--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:08:24 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0298/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -307.16 -310.27
2 -307.16 -312.45
--------------------------------------
TOTAL -307.16 -311.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903120 0.096292 0.380725 1.548777 0.864778 1393.30 1447.15 1.000
r(A<->C){all} 0.159460 0.018889 0.000097 0.432540 0.122683 151.52 271.19 1.001
r(A<->G){all} 0.173682 0.020744 0.000260 0.467426 0.136729 157.72 203.58 1.000
r(A<->T){all} 0.161654 0.019530 0.000011 0.450906 0.123403 268.51 273.33 1.000
r(C<->G){all} 0.162676 0.018708 0.000192 0.434680 0.129530 214.55 248.02 1.001
r(C<->T){all} 0.162589 0.021193 0.000068 0.475185 0.119939 194.41 234.49 1.002
r(G<->T){all} 0.179939 0.023771 0.000079 0.485820 0.137356 90.20 212.26 1.009
pi(A){all} 0.203435 0.000721 0.150266 0.254224 0.203168 910.25 1150.95 1.000
pi(C){all} 0.235081 0.000818 0.180177 0.292458 0.234603 1202.82 1204.81 1.000
pi(G){all} 0.301610 0.000898 0.242635 0.357061 0.301042 1097.53 1154.98 1.000
pi(T){all} 0.259874 0.000860 0.201200 0.313430 0.259568 1199.88 1227.07 1.000
alpha{1,2} 0.412489 0.224919 0.000165 1.359574 0.241668 1015.77 1124.18 1.000
alpha{3} 0.466392 0.243742 0.000346 1.439055 0.305297 1280.70 1346.69 1.000
pinvar{all} 0.992503 0.000090 0.975829 0.999994 0.995489 1277.37 1312.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -293.069809
Model 2: PositiveSelection -293.069809
Model 0: one-ratio -293.069885
Model 7: beta -293.069837
Model 8: beta&w>1 -293.069809
Model 0 vs 1 1.519999999572974E-4
Model 2 vs 1 0.0
Model 8 vs 7 5.599999997230043E-5
>C1
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C2
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C3
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C4
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C5
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C6
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=74
C1 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C2 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C3 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C4 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C5 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C6 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
**************************************************
C1 SELPAVTGRSEPIRLEVVTAVQGG
C2 SELPAVTGRSEPIRLEVVTAVQGG
C3 SELPAVTGRSEPIRLEVVTAVQGG
C4 SELPAVTGRSEPIRLEVVTAVQGG
C5 SELPAVTGRSEPIRLEVVTAVQGG
C6 SELPAVTGRSEPIRLEVVTAVQGG
************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2220]--->[2220]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.447 Mb, Max= 30.594 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C2 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C3 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C4 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C5 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
C6 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
**************************************************
C1 SELPAVTGRSEPIRLEVVTAVQGG
C2 SELPAVTGRSEPIRLEVVTAVQGG
C3 SELPAVTGRSEPIRLEVVTAVQGG
C4 SELPAVTGRSEPIRLEVVTAVQGG
C5 SELPAVTGRSEPIRLEVVTAVQGG
C6 SELPAVTGRSEPIRLEVVTAVQGG
************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
C2 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
C3 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
C4 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
C5 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
C6 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
**************************************************
C1 CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
C2 CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
C3 CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
C4 CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
C5 CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
C6 CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
**************************************************
C1 TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
C2 TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
C3 TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
C4 TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
C5 TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
C6 TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
