-550.182] (-551.931) -- 0:00:06
893500 -- [-553.970] (-552.152) (-550.830) (-554.334) * (-552.660) (-552.365) (-550.239) [-551.647] -- 0:00:06
894000 -- (-554.724) (-551.485) [-550.720] (-556.308) * (-551.248) (-554.624) (-552.916) [-551.564] -- 0:00:06
894500 -- [-552.875] (-552.870) (-555.567) (-552.620) * (-554.108) [-553.147] (-551.265) (-552.290) -- 0:00:06
895000 -- [-552.037] (-556.670) (-551.134) (-555.353) * (-551.902) (-552.610) (-553.107) [-552.049] -- 0:00:06
Average standard deviation of split frequencies: 0.007168
895500 -- [-552.004] (-552.874) (-555.681) (-557.276) * [-551.400] (-552.359) (-550.801) (-553.433) -- 0:00:06
896000 -- [-551.407] (-551.847) (-553.884) (-555.630) * (-552.376) (-553.186) [-552.699] (-555.366) -- 0:00:06
896500 -- [-551.858] (-551.444) (-555.171) (-554.053) * (-554.251) [-552.293] (-551.023) (-555.228) -- 0:00:06
897000 -- (-555.888) (-550.174) (-551.854) [-551.446] * (-556.395) [-551.335] (-556.024) (-550.832) -- 0:00:06
897500 -- (-551.314) (-550.211) [-553.184] (-550.184) * [-552.132] (-551.197) (-553.347) (-552.546) -- 0:00:06
898000 -- (-556.416) [-550.205] (-554.691) (-550.205) * [-551.569] (-553.516) (-553.807) (-552.817) -- 0:00:06
898500 -- (-552.598) (-550.958) (-551.881) [-552.332] * (-551.096) [-552.977] (-553.293) (-555.649) -- 0:00:06
899000 -- [-552.276] (-551.254) (-554.224) (-551.845) * (-550.678) (-551.826) [-552.360] (-551.334) -- 0:00:06
899500 -- [-550.955] (-551.514) (-552.581) (-551.284) * (-552.698) [-550.966] (-552.369) (-550.805) -- 0:00:06
900000 -- [-552.722] (-550.092) (-551.234) (-551.776) * [-550.737] (-553.902) (-559.584) (-556.618) -- 0:00:06
Average standard deviation of split frequencies: 0.007229
900500 -- (-552.035) (-550.959) [-551.519] (-551.960) * (-550.415) (-551.553) [-551.567] (-551.083) -- 0:00:06
901000 -- (-553.122) [-552.296] (-553.419) (-554.527) * (-550.383) (-556.048) [-552.224] (-550.383) -- 0:00:06
901500 -- [-555.136] (-550.803) (-550.946) (-555.121) * (-550.472) (-554.184) (-549.913) [-550.856] -- 0:00:06
902000 -- (-556.191) (-553.610) (-555.104) [-550.123] * [-550.611] (-551.376) (-551.209) (-552.137) -- 0:00:06
902500 -- (-553.914) (-553.219) (-550.122) [-553.646] * (-555.405) [-551.277] (-552.373) (-553.835) -- 0:00:06
903000 -- (-550.858) [-553.361] (-551.235) (-551.667) * [-553.135] (-551.099) (-550.719) (-550.395) -- 0:00:06
903500 -- [-550.312] (-551.277) (-551.887) (-553.426) * (-550.869) [-551.004] (-555.465) (-550.145) -- 0:00:05
904000 -- (-552.447) (-553.024) [-551.620] (-553.476) * (-551.220) (-554.035) (-557.402) [-550.490] -- 0:00:05
904500 -- [-549.992] (-551.050) (-554.559) (-551.889) * [-550.740] (-551.965) (-554.423) (-550.498) -- 0:00:05
905000 -- [-554.324] (-551.685) (-550.878) (-550.142) * (-552.572) (-550.688) (-551.520) [-553.289] -- 0:00:05
Average standard deviation of split frequencies: 0.007349
905500 -- (-553.213) (-551.792) (-555.049) [-555.754] * [-551.259] (-552.249) (-551.424) (-550.583) -- 0:00:05
906000 -- (-552.334) (-551.546) (-551.489) [-552.053] * (-552.523) (-552.673) (-551.657) [-553.914] -- 0:00:05
906500 -- [-550.762] (-552.207) (-552.921) (-552.335) * [-550.890] (-553.135) (-555.722) (-551.404) -- 0:00:05
907000 -- [-552.497] (-553.185) (-555.754) (-552.762) * (-556.765) [-554.353] (-552.084) (-550.665) -- 0:00:05
907500 -- (-553.839) (-551.404) [-551.605] (-552.773) * (-553.982) (-551.681) (-551.623) [-550.591] -- 0:00:05
908000 -- [-555.293] (-553.032) (-555.423) (-552.407) * (-553.338) (-553.907) [-551.675] (-550.095) -- 0:00:05
908500 -- [-550.823] (-552.492) (-557.963) (-551.392) * (-554.857) (-551.146) (-551.430) [-550.222] -- 0:00:05
909000 -- [-551.481] (-554.179) (-555.542) (-553.232) * [-553.743] (-554.840) (-552.674) (-550.492) -- 0:00:05
909500 -- (-551.894) (-556.589) (-552.377) [-551.293] * [-551.369] (-554.509) (-554.588) (-550.569) -- 0:00:05
910000 -- (-552.283) (-552.591) [-552.560] (-552.010) * [-551.590] (-552.085) (-553.046) (-550.602) -- 0:00:05
Average standard deviation of split frequencies: 0.007826
910500 -- (-551.090) [-553.077] (-557.634) (-552.672) * (-553.259) (-553.180) [-551.750] (-549.999) -- 0:00:05
911000 -- (-551.218) (-552.381) (-553.994) [-553.826] * (-554.403) (-552.334) (-552.638) [-551.984] -- 0:00:05
911500 -- (-551.672) (-550.852) (-553.420) [-551.146] * (-553.766) (-552.295) [-552.522] (-552.678) -- 0:00:05
912000 -- (-553.050) [-551.628] (-556.572) (-552.008) * (-554.027) (-551.636) (-551.783) [-553.736] -- 0:00:05
912500 -- (-551.937) (-551.045) [-557.508] (-550.842) * (-552.536) (-552.179) [-552.092] (-552.172) -- 0:00:05
913000 -- (-552.600) [-550.787] (-553.721) (-552.010) * [-550.789] (-554.792) (-551.778) (-550.989) -- 0:00:05
913500 -- (-553.203) [-549.812] (-552.616) (-553.061) * (-551.362) (-550.772) [-551.458] (-552.871) -- 0:00:05
914000 -- [-551.008] (-555.667) (-554.613) (-554.028) * (-552.269) [-551.484] (-551.410) (-552.508) -- 0:00:05
914500 -- [-553.092] (-550.946) (-551.573) (-552.682) * (-550.711) (-551.286) (-554.566) [-552.957] -- 0:00:05
915000 -- (-552.156) [-549.898] (-551.576) (-552.876) * [-553.005] (-551.804) (-552.257) (-556.400) -- 0:00:05
Average standard deviation of split frequencies: 0.007810
915500 -- (-552.309) [-550.398] (-551.376) (-552.543) * (-553.011) (-552.004) [-551.968] (-553.167) -- 0:00:05
916000 -- [-552.078] (-552.160) (-550.590) (-552.729) * (-551.107) (-554.000) [-550.874] (-554.122) -- 0:00:05
916500 -- (-552.264) [-552.840] (-551.684) (-550.665) * (-550.866) (-551.705) (-555.883) [-551.909] -- 0:00:05
917000 -- (-552.053) [-553.124] (-550.292) (-553.779) * (-552.915) [-553.091] (-557.577) (-553.036) -- 0:00:05
917500 -- [-553.431] (-551.278) (-550.364) (-550.870) * [-552.169] (-551.362) (-551.768) (-554.104) -- 0:00:05
918000 -- (-552.380) (-551.103) [-550.047] (-551.334) * [-552.191] (-554.466) (-552.819) (-553.935) -- 0:00:05
918500 -- (-551.996) [-550.786] (-550.243) (-550.913) * (-552.777) [-551.863] (-550.732) (-551.109) -- 0:00:05
919000 -- (-551.038) (-553.001) (-552.789) [-550.688] * (-552.171) [-550.813] (-557.281) (-551.441) -- 0:00:05
919500 -- [-550.528] (-551.902) (-553.246) (-551.621) * (-552.178) (-552.218) [-556.995] (-552.031) -- 0:00:04
920000 -- (-551.716) (-550.747) [-552.588] (-551.963) * [-551.521] (-553.538) (-556.777) (-551.841) -- 0:00:04
Average standard deviation of split frequencies: 0.007741
920500 -- [-557.299] (-554.238) (-551.562) (-552.199) * (-551.826) (-554.289) (-553.549) [-553.307] -- 0:00:04
921000 -- [-550.717] (-552.234) (-553.511) (-552.068) * (-551.164) (-554.427) [-553.241] (-553.676) -- 0:00:04
921500 -- (-554.108) (-551.586) (-551.908) [-552.431] * (-551.740) [-551.303] (-551.417) (-551.231) -- 0:00:04
922000 -- (-551.441) [-552.556] (-552.361) (-552.257) * (-552.417) (-553.036) (-550.282) [-552.113] -- 0:00:04
922500 -- (-557.878) (-551.755) [-552.794] (-552.027) * [-552.588] (-552.345) (-552.572) (-550.836) -- 0:00:04