**************************************************
C1 TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
C2 TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
C3 TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
C4 TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
C5 TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
C6 TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
**************************************************
C1 GGTTACGGCAGTGCAAGGTGGT
C2 GGTTACGGCAGTGCAAGGTGGT
C3 GGTTACGGCAGTGCAAGGTGGT
C4 GGTTACGGCAGTGCAAGGTGGT
C5 GGTTACGGCAGTGCAAGGTGGT
C6 GGTTACGGCAGTGCAAGGTGGT
**********************
>C1
ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
GGTTACGGCAGTGCAAGGTGGT
>C2
ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
GGTTACGGCAGTGCAAGGTGGT
>C3
ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
GGTTACGGCAGTGCAAGGTGGT
>C4
ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
GGTTACGGCAGTGCAAGGTGGT
>C5
ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
GGTTACGGCAGTGCAAGGTGGT
>C6
ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC
CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG
TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT
TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT
GGTTACGGCAGTGCAAGGTGGT
>C1
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C2
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C3
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C4
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C5
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
>C6
MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
SELPAVTGRSEPIRLEVVTAVQGG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 222 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579799219
Setting output file names to "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1503477374
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0982559540
Seed = 2040854425
Swapseed = 1579799219
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -496.846641 -- -24.965149
Chain 2 -- -496.846612 -- -24.965149
Chain 3 -- -496.846641 -- -24.965149
Chain 4 -- -496.846612 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -496.846641 -- -24.965149
Chain 2 -- -496.846641 -- -24.965149
Chain 3 -- -496.846612 -- -24.965149
Chain 4 -- -496.846641 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-496.847] (-496.847) (-496.847) (-496.847) * [-496.847] (-496.847) (-496.847) (-496.847)
500 -- (-319.042) (-317.391) [-314.596] (-317.671) * (-324.553) [-319.095] (-316.119) (-315.236) -- 0:00:00
1000 -- (-320.145) (-316.318) (-318.008) [-315.402] * [-317.063] (-312.771) (-328.220) (-315.920) -- 0:00:00
1500 -- [-318.062] (-320.431) (-320.407) (-319.639) * (-317.675) (-321.214) [-313.335] (-315.419) -- 0:00:00
2000 -- (-320.782) (-312.777) [-313.825] (-314.909) * (-313.484) (-318.595) (-320.208) [-317.825] -- 0:00:00
2500 -- (-315.129) (-315.036) [-318.503] (-322.810) * (-316.199) (-319.163) [-319.620] (-317.341) -- 0:00:00
3000 -- [-319.145] (-314.556) (-317.420) (-320.698) * [-313.724] (-317.336) (-311.970) (-317.875) -- 0:00:00
3500 -- (-321.853) (-320.086) [-314.980] (-322.365) * (-320.298) (-317.134) (-320.362) [-311.327] -- 0:00:00
4000 -- [-313.687] (-321.892) (-315.291) (-325.201) * (-318.865) (-320.688) (-322.683) [-312.402] -- 0:00:00
4500 -- (-316.108) [-318.337] (-330.807) (-316.091) * (-321.443) [-317.278] (-315.324) (-322.546) -- 0:00:00
5000 -- (-318.257) (-312.949) [-312.839] (-321.188) * (-317.542) [-318.593] (-312.345) (-318.526) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- [-310.564] (-318.681) (-319.072) (-320.999) * (-313.924) (-317.243) [-312.357] (-324.777) -- 0:00:00
6000 -- (-322.694) (-319.704) (-318.400) [-323.836] * (-315.713) [-314.222] (-313.389) (-314.100) -- 0:00:00
6500 -- (-315.577) [-315.077] (-313.232) (-313.890) * (-317.544) (-317.830) (-319.430) [-313.472] -- 0:00:00
7000 -- (-318.012) (-314.220) [-317.448] (-325.857) * (-324.161) (-317.973) (-318.517) [-318.550] -- 0:00:00
7500 -- (-315.520) (-318.675) [-314.857] (-314.110) * [-314.187] (-317.165) (-319.855) (-320.437) -- 0:00:00
8000 -- [-318.966] (-323.768) (-319.144) (-320.483) * (-318.334) (-323.294) (-319.689) [-317.466] -- 0:00:00
8500 -- (-315.004) (-318.421) (-316.870) [-320.523] * (-315.996) [-320.449] (-323.406) (-318.420) -- 0:00:00
9000 -- (-317.667) (-318.531) [-322.463] (-318.370) * (-316.863) (-314.927) [-314.081] (-314.020) -- 0:00:00
9500 -- (-320.479) (-320.955) [-313.687] (-317.064) * (-320.284) [-313.326] (-317.879) (-319.587) -- 0:00:00
10000 -- (-316.454) (-317.449) (-318.708) [-318.882] * (-317.178) (-322.910) (-318.711) [-311.679] -- 0:00:00
Average standard deviation of split frequencies: 0.066291
10500 -- (-327.249) [-320.181] (-325.005) (-320.410) * (-316.839) [-321.034] (-313.853) (-322.801) -- 0:00:00
11000 -- (-314.350) (-316.548) (-327.391) [-314.343] * (-319.107) (-318.874) [-313.444] (-327.459) -- 0:00:00
11500 -- (-322.378) [-314.822] (-323.548) (-321.303) * (-318.355) (-327.418) [-314.500] (-330.060) -- 0:00:00
12000 -- (-320.269) (-315.076) (-317.984) [-313.101] * (-313.932) (-318.648) (-317.947) [-312.190] -- 0:00:00
12500 -- (-318.629) (-324.452) (-321.875) [-312.200] * [-319.849] (-314.773) (-314.268) (-312.505) -- 0:00:00
13000 -- (-315.281) [-313.909] (-315.829) (-313.426) * (-322.852) (-315.274) (-312.195) [-307.122] -- 0:00:00
13500 -- [-313.384] (-317.120) (-309.713) (-317.382) * (-323.251) (-318.195) (-318.156) [-308.288] -- 0:00:00
14000 -- (-317.476) (-318.529) [-308.299] (-310.003) * [-310.726] (-315.532) (-317.520) (-309.530) -- 0:00:00
14500 -- (-320.123) [-314.461] (-308.434) (-319.293) * (-327.037) [-318.085] (-318.177) (-307.875) -- 0:00:00
15000 -- (-326.498) (-313.720) (-307.827) [-324.029] * [-314.882] (-317.213) (-321.070) (-308.148) -- 0:00:00
Average standard deviation of split frequencies: 0.054506
15500 -- (-321.526) (-322.935) [-307.541] (-327.834) * (-312.804) [-316.847] (-324.146) (-307.402) -- 0:01:03
16000 -- [-312.815] (-321.333) (-310.688) (-318.243) * (-325.886) (-333.038) (-324.566) [-308.143] -- 0:01:01
16500 -- (-307.156) (-332.496) [-308.358] (-314.707) * [-314.671] (-328.416) (-324.200) (-311.008) -- 0:00:59
17000 -- (-307.099) (-320.157) [-308.545] (-327.330) * [-314.144] (-326.853) (-316.011) (-306.999) -- 0:00:57
17500 -- (-310.703) (-312.203) (-311.912) [-316.877] * (-321.116) [-316.095] (-312.862) (-308.449) -- 0:00:56
18000 -- (-309.673) (-311.105) [-308.334] (-317.237) * (-317.627) (-308.750) [-318.101] (-306.127) -- 0:00:54
18500 -- (-314.318) (-308.424) (-307.472) [-318.278] * (-314.966) [-312.828] (-317.764) (-306.892) -- 0:00:53
19000 -- (-309.497) (-307.297) [-306.868] (-323.693) * (-327.223) (-310.842) (-314.660) [-305.822] -- 0:00:51
19500 -- [-308.528] (-306.651) (-306.942) (-316.264) * (-326.593) [-310.128] (-319.079) (-309.826) -- 0:00:50
20000 -- (-308.286) (-307.308) [-305.999] (-307.611) * (-321.054) [-309.531] (-319.425) (-307.913) -- 0:00:49
Average standard deviation of split frequencies: 0.061227
20500 -- (-306.943) (-308.881) [-310.061] (-307.446) * (-317.055) [-305.734] (-321.915) (-310.430) -- 0:00:47
21000 -- (-308.883) (-308.506) [-308.439] (-307.864) * (-307.668) (-306.059) (-315.322) [-308.396] -- 0:00:46
21500 -- (-307.126) (-307.899) (-307.477) [-306.687] * [-308.694] (-308.145) (-316.877) (-311.259) -- 0:00:45
22000 -- (-307.687) (-312.207) [-305.711] (-305.983) * (-307.207) [-306.720] (-314.447) (-308.562) -- 0:00:44
22500 -- (-309.325) [-307.200] (-307.370) (-306.087) * (-311.213) [-308.045] (-315.966) (-306.491) -- 0:00:43
23000 -- (-307.460) (-306.761) (-307.949) [-306.395] * [-305.982] (-309.764) (-323.315) (-309.122) -- 0:00:42
23500 -- (-306.468) [-307.421] (-307.488) (-305.942) * [-309.470] (-305.695) (-321.384) (-306.555) -- 0:00:41
24000 -- (-305.931) [-308.069] (-306.586) (-306.217) * (-308.768) [-305.826] (-317.608) (-308.633) -- 0:00:40
24500 -- [-306.221] (-309.366) (-307.610) (-307.405) * (-306.155) (-306.682) [-314.081] (-311.583) -- 0:00:39
25000 -- (-308.579) (-309.425) [-307.978] (-312.855) * [-306.507] (-309.442) (-318.066) (-306.722) -- 0:00:39
Average standard deviation of split frequencies: 0.047800
25500 -- (-307.318) (-307.769) [-308.964] (-308.332) * (-308.300) (-306.267) [-315.626] (-308.016) -- 0:00:38
26000 -- (-307.614) (-308.680) (-312.023) [-307.123] * (-309.048) [-309.653] (-317.137) (-306.877) -- 0:00:37
26500 -- (-307.169) (-309.641) [-307.038] (-311.845) * (-307.735) (-308.952) (-318.484) [-305.832] -- 0:00:36
27000 -- (-307.029) [-309.305] (-307.696) (-306.726) * (-306.821) [-305.673] (-317.458) (-309.548) -- 0:00:36
27500 -- (-306.223) [-307.550] (-311.106) (-307.947) * (-310.516) [-306.726] (-314.364) (-308.629) -- 0:00:35
28000 -- [-307.297] (-306.868) (-309.487) (-306.527) * (-306.828) (-309.284) [-318.343] (-308.069) -- 0:00:34
28500 -- (-309.660) [-309.508] (-305.706) (-306.163) * (-310.661) (-307.574) (-328.162) [-306.803] -- 0:00:34