923000 -- (-554.153) (-551.133) [-554.107] (-553.357) * (-555.308) [-551.205] (-550.566) (-550.573) -- 0:00:04
923500 -- [-551.361] (-553.824) (-551.023) (-551.898) * (-554.786) (-553.782) [-551.247] (-550.579) -- 0:00:04
924000 -- [-552.434] (-551.656) (-550.145) (-553.356) * (-550.809) (-558.661) [-551.097] (-553.022) -- 0:00:04
924500 -- (-554.246) (-551.801) (-557.162) [-552.000] * (-553.892) (-554.015) (-553.513) [-550.679] -- 0:00:04
925000 -- (-555.225) (-551.072) (-553.813) [-550.449] * (-554.648) (-550.915) (-553.045) [-553.484] -- 0:00:04
Average standard deviation of split frequencies: 0.007486
925500 -- (-557.295) (-552.857) [-552.066] (-551.377) * (-550.219) (-554.232) (-553.676) [-552.231] -- 0:00:04
926000 -- (-551.760) (-550.407) (-553.164) [-552.069] * (-550.036) [-552.307] (-549.954) (-553.216) -- 0:00:04
926500 -- (-550.916) (-553.588) [-552.317] (-552.841) * (-552.952) (-553.153) [-551.029] (-553.329) -- 0:00:04
927000 -- [-550.868] (-551.715) (-553.882) (-555.129) * (-554.385) (-554.906) [-553.159] (-551.958) -- 0:00:04
927500 -- [-552.861] (-551.185) (-552.539) (-555.691) * (-556.672) [-553.103] (-553.591) (-554.360) -- 0:00:04
928000 -- (-552.801) [-550.570] (-554.577) (-550.999) * (-553.434) [-553.044] (-552.714) (-557.392) -- 0:00:04
928500 -- [-551.487] (-554.783) (-551.212) (-552.723) * (-552.430) (-552.321) (-551.080) [-552.219] -- 0:00:04
929000 -- [-550.983] (-552.051) (-551.628) (-551.655) * [-553.395] (-551.029) (-553.839) (-554.416) -- 0:00:04
929500 -- [-551.469] (-553.563) (-551.137) (-551.808) * (-551.582) [-550.304] (-554.096) (-551.835) -- 0:00:04
930000 -- [-551.964] (-553.285) (-551.658) (-552.567) * (-556.328) (-552.768) [-552.813] (-550.880) -- 0:00:04
Average standard deviation of split frequencies: 0.007389
930500 -- (-553.876) [-551.958] (-556.721) (-551.355) * (-552.304) [-550.836] (-550.515) (-551.088) -- 0:00:04
931000 -- [-554.219] (-551.091) (-550.111) (-550.355) * [-551.988] (-551.122) (-554.922) (-552.339) -- 0:00:04
931500 -- (-553.496) (-550.825) [-550.154] (-550.755) * (-552.946) (-552.398) [-551.432] (-554.390) -- 0:00:04
932000 -- (-552.233) (-553.442) (-552.046) [-552.619] * (-552.975) (-552.683) [-551.578] (-552.287) -- 0:00:04
932500 -- (-554.032) (-553.951) (-552.833) [-554.979] * [-552.580] (-554.361) (-554.183) (-551.753) -- 0:00:04
933000 -- (-552.946) [-550.569] (-551.091) (-551.005) * (-551.990) [-552.267] (-554.263) (-551.479) -- 0:00:04
933500 -- [-550.600] (-550.768) (-551.675) (-552.208) * (-551.512) (-551.544) (-553.613) [-551.707] -- 0:00:04
934000 -- (-552.279) (-552.654) (-551.623) [-552.094] * [-551.476] (-552.041) (-554.064) (-551.703) -- 0:00:04
934500 -- (-554.216) [-553.883] (-551.289) (-553.834) * (-552.637) (-551.880) [-555.893] (-550.885) -- 0:00:04
935000 -- (-554.132) [-552.383] (-554.578) (-551.169) * (-555.122) [-551.571] (-559.550) (-551.937) -- 0:00:04
Average standard deviation of split frequencies: 0.007762
935500 -- (-552.256) (-554.311) [-553.287] (-552.002) * [-551.466] (-551.705) (-554.602) (-554.218) -- 0:00:03
936000 -- (-552.193) (-552.343) (-550.432) [-550.910] * [-552.043] (-551.870) (-553.547) (-552.953) -- 0:00:03
936500 -- (-552.817) (-552.543) [-551.329] (-552.375) * (-551.343) [-553.641] (-554.223) (-550.172) -- 0:00:03
937000 -- (-554.636) [-555.405] (-553.162) (-551.310) * (-554.999) (-551.803) [-557.789] (-550.477) -- 0:00:03
937500 -- (-551.511) (-553.472) [-553.192] (-553.452) * (-559.970) [-552.390] (-553.186) (-550.808) -- 0:00:03
938000 -- (-551.878) (-551.293) [-552.642] (-552.025) * (-557.625) [-552.554] (-556.220) (-555.688) -- 0:00:03
938500 -- [-551.232] (-556.796) (-552.684) (-553.929) * [-551.365] (-553.399) (-551.387) (-553.853) -- 0:00:03
939000 -- (-553.710) (-551.319) [-551.804] (-555.710) * (-554.088) [-550.842] (-555.461) (-552.662) -- 0:00:03
939500 -- [-551.134] (-551.285) (-554.357) (-556.906) * (-554.340) (-550.360) (-557.230) [-554.641] -- 0:00:03
940000 -- (-551.517) (-552.704) [-553.061] (-554.467) * (-550.805) [-550.607] (-556.867) (-552.687) -- 0:00:03
Average standard deviation of split frequencies: 0.007900
940500 -- (-552.216) (-550.758) (-551.246) [-551.796] * (-550.757) [-552.942] (-553.664) (-554.492) -- 0:00:03
941000 -- (-552.807) [-550.445] (-551.240) (-554.024) * (-552.180) [-551.858] (-551.500) (-555.532) -- 0:00:03
941500 -- (-551.924) [-552.762] (-553.551) (-552.137) * (-551.673) (-551.539) (-552.678) [-551.838] -- 0:00:03
942000 -- [-550.310] (-551.575) (-551.520) (-553.657) * (-551.403) (-551.698) [-551.676] (-554.851) -- 0:00:03
942500 -- [-551.672] (-552.871) (-550.370) (-555.897) * (-552.376) (-551.289) (-552.931) [-551.539] -- 0:00:03
943000 -- (-552.996) (-552.058) [-550.702] (-550.812) * (-553.906) [-553.450] (-549.961) (-552.284) -- 0:00:03
943500 -- (-551.794) (-554.046) [-551.524] (-553.688) * [-550.943] (-551.557) (-552.270) (-552.489) -- 0:00:03
944000 -- [-551.552] (-552.238) (-550.572) (-551.330) * [-553.278] (-551.857) (-550.499) (-551.764) -- 0:00:03
944500 -- (-552.631) [-551.073] (-551.444) (-551.336) * (-554.230) [-551.591] (-551.486) (-553.181) -- 0:00:03
945000 -- (-550.570) (-551.489) (-552.666) [-550.428] * (-556.046) (-552.752) [-550.700] (-551.180) -- 0:00:03
Average standard deviation of split frequencies: 0.007599
945500 -- (-552.638) (-555.211) [-551.612] (-551.434) * (-551.369) (-552.655) [-550.849] (-551.218) -- 0:00:03
946000 -- (-552.983) (-552.802) (-553.968) [-551.604] * (-553.966) [-551.990] (-552.259) (-554.190) -- 0:00:03
946500 -- [-551.148] (-552.237) (-553.345) (-551.635) * (-552.407) (-552.828) (-553.092) [-552.392] -- 0:00:03
947000 -- (-550.891) [-552.557] (-555.911) (-551.588) * (-551.285) (-554.173) [-552.675] (-555.935) -- 0:00:03
947500 -- [-550.705] (-558.182) (-551.033) (-552.102) * (-553.325) [-553.619] (-552.263) (-553.317) -- 0:00:03
948000 -- [-554.201] (-557.657) (-552.448) (-553.326) * (-551.929) (-552.663) (-551.555) [-552.950] -- 0:00:03
948500 -- (-557.036) (-550.896) (-550.812) [-552.126] * (-554.125) [-552.189] (-553.386) (-553.099) -- 0:00:03
949000 -- (-556.045) (-550.931) [-551.108] (-555.363) * [-550.688] (-554.171) (-552.622) (-551.973) -- 0:00:03
949500 -- (-551.833) (-551.482) [-556.294] (-558.682) * [-552.071] (-555.005) (-553.265) (-551.120) -- 0:00:03
950000 -- (-555.291) (-553.537) (-553.444) [-552.610] * (-552.783) (-553.718) [-551.182] (-551.221) -- 0:00:03
Average standard deviation of split frequencies: 0.007531
950500 -- [-552.636] (-553.024) (-554.599) (-553.771) * (-553.764) (-552.560) (-552.342) [-552.896] -- 0:00:03
951000 -- (-550.842) (-555.059) (-551.047) [-552.506] * (-555.955) [-556.379] (-551.096) (-553.453) -- 0:00:03
951500 -- (-554.672) (-552.160) (-551.612) [-552.785] * (-553.118) [-555.290] (-555.855) (-550.889) -- 0:00:03
952000 -- (-552.683) (-553.315) [-550.850] (-554.364) * (-552.582) (-552.909) (-552.806) [-552.746] -- 0:00:02
952500 -- (-557.505) (-552.148) (-550.977) [-553.587] * (-556.719) [-552.760] (-552.037) (-551.934) -- 0:00:02