29000 -- (-307.924) (-306.422) (-305.970) [-307.728] * [-308.465] (-309.125) (-322.227) (-307.073) -- 0:00:33
29500 -- (-310.159) (-306.884) (-310.075) [-306.561] * (-309.124) (-308.796) (-315.548) [-306.822] -- 0:00:32
30000 -- (-306.735) (-306.614) [-308.282] (-306.605) * (-307.988) (-308.698) [-323.825] (-306.258) -- 0:00:32
Average standard deviation of split frequencies: 0.042456
30500 -- [-307.498] (-306.795) (-307.543) (-306.564) * (-307.852) (-309.424) (-325.680) [-307.346] -- 0:00:31
31000 -- (-307.337) (-310.509) [-307.626] (-308.464) * (-306.961) (-313.631) (-322.792) [-309.830] -- 0:00:31
31500 -- (-308.635) (-314.115) [-307.006] (-306.110) * (-309.263) [-308.666] (-315.593) (-312.872) -- 0:00:30
32000 -- (-308.938) (-307.478) (-306.468) [-306.336] * (-309.377) [-306.357] (-318.862) (-306.559) -- 0:01:00
32500 -- (-306.116) [-308.659] (-307.549) (-305.879) * (-308.043) [-305.757] (-317.110) (-308.878) -- 0:00:59
33000 -- (-310.047) [-306.198] (-309.046) (-308.050) * [-310.079] (-310.282) (-315.189) (-308.394) -- 0:00:58
33500 -- (-306.784) [-307.011] (-308.086) (-305.970) * (-308.855) [-308.169] (-316.152) (-307.806) -- 0:00:57
34000 -- (-307.251) (-306.549) (-306.007) [-305.628] * (-308.514) [-306.252] (-312.074) (-306.245) -- 0:00:56
34500 -- (-309.848) (-313.021) [-306.400] (-305.723) * (-308.538) [-307.967] (-317.712) (-306.826) -- 0:00:55
35000 -- (-314.530) (-310.985) (-307.562) [-306.761] * (-306.509) (-307.616) (-323.648) [-310.667] -- 0:00:55
Average standard deviation of split frequencies: 0.030324
35500 -- [-308.159] (-307.228) (-306.305) (-307.567) * (-306.080) [-305.945] (-316.593) (-306.865) -- 0:00:54
36000 -- (-310.369) [-307.112] (-309.446) (-308.396) * (-310.617) [-306.163] (-317.447) (-309.651) -- 0:00:53
36500 -- (-308.966) (-306.559) [-309.396] (-308.124) * (-307.726) (-305.940) [-315.399] (-308.790) -- 0:00:52
37000 -- (-307.248) (-306.646) (-306.643) [-308.594] * (-306.855) (-312.082) (-315.608) [-306.692] -- 0:00:52
37500 -- (-307.154) (-307.941) (-307.599) [-313.124] * (-309.197) [-305.831] (-312.178) (-305.858) -- 0:00:51
38000 -- [-307.087] (-307.061) (-307.130) (-309.744) * (-310.781) (-307.966) (-319.418) [-309.469] -- 0:00:50
38500 -- (-307.080) [-308.719] (-309.014) (-308.042) * (-307.951) [-307.408] (-315.881) (-308.058) -- 0:00:49
39000 -- (-306.359) [-306.653] (-306.603) (-306.424) * (-306.734) (-308.616) (-332.545) [-307.384] -- 0:00:49
39500 -- (-310.502) [-308.678] (-308.619) (-305.981) * [-309.513] (-307.679) (-318.202) (-308.780) -- 0:00:48
40000 -- [-307.821] (-307.967) (-306.396) (-308.196) * [-308.189] (-307.996) (-320.825) (-308.052) -- 0:00:48
Average standard deviation of split frequencies: 0.030912
40500 -- [-306.226] (-307.562) (-308.513) (-307.417) * (-309.807) [-307.776] (-334.760) (-309.466) -- 0:00:47
41000 -- (-306.264) (-308.411) [-309.360] (-306.865) * (-306.684) [-308.034] (-323.249) (-310.842) -- 0:00:46
41500 -- (-306.165) [-307.326] (-309.228) (-306.589) * [-310.894] (-306.588) (-319.668) (-308.283) -- 0:00:46
42000 -- [-306.707] (-306.984) (-305.914) (-308.069) * [-308.637] (-307.586) (-339.803) (-306.687) -- 0:00:45
42500 -- (-307.473) [-306.131] (-306.008) (-306.771) * [-307.114] (-306.190) (-322.052) (-307.007) -- 0:00:45
43000 -- [-307.563] (-307.064) (-307.399) (-308.846) * (-310.679) (-306.617) (-317.211) [-306.754] -- 0:00:44
43500 -- (-305.915) (-305.975) [-306.188] (-313.219) * (-312.970) [-308.282] (-312.100) (-308.179) -- 0:00:43
44000 -- [-306.205] (-306.384) (-306.633) (-308.344) * [-310.770] (-311.280) (-306.479) (-306.476) -- 0:00:43
44500 -- (-306.907) [-308.856] (-306.092) (-306.702) * (-309.354) [-309.146] (-306.303) (-306.264) -- 0:00:42
45000 -- [-307.765] (-310.992) (-307.860) (-310.892) * (-307.575) (-307.726) (-306.965) [-307.156] -- 0:00:42
Average standard deviation of split frequencies: 0.028516
45500 -- [-311.667] (-308.456) (-306.777) (-308.284) * (-307.305) (-308.982) (-312.788) [-311.544] -- 0:00:41
46000 -- [-308.269] (-308.571) (-309.223) (-309.141) * (-306.105) [-307.845] (-308.370) (-307.378) -- 0:00:41
46500 -- (-308.213) [-308.646] (-311.748) (-306.625) * (-310.069) (-308.042) (-307.603) [-310.761] -- 0:00:41
47000 -- (-307.147) [-306.755] (-306.876) (-307.161) * (-307.306) [-310.283] (-308.803) (-306.521) -- 0:00:40
47500 -- (-306.741) (-308.567) [-309.515] (-309.573) * (-305.704) (-311.745) (-308.755) [-307.608] -- 0:00:40
48000 -- (-307.650) (-315.699) (-306.989) [-308.053] * (-306.033) (-309.188) (-309.587) [-307.230] -- 0:00:39
48500 -- (-309.796) [-309.586] (-311.561) (-307.474) * [-309.691] (-308.327) (-308.210) (-307.280) -- 0:00:39
49000 -- (-307.044) (-308.455) (-310.113) [-306.405] * (-307.268) (-306.737) (-310.903) [-310.936] -- 0:00:38
49500 -- [-306.689] (-308.070) (-308.111) (-305.666) * (-307.576) (-307.399) (-310.483) [-307.579] -- 0:00:57
50000 -- (-309.004) (-310.057) [-307.683] (-305.958) * (-309.406) (-307.784) [-308.744] (-307.596) -- 0:00:57
Average standard deviation of split frequencies: 0.030703
50500 -- (-310.931) (-308.926) (-308.410) [-305.839] * (-307.262) [-306.270] (-308.539) (-309.473) -- 0:00:56
51000 -- (-308.266) [-309.920] (-308.940) (-305.974) * [-306.559] (-307.848) (-309.081) (-306.979) -- 0:00:55
51500 -- (-307.167) [-309.236] (-315.205) (-306.450) * (-306.998) (-306.620) [-311.382] (-316.036) -- 0:00:55
52000 -- [-309.170] (-310.313) (-308.025) (-306.642) * (-306.208) (-308.973) [-310.439] (-306.679) -- 0:00:54
52500 -- (-307.493) (-306.577) [-310.444] (-308.157) * (-308.581) (-308.657) (-309.551) [-308.336] -- 0:00:54
53000 -- [-306.512] (-307.585) (-307.025) (-309.175) * [-307.317] (-307.407) (-307.434) (-308.192) -- 0:00:53
53500 -- (-309.060) [-308.314] (-307.514) (-307.576) * [-307.411] (-309.561) (-310.888) (-307.666) -- 0:00:53
54000 -- (-306.322) (-308.379) [-306.773] (-307.007) * (-308.447) (-306.114) (-311.159) [-307.051] -- 0:00:52
54500 -- [-306.768] (-311.581) (-307.532) (-307.827) * (-308.502) (-308.933) [-307.015] (-306.852) -- 0:00:52
55000 -- [-310.034] (-307.291) (-308.537) (-307.010) * [-311.278] (-309.115) (-306.719) (-307.161) -- 0:00:51
Average standard deviation of split frequencies: 0.031013
55500 -- (-310.479) [-306.014] (-308.894) (-308.617) * (-307.122) [-310.346] (-307.376) (-307.625) -- 0:00:51
56000 -- (-308.469) (-306.711) [-308.065] (-306.972) * (-307.384) (-308.632) (-305.964) [-306.595] -- 0:00:50
56500 -- (-308.521) (-306.543) [-307.539] (-310.686) * (-311.134) (-309.031) (-306.460) [-306.445] -- 0:00:50
57000 -- (-312.292) (-309.496) [-306.571] (-307.462) * [-307.715] (-307.002) (-307.450) (-306.852) -- 0:00:49
57500 -- (-308.755) (-309.580) [-309.906] (-307.787) * (-308.819) [-308.983] (-307.639) (-307.478) -- 0:00:49
58000 -- (-309.659) (-308.877) (-307.944) [-306.506] * (-307.240) [-308.849] (-308.321) (-308.537) -- 0:00:48
58500 -- (-307.492) [-307.163] (-307.806) (-306.039) * (-308.190) (-308.274) (-306.736) [-307.233] -- 0:00:48
59000 -- (-309.400) (-307.279) (-309.913) [-305.976] * [-306.231] (-308.702) (-307.056) (-309.283) -- 0:00:47
59500 -- (-306.049) (-308.529) [-308.133] (-306.540) * [-306.835] (-305.979) (-307.365) (-306.683) -- 0:00:47
60000 -- [-308.066] (-307.381) (-306.197) (-305.640) * (-308.319) (-305.711) (-308.003) [-306.647] -- 0:00:47
Average standard deviation of split frequencies: 0.028219
60500 -- [-307.128] (-313.215) (-307.430) (-305.858) * [-312.359] (-308.035) (-309.739) (-307.920) -- 0:00:46
61000 -- (-308.723) (-306.846) [-309.789] (-311.222) * (-311.284) (-306.306) [-309.883] (-308.598) -- 0:00:46
61500 -- [-309.183] (-306.567) (-306.275) (-306.854) * (-314.627) (-306.895) (-309.427) [-306.742] -- 0:00:45
62000 -- (-308.647) (-307.508) [-306.638] (-309.472) * (-310.429) [-307.436] (-309.358) (-306.767) -- 0:00:45
62500 -- (-310.316) (-306.341) [-306.299] (-308.396) * [-307.494] (-306.964) (-307.604) (-307.219) -- 0:00:45
63000 -- [-307.526] (-306.605) (-306.099) (-306.826) * (-312.594) [-306.243] (-308.706) (-307.240) -- 0:00:44
63500 -- [-307.134] (-307.893) (-308.023) (-306.600) * (-306.603) (-306.784) [-308.713] (-306.298) -- 0:00:44
64000 -- [-306.630] (-306.798) (-311.331) (-306.818) * (-306.648) (-307.320) (-306.331) [-306.817] -- 0:00:43
64500 -- [-306.955] (-306.560) (-308.117) (-307.389) * (-307.176) (-306.267) [-306.414] (-309.207) -- 0:00:43
65000 -- (-309.309) (-305.945) [-307.358] (-312.710) * [-306.865] (-307.752) (-307.831) (-307.850) -- 0:00:43
Average standard deviation of split frequencies: 0.026070
65500 -- [-310.782] (-306.577) (-307.847) (-309.611) * [-306.432] (-306.707) (-310.377) (-309.299) -- 0:00:42
66000 -- [-310.032] (-305.936) (-306.573) (-306.066) * [-306.566] (-305.679) (-307.294) (-307.834) -- 0:00:42
66500 -- (-312.320) (-307.160) (-309.545) [-305.713] * (-306.985) [-306.218] (-307.609) (-307.876) -- 0:00:56
67000 -- (-311.529) (-313.479) [-306.625] (-307.377) * [-306.770] (-306.531) (-310.890) (-309.144) -- 0:00:55