953000 -- (-554.788) (-553.307) [-550.356] (-553.304) * (-557.087) (-551.559) [-555.756] (-554.289) -- 0:00:02
953500 -- (-553.899) (-554.417) [-550.341] (-551.931) * [-556.386] (-551.464) (-552.933) (-552.025) -- 0:00:02
954000 -- (-553.378) (-553.436) [-553.311] (-557.652) * (-552.234) (-552.967) (-551.079) [-552.576] -- 0:00:02
954500 -- (-555.664) (-552.425) [-556.398] (-551.456) * [-554.286] (-551.842) (-552.418) (-554.745) -- 0:00:02
955000 -- (-554.828) (-551.759) [-551.974] (-551.194) * [-555.597] (-551.830) (-554.830) (-554.719) -- 0:00:02
Average standard deviation of split frequencies: 0.007242
955500 -- (-556.477) (-552.773) (-550.991) [-551.347] * (-554.138) (-551.770) (-553.433) [-553.077] -- 0:00:02
956000 -- (-551.519) [-552.827] (-553.518) (-555.958) * (-550.591) (-552.870) [-552.051] (-554.228) -- 0:00:02
956500 -- (-550.654) (-554.872) [-551.853] (-552.127) * (-551.239) (-552.139) [-552.540] (-550.775) -- 0:00:02
957000 -- [-551.545] (-553.839) (-552.222) (-551.863) * (-552.275) [-554.888] (-554.231) (-550.882) -- 0:00:02
957500 -- [-554.257] (-553.012) (-555.198) (-550.739) * (-551.505) (-557.543) (-554.499) [-553.349] -- 0:00:02
958000 -- [-555.336] (-552.529) (-550.342) (-550.648) * (-551.339) [-553.315] (-550.884) (-553.293) -- 0:00:02
958500 -- [-550.269] (-551.487) (-550.297) (-550.778) * (-551.635) [-552.513] (-552.148) (-550.649) -- 0:00:02
959000 -- [-551.632] (-552.566) (-553.356) (-551.322) * (-554.094) (-552.853) [-551.051] (-550.984) -- 0:00:02
959500 -- [-551.611] (-551.516) (-553.483) (-551.168) * (-553.948) (-553.642) (-554.415) [-551.515] -- 0:00:02
960000 -- (-551.416) [-550.929] (-556.714) (-550.453) * (-554.241) (-550.933) (-555.211) [-551.546] -- 0:00:02
Average standard deviation of split frequencies: 0.007299
960500 -- (-552.378) (-552.856) (-556.217) [-553.605] * (-552.902) (-551.466) (-553.589) [-550.923] -- 0:00:02
961000 -- [-550.861] (-551.986) (-554.253) (-550.894) * (-552.298) [-552.691] (-551.679) (-552.782) -- 0:00:02
961500 -- (-551.231) (-554.009) (-554.797) [-550.862] * [-551.193] (-551.892) (-550.363) (-555.411) -- 0:00:02
962000 -- (-551.813) (-554.582) (-550.404) [-552.865] * (-553.831) [-550.308] (-550.638) (-554.201) -- 0:00:02
962500 -- (-550.983) (-552.402) (-549.997) [-552.306] * [-552.948] (-553.177) (-550.493) (-552.133) -- 0:00:02
963000 -- (-554.800) [-550.972] (-554.743) (-553.985) * [-552.664] (-552.286) (-550.903) (-553.204) -- 0:00:02
963500 -- (-556.636) [-550.965] (-556.478) (-556.519) * (-560.312) (-557.088) [-550.197] (-552.162) -- 0:00:02
964000 -- (-552.688) (-550.796) [-552.937] (-557.466) * (-553.801) (-552.088) (-552.638) [-553.082] -- 0:00:02
964500 -- (-552.584) (-553.340) (-551.868) [-552.361] * (-555.886) (-551.277) (-550.963) [-551.067] -- 0:00:02
965000 -- [-552.518] (-552.703) (-551.819) (-552.456) * (-550.807) (-551.368) (-553.992) [-550.441] -- 0:00:02
Average standard deviation of split frequencies: 0.007564
965500 -- (-551.479) (-554.229) (-552.484) [-550.604] * (-552.341) [-552.860] (-553.007) (-550.470) -- 0:00:02
966000 -- (-554.209) (-553.287) (-551.577) [-552.733] * (-551.557) (-553.648) (-554.267) [-550.015] -- 0:00:02
966500 -- (-551.629) (-550.595) (-552.752) [-550.145] * [-551.751] (-551.489) (-553.873) (-551.210) -- 0:00:02
967000 -- (-552.258) (-556.414) (-550.980) [-553.388] * (-553.603) (-553.893) [-553.922] (-550.256) -- 0:00:02
967500 -- [-551.928] (-553.446) (-552.594) (-552.273) * (-552.972) (-556.315) [-551.906] (-550.735) -- 0:00:02
968000 -- (-556.109) [-551.378] (-550.957) (-551.871) * (-554.501) (-557.055) (-551.185) [-552.286] -- 0:00:01
968500 -- (-553.650) (-553.917) (-553.112) [-550.352] * (-553.058) (-556.999) [-554.714] (-554.304) -- 0:00:01
969000 -- (-550.448) (-553.073) [-557.519] (-555.966) * (-550.268) (-553.802) (-553.310) [-551.851] -- 0:00:01
969500 -- (-554.448) (-553.102) [-552.208] (-556.068) * (-552.315) [-553.153] (-552.266) (-551.568) -- 0:00:01
970000 -- [-553.672] (-551.754) (-550.509) (-551.056) * [-550.735] (-553.049) (-555.549) (-556.805) -- 0:00:01
Average standard deviation of split frequencies: 0.007558
970500 -- (-554.925) [-550.001] (-554.267) (-552.099) * [-552.045] (-550.726) (-553.143) (-554.290) -- 0:00:01
971000 -- (-553.444) (-552.193) [-550.958] (-550.447) * [-554.098] (-553.686) (-551.942) (-552.051) -- 0:00:01
971500 -- (-553.711) (-552.114) [-551.791] (-552.165) * (-550.689) (-553.028) [-552.678] (-551.187) -- 0:00:01
972000 -- [-555.196] (-552.591) (-553.999) (-553.694) * (-552.455) (-553.090) (-555.374) [-554.382] -- 0:00:01
972500 -- [-553.131] (-552.892) (-550.242) (-553.666) * [-556.203] (-553.620) (-550.242) (-554.099) -- 0:00:01
973000 -- [-552.585] (-554.474) (-552.687) (-552.132) * (-551.253) [-551.508] (-553.524) (-553.298) -- 0:00:01
973500 -- (-552.484) (-556.804) (-554.810) [-552.872] * (-551.786) (-554.728) [-554.581] (-550.697) -- 0:00:01
974000 -- (-553.669) (-551.399) [-555.255] (-552.737) * [-553.018] (-550.925) (-554.425) (-553.022) -- 0:00:01
974500 -- [-550.515] (-550.272) (-555.983) (-550.817) * (-552.391) (-551.754) [-550.505] (-552.641) -- 0:00:01
975000 -- (-550.464) (-553.543) [-553.745] (-550.784) * (-551.664) (-550.858) [-554.330] (-556.773) -- 0:00:01
Average standard deviation of split frequencies: 0.007758
975500 -- (-551.355) (-552.157) [-554.693] (-550.756) * (-552.658) [-550.138] (-554.631) (-550.903) -- 0:00:01
976000 -- [-551.899] (-552.957) (-552.559) (-554.654) * (-552.809) (-551.194) [-551.046] (-552.067) -- 0:00:01
976500 -- (-552.152) [-549.950] (-555.325) (-556.423) * (-553.133) (-551.381) [-550.171] (-553.531) -- 0:00:01
977000 -- (-551.713) (-551.730) [-554.562] (-552.754) * (-551.202) (-555.131) (-550.902) [-555.309] -- 0:00:01
977500 -- [-554.314] (-552.163) (-553.128) (-553.928) * (-550.753) (-557.607) [-551.810] (-554.640) -- 0:00:01
978000 -- (-552.233) [-551.784] (-550.938) (-554.021) * (-552.483) [-554.342] (-555.145) (-552.382) -- 0:00:01
978500 -- (-554.572) [-550.306] (-552.136) (-553.814) * (-551.832) (-551.716) [-552.626] (-551.763) -- 0:00:01
979000 -- (-553.402) (-552.112) (-556.010) [-551.434] * (-554.725) (-555.262) [-552.125] (-559.575) -- 0:00:01
979500 -- (-552.072) (-551.077) (-556.945) [-551.779] * (-551.571) [-552.789] (-551.057) (-557.183) -- 0:00:01
980000 -- [-551.459] (-551.688) (-553.389) (-555.177) * (-555.068) [-552.548] (-553.592) (-553.105) -- 0:00:01
Average standard deviation of split frequencies: 0.007511
980500 -- [-552.479] (-552.235) (-554.182) (-554.342) * (-551.302) (-551.736) (-551.834) [-552.018] -- 0:00:01
981000 -- (-552.375) (-552.559) (-552.452) [-553.644] * (-555.499) [-552.548] (-551.255) (-551.421) -- 0:00:01
981500 -- (-550.634) [-550.611] (-552.167) (-553.063) * (-551.618) [-550.770] (-552.648) (-555.782) -- 0:00:01
982000 -- (-551.514) (-551.974) [-551.722] (-552.795) * (-551.874) (-550.825) [-552.213] (-553.706) -- 0:00:01
982500 -- (-552.024) [-552.107] (-553.792) (-551.180) * (-550.687) (-550.400) (-552.946) [-550.915] -- 0:00:01
983000 -- [-552.650] (-550.183) (-553.155) (-553.649) * (-550.790) (-553.437) (-551.938) [-551.193] -- 0:00:01
983500 -- (-551.276) (-550.096) [-551.688] (-552.967) * (-551.307) [-551.232] (-554.172) (-551.340) -- 0:00:01
984000 -- [-551.922] (-553.782) (-551.056) (-553.847) * (-551.057) (-555.449) [-552.793] (-552.183) -- 0:00:00
984500 -- (-553.323) (-553.478) [-552.349] (-554.221) * (-550.996) (-551.429) (-553.193) [-550.819] -- 0:00:00
985000 -- (-556.319) (-550.858) [-550.930] (-552.370) * (-552.002) [-552.075] (-552.409) (-552.330) -- 0:00:00
Average standard deviation of split frequencies: 0.006962
985500 -- (-551.823) (-551.602) [-553.410] (-554.095) * (-550.927) (-553.498) (-551.221) [-551.730] -- 0:00:00
986000 -- (-551.747) [-551.147] (-553.418) (-551.930) * (-553.151) [-551.973] (-550.588) (-550.612) -- 0:00:00
986500 -- [-553.442] (-554.905) (-551.428) (-550.602) * (-553.959) (-551.397) (-553.915) [-551.690] -- 0:00:00
987000 -- (-552.041) (-554.405) (-552.081) [-555.215] * (-552.100) [-552.266] (-550.886) (-551.278) -- 0:00:00
987500 -- (-553.616) [-551.101] (-554.235) (-551.599) * [-552.267] (-551.314) (-550.778) (-552.882) -- 0:00:00
988000 -- [-556.518] (-554.945) (-554.372) (-551.332) * (-552.152) (-553.378) (-553.385) [-552.279] -- 0:00:00
988500 -- (-551.629) (-557.478) (-555.449) [-553.524] * (-552.037) [-555.419] (-553.056) (-552.503) -- 0:00:00
989000 -- (-558.222) (-556.032) [-552.071] (-551.525) * (-552.202) (-553.138) (-553.946) [-551.290] -- 0:00:00
989500 -- (-561.252) [-555.373] (-552.723) (-551.258) * (-551.320) (-551.062) [-550.842] (-550.616) -- 0:00:00
990000 -- (-556.750) (-550.826) (-551.422) [-551.888] * (-551.320) [-550.133] (-551.272) (-550.741) -- 0:00:00
Average standard deviation of split frequencies: 0.007019
990500 -- (-550.874) (-554.098) (-554.335) [-551.456] * (-550.781) (-551.336) [-552.984] (-552.946) -- 0:00:00
991000 -- (-552.791) (-551.424) [-553.690] (-552.608) * (-551.327) [-551.654] (-551.804) (-552.178) -- 0:00:00
991500 -- (-551.408) (-552.457) (-550.949) [-557.380] * (-557.037) (-550.093) [-549.848] (-550.979) -- 0:00:00
992000 -- [-551.048] (-551.774) (-552.877) (-550.951) * (-554.539) (-553.399) (-551.250) [-554.451] -- 0:00:00
992500 -- [-551.279] (-551.592) (-551.725) (-552.220) * (-550.589) [-552.802] (-550.552) (-550.327) -- 0:00:00
993000 -- (-552.855) (-553.901) (-554.825) [-551.231] * (-555.109) (-553.557) (-550.963) [-550.239] -- 0:00:00
993500 -- (-554.442) (-551.062) [-552.547] (-554.282) * (-551.635) [-552.049] (-552.037) (-552.340) -- 0:00:00
994000 -- (-555.202) (-550.202) [-552.678] (-550.806) * (-552.134) [-552.561] (-554.703) (-550.661) -- 0:00:00
994500 -- [-551.136] (-550.419) (-552.204) (-551.051) * [-555.713] (-553.789) (-551.138) (-551.143) -- 0:00:00
995000 -- [-552.009] (-552.858) (-551.928) (-552.509) * [-551.567] (-553.630) (-551.941) (-553.246) -- 0:00:00
Average standard deviation of split frequencies: 0.006892
995500 -- (-551.750) (-551.460) (-550.868) [-551.595] * (-553.990) [-551.592] (-552.568) (-551.606) -- 0:00:00
996000 -- (-551.005) (-551.987) [-550.733] (-551.983) * (-551.122) [-552.698] (-551.260) (-554.357) -- 0:00:00
996500 -- (-552.344) (-550.006) (-551.650) [-553.235] * (-555.883) [-551.207] (-550.615) (-550.501) -- 0:00:00
997000 -- (-551.134) [-549.988] (-555.304) (-551.655) * (-551.726) (-554.778) [-554.048] (-552.933) -- 0:00:00
997500 -- (-551.859) [-552.427] (-551.246) (-552.895) * (-552.325) (-554.902) [-553.949] (-554.759) -- 0:00:00
998000 -- (-551.727) [-551.955] (-552.001) (-551.194) * [-553.232] (-551.176) (-551.380) (-551.728) -- 0:00:00
998500 -- (-551.622) [-551.453] (-554.708) (-552.455) * (-550.611) (-552.580) [-551.419] (-556.550) -- 0:00:00
999000 -- [-550.496] (-551.866) (-555.000) (-553.186) * (-551.283) (-551.150) (-552.016) [-551.095] -- 0:00:00
999500 -- (-552.338) [-552.601] (-551.266) (-550.820) * (-554.872) [-550.445] (-553.547) (-553.161) -- 0:00:00
1000000 -- (-552.431) [-555.226] (-555.335) (-552.328) * [-554.215] (-552.073) (-555.711) (-552.133) -- 0:00:00
Average standard deviation of split frequencies: 0.006772
Analysis completed in 1 mins 2 seconds
Analysis used 60.58 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -549.79
Likelihood of best state for "cold" chain of run 2 was -549.79
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
34.0 % ( 25 %) Dirichlet(Pi{all})
34.6 % ( 33 %) Slider(Pi{all})
79.1 % ( 53 %) Multiplier(Alpha{1,2})
77.7 % ( 53 %) Multiplier(Alpha{3})
25.3 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.3 % ( 96 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.3 % ( 26 %) Dirichlet(Pi{all})
34.6 % ( 34 %) Slider(Pi{all})
78.7 % ( 52 %) Multiplier(Alpha{1,2})
77.9 % ( 53 %) Multiplier(Alpha{3})
24.8 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 93 %) ExtSPR(Tau{all},V{all})
70.2 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 96 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.3 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166524 0.82 0.67
3 | 167054 166800 0.84
4 | 166582 166376 166664
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167140 0.82 0.67
3 | 166954 166494 0.84
4 | 166389 165905 167118
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -551.37
| 2 |
| |
| 2 12 |
| 2 1 1 1 21 2 |
| 12 21 2 21 21 22 1 |
| 2 21 2 2 221 1 |
|1 2 11 2 *2 1 1 1 2 2 212 2 |
|22 1 2 1 2 1 2 1 1 2 *12 *1 1 2 11 1 |
| 2 2 1 2 1 2 2 121 1 1112|
| 1 21 2 2 2 2 2 1|
| 1 1 1 1 2 |
| 1 2 * 1 1 |
| 1 2 21 |
| 22 2 1 1 |
| 1 1 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -553.07
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -551.53 -554.31
2 -551.50 -555.13
--------------------------------------
TOTAL -551.51 -554.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891099 0.085157 0.354771 1.461019 0.859373 1401.74 1433.31 1.001
r(A<->C){all} 0.152921 0.017405 0.000056 0.417120 0.118443 157.04 300.20 1.000
r(A<->G){all} 0.171165 0.020419 0.000083 0.454439 0.135067 235.37 272.74 1.004
r(A<->T){all} 0.168221 0.018735 0.000027 0.438747 0.131900 221.56 254.43 1.000
r(C<->G){all} 0.169653 0.018371 0.000064 0.425878 0.140459 192.48 216.55 1.007
r(C<->T){all} 0.173672 0.021382 0.000072 0.472730 0.134667 192.13 209.08 1.001
r(G<->T){all} 0.164369 0.019750 0.000082 0.442822 0.125588 123.42 199.08 1.002
pi(A){all} 0.168229 0.000325 0.132373 0.201489 0.167631 1311.35 1406.17 1.000
pi(C){all} 0.327690 0.000538 0.278631 0.369461 0.327444 1143.03 1264.62 1.000
pi(G){all} 0.326469 0.000519 0.281070 0.369079 0.326103 1328.99 1415.00 1.000
pi(T){all} 0.177611 0.000332 0.143029 0.212975 0.176994 1037.69 1228.21 1.000
alpha{1,2} 0.396958 0.199618 0.000232 1.356336 0.229981 1170.45 1335.73 1.000
alpha{3} 0.463562 0.245638 0.000175 1.490978 0.300774 1197.90 1211.78 1.000
pinvar{all} 0.996079 0.000022 0.987309 0.999994 0.997570 1233.56 1244.90 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .*.***
9 -- .***.*
10 -- ..****
11 -- .*...*
12 -- .**.**
13 -- .*..*.