67500 -- (-308.794) [-308.449] (-310.022) (-307.287) * [-307.403] (-307.378) (-309.492) (-313.863) -- 0:00:55
68000 -- (-309.567) (-306.942) [-306.247] (-309.046) * [-306.703] (-306.356) (-308.467) (-307.987) -- 0:00:54
68500 -- (-306.986) [-307.568] (-307.175) (-310.849) * (-307.258) (-307.029) [-307.362] (-306.906) -- 0:00:54
69000 -- (-309.585) [-307.633] (-310.049) (-309.338) * (-308.472) (-307.374) (-306.323) [-307.972] -- 0:00:53
69500 -- [-307.014] (-316.645) (-308.895) (-307.576) * (-310.723) [-308.931] (-306.620) (-306.848) -- 0:00:53
70000 -- (-307.430) (-306.502) [-306.514] (-309.573) * (-309.490) (-308.432) [-307.844] (-308.423) -- 0:00:53
Average standard deviation of split frequencies: 0.027054
70500 -- (-308.534) [-306.731] (-310.414) (-309.574) * (-310.280) (-306.776) (-307.299) [-306.978] -- 0:00:52
71000 -- (-307.630) [-308.584] (-307.755) (-311.077) * (-309.125) (-309.254) [-309.107] (-306.411) -- 0:00:52
71500 -- (-313.479) (-312.362) [-308.242] (-308.135) * (-309.233) (-307.217) (-309.333) [-307.370] -- 0:00:51
72000 -- (-309.886) (-309.175) (-309.276) [-306.210] * [-309.593] (-307.712) (-306.211) (-307.852) -- 0:00:51
72500 -- (-312.954) (-308.718) (-306.469) [-306.402] * (-309.241) [-307.265] (-306.410) (-307.518) -- 0:00:51
73000 -- (-313.877) (-307.393) (-308.866) [-309.565] * (-308.410) (-307.270) (-307.619) [-307.262] -- 0:00:50
73500 -- (-308.120) (-311.283) (-306.314) [-306.685] * (-306.726) [-306.002] (-307.739) (-306.581) -- 0:00:50
74000 -- (-306.907) (-309.918) (-309.797) [-307.326] * [-307.000] (-309.841) (-309.750) (-306.276) -- 0:00:50
74500 -- [-307.044] (-308.760) (-312.929) (-310.636) * [-306.930] (-307.983) (-308.432) (-307.510) -- 0:00:49
75000 -- [-311.398] (-308.124) (-313.069) (-310.276) * (-307.929) (-307.285) [-306.765] (-306.148) -- 0:00:49
Average standard deviation of split frequencies: 0.026583
75500 -- [-308.588] (-307.240) (-315.934) (-311.353) * [-309.997] (-308.139) (-305.538) (-308.244) -- 0:00:48
76000 -- (-310.301) (-309.097) [-313.273] (-310.706) * [-307.715] (-308.176) (-306.269) (-306.743) -- 0:00:48
76500 -- (-308.348) (-308.380) [-306.712] (-308.836) * (-307.307) (-310.500) [-306.286] (-306.040) -- 0:00:48
77000 -- (-309.591) [-306.803] (-309.503) (-305.990) * (-309.973) (-307.551) [-306.723] (-310.003) -- 0:00:47
77500 -- (-308.808) (-307.310) [-306.836] (-308.254) * (-309.124) (-309.426) [-306.934] (-310.058) -- 0:00:47
78000 -- (-306.122) (-306.107) [-305.839] (-309.120) * [-308.554] (-307.124) (-306.731) (-307.835) -- 0:00:47
78500 -- (-310.034) (-310.698) (-306.648) [-312.722] * (-307.507) [-307.435] (-307.822) (-311.672) -- 0:00:46
79000 -- (-307.198) (-313.383) (-309.456) [-306.451] * (-306.382) [-308.095] (-310.719) (-309.621) -- 0:00:46
79500 -- [-308.744] (-308.290) (-310.421) (-309.080) * (-308.843) (-310.075) (-307.830) [-307.030] -- 0:00:46
80000 -- [-305.941] (-307.005) (-309.113) (-306.148) * [-306.701] (-310.346) (-306.603) (-306.537) -- 0:00:46
Average standard deviation of split frequencies: 0.029834
80500 -- (-314.416) (-306.156) (-309.162) [-306.988] * (-306.752) (-307.525) (-305.925) [-308.447] -- 0:00:45
81000 -- (-308.252) (-306.089) [-306.255] (-309.962) * [-309.930] (-307.608) (-307.093) (-307.085) -- 0:00:45
81500 -- [-307.972] (-307.951) (-306.065) (-314.635) * (-307.933) (-306.749) [-307.214] (-307.972) -- 0:00:45
82000 -- (-308.451) (-307.821) [-307.925] (-307.129) * (-306.132) (-307.088) [-306.533] (-306.615) -- 0:00:44
82500 -- (-308.836) (-309.117) (-308.551) [-308.320] * (-308.177) (-308.537) [-310.509] (-306.994) -- 0:00:44
83000 -- [-307.321] (-307.297) (-308.211) (-308.172) * (-308.194) [-306.428] (-306.943) (-307.403) -- 0:00:44
83500 -- (-309.072) (-308.394) [-311.184] (-306.841) * [-307.853] (-308.598) (-314.410) (-306.368) -- 0:00:54
84000 -- (-307.039) (-306.759) (-317.199) [-307.696] * (-311.544) [-307.797] (-307.850) (-308.824) -- 0:00:54
84500 -- (-310.057) (-307.263) (-309.325) [-306.072] * (-310.988) (-309.602) (-309.177) [-311.984] -- 0:00:54
85000 -- (-307.434) (-308.295) (-308.353) [-306.511] * [-309.235] (-308.339) (-308.630) (-309.622) -- 0:00:53
Average standard deviation of split frequencies: 0.033437
85500 -- (-307.147) [-308.533] (-306.074) (-308.732) * (-308.203) (-311.499) [-306.372] (-311.504) -- 0:00:53
86000 -- [-306.525] (-306.934) (-306.588) (-308.473) * [-308.445] (-316.737) (-309.319) (-308.285) -- 0:00:53