14 -- .**...
15 -- ....**
16 -- ...**.
17 -- ..*.*.
18 -- ..**..
19 -- .*.*..
20 -- .****.
21 -- ...*.*
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.003769 0.151233 0.156562 2
8 460 0.153231 0.009422 0.146569 0.159893 2
9 443 0.147568 0.004240 0.144570 0.150566 2
10 440 0.146569 0.007537 0.141239 0.151899 2
11 439 0.146236 0.003298 0.143904 0.148568 2
12 434 0.144570 0.004711 0.141239 0.147901 2
13 432 0.143904 0.017901 0.131246 0.156562 2
14 431 0.143571 0.005182 0.139907 0.147235 2
15 427 0.142239 0.016488 0.130580 0.153897 2
16 420 0.139907 0.008480 0.133911 0.145903 2
17 418 0.139241 0.000000 0.139241 0.139241 2
18 416 0.138574 0.004711 0.135243 0.141905 2
19 413 0.137575 0.000471 0.137242 0.137908 2
20 412 0.137242 0.005653 0.133245 0.141239 2
21 408 0.135909 0.000942 0.135243 0.136576 2
22 289 0.096269 0.015546 0.085276 0.107262 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097615 0.009473 0.000026 0.291927 0.068225 1.001 2
length{all}[2] 0.101484 0.009896 0.000012 0.302033 0.072084 1.001 2
length{all}[3] 0.095603 0.008836 0.000087 0.289247 0.065954 1.001 2
length{all}[4] 0.096917 0.009191 0.000067 0.288469 0.069030 1.000 2
length{all}[5] 0.101045 0.010431 0.000066 0.299469 0.070063 1.000 2
length{all}[6] 0.096272 0.009572 0.000026 0.289714 0.065465 1.000 2
length{all}[7] 0.096336 0.008702 0.000149 0.279880 0.069988 1.002 2
length{all}[8] 0.096573 0.008584 0.000323 0.264048 0.075689 0.999 2
length{all}[9] 0.104524 0.010412 0.000164 0.306059 0.078505 0.998 2
length{all}[10] 0.096280 0.009212 0.000020 0.286012 0.066934 1.010 2
length{all}[11] 0.104225 0.009722 0.000234 0.282215 0.073075 1.003 2
length{all}[12] 0.099146 0.009719 0.000586 0.295973 0.067813 1.000 2
length{all}[13] 0.104820 0.009534 0.000202 0.298166 0.072324 0.998 2
length{all}[14] 0.093521 0.007529 0.000460 0.269506 0.067194 0.998 2
length{all}[15] 0.108902 0.011413 0.000211 0.319292 0.081625 0.998 2
length{all}[16] 0.105426 0.010644 0.000112 0.303431 0.075401 1.011 2
length{all}[17] 0.097864 0.008669 0.000088 0.276715 0.071147 1.001 2
length{all}[18] 0.098301 0.011808 0.000033 0.337241 0.060278 0.998 2
length{all}[19] 0.101619 0.008770 0.000100 0.283768 0.073161 0.998 2
length{all}[20] 0.090165 0.009294 0.000334 0.248603 0.058969 1.001 2
length{all}[21] 0.102360 0.009913 0.000191 0.317664 0.071365 0.999 2
length{all}[22] 0.101219 0.010768 0.000344 0.332373 0.064902 1.007 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006772
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 411
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 137 / 137 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 137 / 137 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027115 0.053983 0.071835 0.016677 0.087570 0.016771 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -568.104910
Iterating by ming2
Initial: fx= 568.104910
x= 0.02712 0.05398 0.07184 0.01668 0.08757 0.01677 0.30000 1.30000
1 h-m-p 0.0000 0.0001 329.3384 ++ 554.708904 m 0.0001 13 | 1/8
2 h-m-p 0.0015 0.0186 25.5146 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 301.2801 ++ 554.645655 m 0.0000 44 | 2/8
4 h-m-p 0.0000 0.0242 20.9485 ---------.. | 2/8
5 h-m-p 0.0000 0.0001 269.0179 ++ 549.092371 m 0.0001 73 | 3/8
6 h-m-p 0.0010 0.0272 17.7230 -----------.. | 3/8
7 h-m-p 0.0000 0.0002 232.9420 +++ 538.202692 m 0.0002 105 | 4/8
8 h-m-p 0.0030 0.0448 12.6740 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 190.8787 ++ 533.331227 m 0.0001 137 | 5/8
10 h-m-p 0.0023 0.1215 7.7359 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 135.2361 ++ 531.169617 m 0.0001 169 | 6/8
12 h-m-p 0.3964 8.0000 0.0000 +++ 531.169617 m 8.0000 181 | 6/8
13 h-m-p 0.0382 8.0000 0.0005 ---C 531.169617 0 0.0002 197 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 -----Y 531.169617 0 0.0000 215
Out..
lnL = -531.169617
216 lfun, 216 eigenQcodon, 1296 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095084 0.075963 0.093092 0.074643 0.059356 0.109413 0.299989 0.800599 0.220329
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.347849
np = 9
lnL0 = -596.290975
Iterating by ming2
Initial: fx= 596.290975
x= 0.09508 0.07596 0.09309 0.07464 0.05936 0.10941 0.29999 0.80060 0.22033
1 h-m-p 0.0000 0.0005 297.4348 +++ 551.743331 m 0.0005 15 | 1/9
2 h-m-p 0.0000 0.0002 287.2668 ++ 541.437488 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0001 131.4459 ++ 540.404377 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0000 23925.3659 ++ 532.879877 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 594.8417 ++ 532.436451 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 543.3858 ++ 532.363426 m 0.0000 75 | 5/9
7 h-m-p 0.0000 0.0000 248.0801
h-m-p: 8.70003219e-22 4.35001609e-21 2.48080107e+02 532.363426
.. | 5/9
8 h-m-p 0.0000 0.0001 135.7123 ++ 531.169648 m 0.0001 96 | 6/9
9 h-m-p 0.0287 8.0000 0.0001 +++++ 531.169648 m 8.0000 111 | 6/9
10 h-m-p 0.0002 0.0010 0.3906 --------N 531.169648 0 0.0000 134 | 6/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 531.169648 m 8.0000 152 | 6/9
12 h-m-p 0.0031 1.5426 1.6579 +++++ 531.169624 m 1.5426 170 | 7/9
13 h-m-p 0.1001 0.5005 5.2820 ----------Y 531.169624 0 0.0000 192 | 7/9
14 h-m-p 0.1914 8.0000 0.0000 Y 531.169624 0 0.0479 204 | 7/9
15 h-m-p 0.0379 8.0000 0.0000 ------Y 531.169624 0 0.0000 224
Out..
lnL = -531.169624
225 lfun, 675 eigenQcodon, 2700 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109768 0.089254 0.070517 0.090796 0.031538 0.051179 2.693744 1.407514 0.284837 0.487384 1.431125
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.369757
np = 11
lnL0 = -589.622357
Iterating by ming2
Initial: fx= 589.622357
x= 0.10977 0.08925 0.07052 0.09080 0.03154 0.05118 2.69374 1.40751 0.28484 0.48738 1.43113
1 h-m-p 0.0000 0.0002 313.8881 +++ 565.306156 m 0.0002 17 | 1/11
2 h-m-p 0.0001 0.0007 153.8584 ++ 552.034635 m 0.0007 31 | 2/11
3 h-m-p 0.0000 0.0000 12402.9933 ++ 541.821252 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0004 395.8145 ++ 533.875497 m 0.0004 59 | 4/11
5 h-m-p 0.0000 0.0000 687.0529 ++ 533.432092 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0001 1580.5500 ++ 532.955923 m 0.0001 87 | 6/11
7 h-m-p 0.0004 0.0058 107.1907 -----------.. | 6/11
8 h-m-p 0.0000 0.0001 135.1723 ++ 531.169648 m 0.0001 124 | 7/11
9 h-m-p 0.1049 8.0000 0.0000 ++++ 531.169648 m 8.0000 140 | 6/11
10 h-m-p 0.0160 8.0000 0.0116 -----Y 531.169648 0 0.0000 163 | 6/11
11 h-m-p 0.0000 0.0000 1.2075 ++ 531.169648 m 0.0000 182 | 6/11
12 h-m-p 0.0160 8.0000 0.0003 +++++ 531.169648 m 8.0000 199 | 6/11
13 h-m-p 0.0005 0.2220 4.7186 +++++ 531.169639 m 0.2220 221 | 6/11
14 h-m-p -0.0000 -0.0000 0.9173
h-m-p: -0.00000000e+00 -0.00000000e+00 9.17326948e-01 531.169639
.. | 6/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 531.169639 m 8.0000 254 | 6/11
16 h-m-p 0.0026 1.2910 1.0465 +++++ 531.169620 m 1.2910 276 | 7/11
17 h-m-p 1.6000 8.0000 0.1640 ++ 531.169618 m 8.0000 290 | 7/11
18 h-m-p 1.6000 8.0000 0.4597 C 531.169618 0 1.6000 308 | 7/11
19 h-m-p 1.6000 8.0000 0.0289 C 531.169618 0 1.2928 326 | 7/11
20 h-m-p 1.6000 8.0000 0.0009 ++ 531.169618 m 8.0000 344 | 7/11
21 h-m-p 0.3403 8.0000 0.0219 +Y 531.169618 0 3.0344 363 | 7/11
22 h-m-p 1.6000 8.0000 0.0017 ++ 531.169618 m 8.0000 381 | 7/11
23 h-m-p 0.0046 1.9089 3.0390 +++Y 531.169616 0 0.5393 402 | 7/11
24 h-m-p 1.6000 8.0000 0.8474 +C 531.169607 0 6.3977 417 | 7/11
25 h-m-p 1.6000 8.0000 2.6779 +Y 531.169592 0 5.0495 436 | 7/11
26 h-m-p 1.6000 8.0000 0.2632 ++ 531.169592 m 8.0000 450 | 7/11
27 h-m-p 1.1862 8.0000 1.7752 Y 531.169591 0 1.1862 468 | 7/11
28 h-m-p 0.2763 3.2947 7.6214 Y 531.169591 0 0.0425 482 | 7/11
29 h-m-p 0.7467 8.0000 0.4337 +Y 531.169591 0 4.3489 497 | 7/11
30 h-m-p 1.6000 8.0000 0.2719 ----------C 531.169591 0 0.0000 525 | 7/11
31 h-m-p 0.0160 8.0000 0.4028 +++C 531.169591 0 1.0991 546 | 7/11
32 h-m-p 1.6000 8.0000 0.0575 Y 531.169591 0 0.6942 564 | 7/11
33 h-m-p 1.6000 8.0000 0.0201 C 531.169591 0 0.4000 582 | 7/11
34 h-m-p 1.3611 8.0000 0.0059 ++ 531.169591 m 8.0000 600 | 7/11
35 h-m-p 1.6000 8.0000 0.0093 ++ 531.169591 m 8.0000 618 | 7/11
36 h-m-p 0.3265 8.0000 0.2276 +C 531.169591 0 1.4662 637 | 7/11
37 h-m-p 1.6000 8.0000 0.0266 ++ 531.169591 m 8.0000 655 | 7/11
38 h-m-p 0.0337 8.0000 6.3100 ++Y 531.169590 0 0.9587 675 | 7/11
39 h-m-p 1.6000 8.0000 3.6787 ++ 531.169581 m 8.0000 689 | 7/11
40 h-m-p 0.9337 4.6685 15.3360 ++ 531.169576 m 4.6685 703 | 7/11
41 h-m-p -0.0000 -0.0000 27.6765
h-m-p: -0.00000000e+00 -0.00000000e+00 2.76764700e+01 531.169576
.. | 7/11
42 h-m-p 0.0160 8.0000 0.0000 Y 531.169576 0 0.0160 728 | 7/11
43 h-m-p 0.0464 8.0000 0.0000 C 531.169576 0 0.0116 746
Out..
lnL = -531.169576
747 lfun, 2988 eigenQcodon, 13446 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -531.166497 S = -531.166385 -0.000043
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:04
did 20 / 47 patterns 0:04
did 30 / 47 patterns 0:04
did 40 / 47 patterns 0:04
did 47 / 47 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106341 0.010103 0.043068 0.087041 0.057715 0.022509 16.972563 1.120973 1.665684
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.546975
np = 9
lnL0 = -574.550211
Iterating by ming2
Initial: fx= 574.550211
x= 0.10634 0.01010 0.04307 0.08704 0.05771 0.02251 16.97256 1.12097 1.66568
1 h-m-p 0.0000 0.0001 317.6023 ++ 566.836420 m 0.0001 14 | 1/9
2 h-m-p 0.0018 0.0960 11.9931 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 291.6020 ++ 558.832282 m 0.0001 48 | 2/9
4 h-m-p 0.0028 0.1328 8.8040 ------------.. | 2/9
5 h-m-p 0.0000 0.0002 262.4988 ++ 547.988246 m 0.0002 82 | 3/9
6 h-m-p 0.0066 0.2343 5.3497 ------------.. | 3/9
7 h-m-p 0.0000 0.0001 230.2608 ++ 542.059517 m 0.0001 116 | 4/9
8 h-m-p 0.0073 0.6075 2.8533 -------------.. | 4/9
9 h-m-p 0.0000 0.0002 188.8945 +++ 533.933838 m 0.0002 152 | 5/9
10 h-m-p 0.0167 1.4750 1.7908 -------------.. | 5/9
11 h-m-p 0.0000 0.0001 135.7588 ++ 531.169661 m 0.0001 187 | 6/9
12 h-m-p 1.2215 8.0000 0.0000 ++ 531.169661 m 8.0000 199 | 6/9
13 h-m-p 0.1566 8.0000 0.0001 ----C 531.169661 0 0.0002 218
Out..
lnL = -531.169661
219 lfun, 2409 eigenQcodon, 13140 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.020284 0.044467 0.035418 0.076614 0.045726 0.089681 16.972563 0.900000 1.146307 1.457069 1.300049
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.347716
np = 11
lnL0 = -572.367845
Iterating by ming2
Initial: fx= 572.367845
x= 0.02028 0.04447 0.03542 0.07661 0.04573 0.08968 16.97256 0.90000 1.14631 1.45707 1.30005
1 h-m-p 0.0000 0.0002 313.2397 ++ 556.853413 m 0.0002 16 | 1/11
2 h-m-p 0.0006 0.0028 68.9802 ++ 545.753120 m 0.0028 30 | 2/11
3 h-m-p 0.0000 0.0001 921.1507 ++ 540.511914 m 0.0001 44 | 3/11
4 h-m-p 0.0000 0.0001 59.3469 ++ 540.443105 m 0.0001 58 | 4/11
5 h-m-p 0.0000 0.0000 272100.0753 ++ 534.494668 m 0.0000 72 | 4/11
6 h-m-p 0.0001 0.0006 152.9286 ++ 532.856502 m 0.0006 86 | 5/11
7 h-m-p 0.0041 0.0656 22.2385 ------------.. | 5/11
8 h-m-p 0.0000 0.0001 136.0541 ++ 531.169651 m 0.0001 124 | 6/11
9 h-m-p 0.5289 8.0000 0.0000 ++ 531.169651 m 8.0000 138 | 6/11
10 h-m-p 0.0251 8.0000 0.0019 +++++ 531.169651 m 8.0000 160 | 6/11
11 h-m-p 0.0291 2.8828 0.5218 -----------Y 531.169651 0 0.0000 190 | 6/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 531.169651 m 8.0000 212 | 6/11
13 h-m-p 0.0160 8.0000 0.0875 --------N 531.169651 0 0.0000 239 | 6/11
14 h-m-p 0.0160 8.0000 0.0000 ---Y 531.169651 0 0.0001 261 | 6/11
15 h-m-p 0.0160 8.0000 0.0000 -N 531.169651 0 0.0010 281
Out..