86500 -- (-306.907) [-306.637] (-311.873) (-306.930) * (-306.568) (-311.589) [-309.090] (-307.616) -- 0:00:52
87000 -- [-308.902] (-308.964) (-307.976) (-305.972) * (-306.332) [-309.564] (-308.865) (-307.248) -- 0:00:52
87500 -- (-307.693) (-307.207) (-306.668) [-309.187] * [-307.283] (-307.374) (-309.529) (-309.021) -- 0:00:52
88000 -- (-307.998) (-310.871) [-307.969] (-306.122) * (-311.300) (-308.547) (-310.691) [-313.780] -- 0:00:51
88500 -- (-307.088) [-305.953] (-307.135) (-308.740) * (-313.929) [-306.535] (-307.964) (-309.593) -- 0:00:51
89000 -- (-309.272) (-310.107) (-308.545) [-310.192] * (-306.872) [-308.186] (-307.067) (-306.072) -- 0:00:51
89500 -- (-306.796) (-306.924) [-309.849] (-314.131) * (-308.309) [-306.806] (-306.430) (-308.504) -- 0:00:50
90000 -- (-308.408) [-312.301] (-307.783) (-308.824) * (-309.579) [-310.829] (-309.779) (-307.069) -- 0:00:50
Average standard deviation of split frequencies: 0.029636
90500 -- [-305.840] (-308.013) (-309.279) (-313.421) * (-310.602) (-308.724) (-307.854) [-308.075] -- 0:00:50
91000 -- [-307.082] (-307.046) (-306.375) (-314.017) * (-307.505) (-307.427) [-309.675] (-310.228) -- 0:00:49
91500 -- (-306.991) [-307.068] (-305.631) (-315.310) * (-310.614) (-307.178) [-307.994] (-313.580) -- 0:00:49
92000 -- (-307.813) (-308.131) [-306.709] (-310.005) * (-306.140) (-308.731) [-307.284] (-309.059) -- 0:00:49
92500 -- (-308.541) (-307.885) [-309.327] (-308.747) * (-308.292) (-307.710) [-306.154] (-309.806) -- 0:00:49
93000 -- (-308.394) (-307.213) (-311.888) [-308.503] * (-306.958) (-307.956) [-306.553] (-307.540) -- 0:00:48
93500 -- (-308.511) (-306.601) (-308.157) [-309.289] * (-312.228) (-308.918) [-308.995] (-307.126) -- 0:00:48
94000 -- [-307.039] (-306.050) (-308.070) (-318.025) * [-309.851] (-306.802) (-308.050) (-308.257) -- 0:00:48
94500 -- (-308.131) (-307.762) [-307.033] (-311.979) * (-307.008) (-308.346) [-305.705] (-306.509) -- 0:00:47
95000 -- [-307.124] (-310.029) (-308.190) (-307.854) * [-306.400] (-306.394) (-307.553) (-307.610) -- 0:00:47
Average standard deviation of split frequencies: 0.024552
95500 -- [-308.033] (-309.274) (-308.520) (-306.199) * (-310.764) (-307.641) [-308.391] (-308.879) -- 0:00:47
96000 -- [-307.965] (-306.837) (-307.937) (-308.224) * (-307.870) (-306.360) [-307.676] (-309.057) -- 0:00:47
96500 -- [-307.692] (-306.376) (-308.787) (-310.953) * (-307.565) (-306.067) [-310.882] (-305.798) -- 0:00:46
97000 -- (-309.236) (-306.186) (-307.645) [-311.700] * (-306.606) [-307.899] (-320.194) (-307.938) -- 0:00:46
97500 -- (-314.333) [-307.372] (-307.561) (-310.603) * (-310.379) (-307.057) (-312.860) [-307.620] -- 0:00:46
98000 -- (-307.223) (-307.681) [-307.806] (-309.946) * (-309.182) (-308.363) (-319.979) [-307.888] -- 0:00:46
98500 -- [-309.743] (-305.976) (-311.533) (-309.891) * (-307.031) (-305.885) [-309.323] (-311.239) -- 0:00:45
99000 -- (-309.646) (-308.036) (-306.514) [-310.266] * [-308.709] (-308.045) (-309.217) (-309.235) -- 0:00:45
99500 -- (-309.993) [-309.903] (-308.725) (-308.424) * (-308.301) (-307.416) (-307.014) [-308.262] -- 0:00:45
100000 -- (-308.513) (-309.456) (-306.734) [-307.403] * (-308.342) (-306.896) (-307.228) [-305.915] -- 0:00:45
Average standard deviation of split frequencies: 0.024154
100500 -- (-306.575) (-307.285) [-307.673] (-307.734) * [-307.700] (-306.684) (-306.993) (-307.542) -- 0:00:53
101000 -- (-308.084) [-308.659] (-306.404) (-311.919) * (-309.061) (-310.702) (-310.701) [-310.697] -- 0:00:53
101500 -- (-308.030) (-308.514) (-306.173) [-306.246] * [-309.268] (-310.074) (-307.593) (-309.113) -- 0:00:53
102000 -- (-307.801) (-309.352) [-309.956] (-308.468) * [-307.702] (-307.450) (-307.446) (-310.916) -- 0:00:52
102500 -- (-309.898) (-309.023) (-307.026) [-311.635] * (-308.701) (-309.315) (-312.078) [-307.509] -- 0:00:52
103000 -- [-306.870] (-307.511) (-308.579) (-307.840) * (-306.992) (-309.929) [-310.781] (-310.958) -- 0:00:52
103500 -- [-311.263] (-310.525) (-309.899) (-310.745) * (-308.427) [-310.054] (-308.896) (-311.376) -- 0:00:51
104000 -- (-312.980) (-307.592) [-308.466] (-307.627) * (-308.774) (-309.722) (-310.103) [-309.532] -- 0:00:51
104500 -- (-313.348) (-306.915) [-306.481] (-308.136) * (-307.690) (-309.384) [-310.409] (-307.168) -- 0:00:51
105000 -- [-311.252] (-307.382) (-308.233) (-307.520) * (-309.777) (-306.507) (-307.042) [-306.987] -- 0:00:51
Average standard deviation of split frequencies: 0.025279
105500 -- [-306.847] (-306.627) (-308.831) (-309.151) * (-310.620) (-307.313) (-311.117) [-309.045] -- 0:00:50