lnL = -531.169651
282 lfun, 3384 eigenQcodon, 18612 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -531.178930 S = -531.168102 -0.004750
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:13
did 20 / 47 patterns 0:13
did 30 / 47 patterns 0:13
did 40 / 47 patterns 0:13
did 47 / 47 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=137
NC_011896_1_WP_010907648_1_294_MLBR_RS01435 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
NC_002677_1_NP_301324_1_196_ML0284 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE
**************************************************
NC_011896_1_WP_010907648_1_294_MLBR_RS01435 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
NC_002677_1_NP_301324_1_196_ML0284 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575 GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC
**************************************************
NC_011896_1_WP_010907648_1_294_MLBR_RS01435 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
NC_002677_1_NP_301324_1_196_ML0284 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575 VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
*************************************
>NC_011896_1_WP_010907648_1_294_MLBR_RS01435 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG AGCTCGGGCTC >NC_002677_1_NP_301324_1_196_ML0284 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG AGCTCGGGCTC >NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG AGCTCGGGCTC >NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG AGCTCGGGCTC >NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG AGCTCGGGCTC >NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575 ATGACGTCAATGGGTGATCTCCTGGGGCCTGATCCGATACTGCTGCCCGA TGACAGCGCCGCCGAGGTGGAACTGCGCGCAAACAAGGATCCCGGAACCG TTGCCGCCGCCCATCCTTCCGCGTCGGTGGCCTGGGCGGCACTTGCTGAG GGGGCACTGGCCGACGATAAGGCTACCACAGCTTACGCGTATGCCCGCAC TGGCTACCACCGCGGTCTCGATCAGCTGCGCTGCAATGGCTGGAAAGGTT TTGGCCCGGTGCCGTATTCGCACGAGCCGAACCGCGGCTTCCTGCGCTGC GTGGCCGCGCTGGCGCGGGCCGCGAACGCCATTGGTGAGACCGACGAGTA TAGACGCTGCCTGAATCTGCTTGACGATTGCGACCCCGCAGCTCGCAACG AGCTCGGGCTC
>NC_011896_1_WP_010907648_1_294_MLBR_RS01435 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL >NC_002677_1_NP_301324_1_196_ML0284 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL >NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL >NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL >NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL >NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575 MTSMGDLLGPDPILLPDDSAAEVELRANKDPGTVAAAHPSASVAWAALAE GALADDKATTAYAYARTGYHRGLDQLRCNGWKGFGPVPYSHEPNRGFLRC VAALARAANAIGETDEYRRCLNLLDDCDPAARNELGL
#NEXUS
[ID: 0788522640]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907648_1_294_MLBR_RS01435
NC_002677_1_NP_301324_1_196_ML0284
NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395
NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520
NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525
NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907648_1_294_MLBR_RS01435,
2 NC_002677_1_NP_301324_1_196_ML0284,
3 NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395,
4 NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520,
5 NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525,
6 NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06822473,2:0.07208411,3:0.06595388,4:0.06903015,5:0.07006298,6:0.06546471);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06822473,2:0.07208411,3:0.06595388,4:0.06903015,5:0.07006298,6:0.06546471);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -551.53 -554.31
2 -551.50 -555.13
--------------------------------------
TOTAL -551.51 -554.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0284/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891099 0.085157 0.354771 1.461019 0.859373 1401.74 1433.31 1.001
r(A<->C){all} 0.152921 0.017405 0.000056 0.417120 0.118443 157.04 300.20 1.000
r(A<->G){all} 0.171165 0.020419 0.000083 0.454439 0.135067 235.37 272.74 1.004
r(A<->T){all} 0.168221 0.018735 0.000027 0.438747 0.131900 221.56 254.43 1.000
r(C<->G){all} 0.169653 0.018371 0.000064 0.425878 0.140459 192.48 216.55 1.007
r(C<->T){all} 0.173672 0.021382 0.000072 0.472730 0.134667 192.13 209.08 1.001
r(G<->T){all} 0.164369 0.019750 0.000082 0.442822 0.125588 123.42 199.08 1.002
pi(A){all} 0.168229 0.000325 0.132373 0.201489 0.167631 1311.35 1406.17 1.000
pi(C){all} 0.327690 0.000538 0.278631 0.369461 0.327444 1143.03 1264.62 1.000
pi(G){all} 0.326469 0.000519 0.281070 0.369079 0.326103 1328.99 1415.00 1.000
pi(T){all} 0.177611 0.000332 0.143029 0.212975 0.176994 1037.69 1228.21 1.000
alpha{1,2} 0.396958 0.199618 0.000232 1.356336 0.229981 1170.45 1335.73 1.000
alpha{3} 0.463562 0.245638 0.000175 1.490978 0.300774 1197.90 1211.78 1.000
pinvar{all} 0.996079 0.000022 0.987309 0.999994 0.997570 1233.56 1244.90 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0284/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 137
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 4 4 4 4 4 4
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 4 4 4 4 4 4 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 8 8 8 8 8 8
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 10 10 10 10 10 10 | CCG 4 4 4 4 4 4 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 0 0 0 0 0 0 | ACC 3 3 3 3 3 3 | AAC 4 4 4 4 4 4 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 4 4 4 4 4 4 | Asp GAT 7 7 7 7 7 7 | Gly GGT 4 4 4 4 4 4
GTC 0 0 0 0 0 0 | GCC 11 11 11 11 11 11 | GAC 5 5 5 5 5 5 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 4 4 4 4 4 4 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 4 4 4 4 4 4 | GCG 6 6 6 6 6 6 | GAG 6 6 6 6 6 6 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907648_1_294_MLBR_RS01435
position 1: T:0.12409 C:0.27737 A:0.15328 G:0.44526
position 2: T:0.19708 C:0.32117 A:0.27007 G:0.21168
position 3: T:0.21168 C:0.38686 A:0.08029 G:0.32117
Average T:0.17762 C:0.32847 A:0.16788 G:0.32603
#2: NC_002677_1_NP_301324_1_196_ML0284
position 1: T:0.12409 C:0.27737 A:0.15328 G:0.44526
position 2: T:0.19708 C:0.32117 A:0.27007 G:0.21168
position 3: T:0.21168 C:0.38686 A:0.08029 G:0.32117
Average T:0.17762 C:0.32847 A:0.16788 G:0.32603
#3: NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395
position 1: T:0.12409 C:0.27737 A:0.15328 G:0.44526
position 2: T:0.19708 C:0.32117 A:0.27007 G:0.21168
position 3: T:0.21168 C:0.38686 A:0.08029 G:0.32117
Average T:0.17762 C:0.32847 A:0.16788 G:0.32603
#4: NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520
position 1: T:0.12409 C:0.27737 A:0.15328 G:0.44526
position 2: T:0.19708 C:0.32117 A:0.27007 G:0.21168
position 3: T:0.21168 C:0.38686 A:0.08029 G:0.32117
Average T:0.17762 C:0.32847 A:0.16788 G:0.32603
#5: NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525
position 1: T:0.12409 C:0.27737 A:0.15328 G:0.44526
position 2: T:0.19708 C:0.32117 A:0.27007 G:0.21168
position 3: T:0.21168 C:0.38686 A:0.08029 G:0.32117
Average T:0.17762 C:0.32847 A:0.16788 G:0.32603
#6: NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575
position 1: T:0.12409 C:0.27737 A:0.15328 G:0.44526
position 2: T:0.19708 C:0.32117 A:0.27007 G:0.21168
position 3: T:0.21168 C:0.38686 A:0.08029 G:0.32117
Average T:0.17762 C:0.32847 A:0.16788 G:0.32603
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 0
TTC 6 | TCC 6 | TAC 12 | TGC 24
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 12 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 0
CTC 24 | CCC 18 | CAC 12 | CGC 48
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 0
CTG 60 | CCG 24 | CAG 6 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 0
ATC 0 | ACC 18 | AAC 24 | AGC 6
ATA 6 | ACA 6 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 12 | ACG 6 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 24 | Asp D GAT 42 | Gly G GGT 24
GTC 0 | GCC 66 | GAC 30 | GGC 24
GTA 0 | GCA 24 | Glu E GAA 6 | GGA 6
GTG 24 | GCG 36 | GAG 36 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12409 C:0.27737 A:0.15328 G:0.44526
position 2: T:0.19708 C:0.32117 A:0.27007 G:0.21168
position 3: T:0.21168 C:0.38686 A:0.08029 G:0.32117
Average T:0.17762 C:0.32847 A:0.16788 G:0.32603
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -531.169617 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299989 1.300049
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907648_1_294_MLBR_RS01435: 0.000004, NC_002677_1_NP_301324_1_196_ML0284: 0.000004, NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395: 0.000004, NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520: 0.000004, NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525: 0.000004, NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29999
omega (dN/dS) = 1.30005
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 315.2 95.8 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 315.2 95.8 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 315.2 95.8 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 315.2 95.8 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 315.2 95.8 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 315.2 95.8 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -531.169624 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 2.693744 0.000010 0.482611
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907648_1_294_MLBR_RS01435: 0.000004, NC_002677_1_NP_301324_1_196_ML0284: 0.000004, NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395: 0.000004, NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520: 0.000004, NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525: 0.000004, NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 2.69374
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.48261 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 298.4 112.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 298.4 112.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 298.4 112.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 298.4 112.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 298.4 112.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 298.4 112.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -531.169576 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 16.972563 0.002460 0.000000 1.000000 69.677517
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907648_1_294_MLBR_RS01435: 0.000004, NC_002677_1_NP_301324_1_196_ML0284: 0.000004, NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395: 0.000004, NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520: 0.000004, NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525: 0.000004, NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 16.97256
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00246 0.00000 0.99754
w: 1.00000 1.00000 69.67752
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 285.3 125.7 69.5086 0.0000 0.0000 0.0 0.0
7..2 0.000 285.3 125.7 69.5086 0.0000 0.0000 0.0 0.0
7..3 0.000 285.3 125.7 69.5086 0.0000 0.0000 0.0 0.0
7..4 0.000 285.3 125.7 69.5086 0.0000 0.0000 0.0 0.0
7..5 0.000 285.3 125.7 69.5086 0.0000 0.0000 0.0 0.0
7..6 0.000 285.3 125.7 69.5086 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907648_1_294_MLBR_RS01435)
Pr(w>1) post mean +- SE for w
1 M 1.000** 69.509
2 T 1.000** 69.509
3 S 1.000** 69.509
4 M 1.000** 69.509
5 G 1.000** 69.509
6 D 1.000** 69.509
7 L 1.000** 69.509
8 L 1.000** 69.509
9 G 1.000** 69.509
10 P 1.000** 69.509
11 D 1.000** 69.509
12 P 1.000** 69.509
13 I 1.000** 69.509
14 L 1.000** 69.509
15 L 1.000** 69.509
16 P 1.000** 69.509
17 D 1.000** 69.509
18 D 1.000** 69.509
19 S 1.000** 69.509
20 A 1.000** 69.509
21 A 1.000** 69.509
22 E 1.000** 69.509
23 V 1.000** 69.509
24 E 1.000** 69.509
25 L 1.000** 69.509
26 R 1.000** 69.509
27 A 1.000** 69.509
28 N 1.000** 69.509
29 K 1.000** 69.509
30 D 1.000** 69.509
31 P 1.000** 69.509
32 G 1.000** 69.509
33 T 1.000** 69.509
34 V 1.000** 69.509
35 A 1.000** 69.509
36 A 1.000** 69.509
37 A 1.000** 69.509
38 H 1.000** 69.509
39 P 1.000** 69.509
40 S 1.000** 69.509
41 A 1.000** 69.509
42 S 1.000** 69.509
43 V 1.000** 69.509
44 A 1.000** 69.509
45 W 1.000** 69.509
46 A 1.000** 69.509
47 A 1.000** 69.509
48 L 1.000** 69.509
49 A 1.000** 69.509
50 E 1.000** 69.509
51 G 1.000** 69.509
52 A 1.000** 69.509
53 L 1.000** 69.509
54 A 1.000** 69.509
55 D 1.000** 69.509
56 D 1.000** 69.509
57 K 1.000** 69.509
58 A 1.000** 69.509
59 T 1.000** 69.509
60 T 1.000** 69.509
61 A 1.000** 69.509
62 Y 1.000** 69.509
63 A 1.000** 69.509
64 Y 1.000** 69.509
65 A 1.000** 69.509
66 R 1.000** 69.509
67 T 1.000** 69.509
68 G 1.000** 69.509
69 Y 1.000** 69.509
70 H 1.000** 69.509
71 R 1.000** 69.509
72 G 1.000** 69.509
73 L 1.000** 69.509
74 D 1.000** 69.509
75 Q 1.000** 69.509
76 L 1.000** 69.509
77 R 1.000** 69.509
78 C 1.000** 69.509
79 N 1.000** 69.509
80 G 1.000** 69.509
81 W 1.000** 69.509
82 K 1.000** 69.509
83 G 1.000** 69.509
84 F 1.000** 69.509
85 G 1.000** 69.509
86 P 1.000** 69.509
87 V 1.000** 69.509
88 P 1.000** 69.509
89 Y 1.000** 69.509
90 S 1.000** 69.509
91 H 1.000** 69.509
92 E 1.000** 69.509
93 P 1.000** 69.509
94 N 1.000** 69.509
95 R 1.000** 69.509
96 G 1.000** 69.509
97 F 1.000** 69.509
98 L 1.000** 69.509
99 R 1.000** 69.509
100 C 1.000** 69.509
101 V 1.000** 69.509
102 A 1.000** 69.509
103 A 1.000** 69.509
104 L 1.000** 69.509
105 A 1.000** 69.509
106 R 1.000** 69.509
107 A 1.000** 69.509
108 A 1.000** 69.509
109 N 1.000** 69.509
110 A 1.000** 69.509
111 I 1.000** 69.509
112 G 1.000** 69.509
113 E 1.000** 69.509
114 T 1.000** 69.509
115 D 1.000** 69.509
116 E 1.000** 69.509
117 Y 1.000** 69.509
118 R 1.000** 69.509
119 R 1.000** 69.509
120 C 1.000** 69.509
121 L 1.000** 69.509
122 N 1.000** 69.509
123 L 1.000** 69.509
124 L 1.000** 69.509
125 D 1.000** 69.509
126 D 1.000** 69.509
127 C 1.000** 69.509
128 D 1.000** 69.509
129 P 1.000** 69.509
130 A 1.000** 69.509
131 A 1.000** 69.509
132 R 1.000** 69.509
133 N 1.000** 69.509
134 E 1.000** 69.509
135 L 1.000** 69.509
136 G 1.000** 69.509
137 L 1.000** 69.509
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907648_1_294_MLBR_RS01435)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -531.169661 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 16.972563 1.120931 1.665650
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907648_1_294_MLBR_RS01435: 0.000004, NC_002677_1_NP_301324_1_196_ML0284: 0.000004, NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395: 0.000004, NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520: 0.000004, NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525: 0.000004, NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 16.97256
Parameters in M7 (beta):
p = 1.12093 q = 1.66565
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.04278 0.11682 0.18889 0.26184 0.33718 0.41639 0.50137 0.59517 0.70407 0.84817
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 285.3 125.7 0.4013 0.0000 0.0000 0.0 0.0
7..2 0.000 285.3 125.7 0.4013 0.0000 0.0000 0.0 0.0
7..3 0.000 285.3 125.7 0.4013 0.0000 0.0000 0.0 0.0
7..4 0.000 285.3 125.7 0.4013 0.0000 0.0000 0.0 0.0
7..5 0.000 285.3 125.7 0.4013 0.0000 0.0000 0.0 0.0
7..6 0.000 285.3 125.7 0.4013 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -531.169651 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 16.971974 0.933181 1.202469 1.425534 1.196084
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907648_1_294_MLBR_RS01435: 0.000004, NC_002677_1_NP_301324_1_196_ML0284: 0.000004, NZ_LVXE01000050_1_WP_010907648_1_2107_A3216_RS11395: 0.000004, NZ_LYPH01000059_1_WP_010907648_1_2201_A8144_RS10520: 0.000004, NZ_CP029543_1_WP_010907648_1_295_DIJ64_RS01525: 0.000004, NZ_AP014567_1_WP_010907648_1_305_JK2ML_RS01575: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 16.97197
Parameters in M8 (beta&w>1):
p0 = 0.93318 p = 1.20247 q = 1.42553
(p1 = 0.06682) w = 1.19608
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09332 0.09332 0.09332 0.09332 0.09332 0.09332 0.09332 0.09332 0.09332 0.09332 0.06682
w: 0.06002 0.15254 0.23770 0.32065 0.40353 0.48788 0.57533 0.66814 0.77054 0.89507 1.19608
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 285.3 125.7 0.5065 0.0000 0.0000 0.0 0.0
7..2 0.000 285.3 125.7 0.5065 0.0000 0.0000 0.0 0.0
7..3 0.000 285.3 125.7 0.5065 0.0000 0.0000 0.0 0.0
7..4 0.000 285.3 125.7 0.5065 0.0000 0.0000 0.0 0.0
7..5 0.000 285.3 125.7 0.5065 0.0000 0.0000 0.0 0.0
7..6 0.000 285.3 125.7 0.5065 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907648_1_294_MLBR_RS01435)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907648_1_294_MLBR_RS01435)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:13
Model 1: NearlyNeutral -531.169624 Model 2: PositiveSelection -531.169576 Model 0: one-ratio -531.169617 Model 7: beta -531.169661 Model 8: beta&w>1 -531.169651 Model 0 vs 1 1.3999999964653398E-5 Model 2 vs 1 9.599999998499698E-5 Model 8 vs 7 1.9999999949504854E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