106000 -- [-307.490] (-308.165) (-309.699) (-313.036) * (-308.447) (-307.227) [-308.030] (-305.998) -- 0:00:50
106500 -- (-307.841) (-307.885) (-308.890) [-307.414] * (-306.615) (-306.623) [-308.191] (-309.167) -- 0:00:50
107000 -- (-307.341) (-312.271) [-308.187] (-307.719) * [-305.994] (-308.821) (-308.232) (-309.186) -- 0:00:50
107500 -- (-308.576) (-309.353) [-306.038] (-307.873) * (-309.340) (-306.426) [-306.556] (-307.823) -- 0:00:49
108000 -- (-308.001) [-307.143] (-307.835) (-307.884) * (-306.801) (-306.537) (-306.559) [-308.827] -- 0:00:49
108500 -- (-309.867) (-310.063) (-308.917) [-305.792] * (-307.017) (-307.824) (-306.606) [-307.735] -- 0:00:49
109000 -- [-310.745] (-307.470) (-310.274) (-306.921) * (-309.013) (-309.577) [-306.067] (-307.486) -- 0:00:49
109500 -- (-308.886) [-307.056] (-310.647) (-310.958) * (-307.704) [-306.687] (-306.657) (-310.728) -- 0:00:48
110000 -- (-306.836) (-307.198) (-308.712) [-307.708] * [-308.611] (-310.168) (-307.025) (-309.470) -- 0:00:48
Average standard deviation of split frequencies: 0.023540
110500 -- (-308.064) (-306.738) [-307.969] (-305.704) * (-307.975) (-307.607) [-309.581] (-306.722) -- 0:00:48
111000 -- (-308.354) (-307.231) [-306.958] (-309.091) * (-311.844) (-308.364) (-306.921) [-307.556] -- 0:00:48
111500 -- (-311.606) (-312.006) (-307.072) [-307.584] * (-306.960) (-307.415) [-307.927] (-306.326) -- 0:00:47
112000 -- (-311.367) (-307.592) [-309.389] (-306.729) * [-307.008] (-310.549) (-306.188) (-309.124) -- 0:00:47
112500 -- [-308.734] (-308.879) (-307.104) (-312.609) * [-305.979] (-307.135) (-306.320) (-311.182) -- 0:00:47
113000 -- (-305.534) (-307.238) (-310.351) [-311.175] * (-310.263) (-308.752) [-308.784] (-313.121) -- 0:00:47
113500 -- [-307.774] (-308.605) (-308.391) (-308.459) * (-308.146) [-307.305] (-307.828) (-308.920) -- 0:00:46
114000 -- [-308.076] (-306.852) (-310.530) (-307.077) * (-307.802) [-306.162] (-309.559) (-307.764) -- 0:00:46
114500 -- (-307.339) [-308.622] (-309.113) (-308.070) * (-309.541) [-306.453] (-306.508) (-307.994) -- 0:00:46
115000 -- [-307.604] (-307.952) (-315.411) (-307.009) * (-309.846) (-305.842) [-306.845] (-307.613) -- 0:00:46
Average standard deviation of split frequencies: 0.020105
115500 -- [-308.409] (-306.895) (-308.139) (-307.987) * (-307.701) (-307.066) [-307.085] (-309.376) -- 0:00:45
116000 -- (-307.424) [-306.226] (-309.170) (-307.178) * (-307.478) (-307.878) [-306.474] (-309.032) -- 0:00:45
116500 -- [-308.876] (-309.421) (-309.700) (-306.173) * [-310.729] (-306.683) (-311.065) (-309.644) -- 0:00:45
117000 -- (-309.857) (-306.676) [-310.984] (-307.864) * (-309.452) (-306.475) [-308.052] (-307.088) -- 0:00:45
117500 -- (-314.385) [-309.218] (-308.585) (-306.025) * (-306.123) (-305.912) [-306.474] (-310.728) -- 0:00:52
118000 -- [-307.134] (-307.732) (-308.504) (-305.956) * (-309.857) [-307.988] (-309.619) (-307.784) -- 0:00:52
118500 -- [-307.191] (-306.594) (-309.261) (-312.295) * (-310.784) (-305.984) (-306.802) [-310.108] -- 0:00:52
119000 -- (-308.195) [-307.099] (-310.266) (-308.829) * [-306.809] (-305.659) (-307.186) (-306.281) -- 0:00:51
119500 -- (-306.413) (-308.538) (-311.712) [-310.154] * (-306.855) (-311.829) (-308.956) [-306.348] -- 0:00:51
120000 -- (-309.680) [-308.263] (-308.640) (-310.359) * [-308.616] (-309.270) (-311.144) (-307.335) -- 0:00:51
Average standard deviation of split frequencies: 0.020356
120500 -- (-313.001) (-308.074) (-309.589) [-313.133] * (-306.638) [-305.758] (-306.589) (-306.490) -- 0:00:51
121000 -- (-308.570) (-308.461) (-310.305) [-314.433] * (-307.384) (-306.536) (-306.458) [-308.081] -- 0:00:50
121500 -- (-307.165) (-309.328) (-307.528) [-307.105] * [-307.807] (-311.276) (-306.015) (-310.376) -- 0:00:50
122000 -- (-314.371) (-307.565) [-306.458] (-306.858) * (-309.260) [-305.969] (-306.424) (-306.453) -- 0:00:50
122500 -- (-305.584) (-308.889) [-307.056] (-308.383) * (-314.567) (-307.023) (-306.462) [-307.053] -- 0:00:50
123000 -- (-306.146) (-310.758) (-310.556) [-308.050] * (-313.535) (-309.519) (-306.681) [-306.714] -- 0:00:49
123500 -- (-312.994) (-310.364) [-309.640] (-310.677) * (-311.725) [-308.101] (-308.438) (-311.223) -- 0:00:49
124000 -- (-307.405) (-309.891) (-307.018) [-306.608] * (-309.791) [-306.134] (-307.440) (-311.708) -- 0:00:49
124500 -- [-312.048] (-307.629) (-306.081) (-307.598) * (-307.557) (-307.442) [-307.033] (-308.146) -- 0:00:49
125000 -- (-306.571) [-306.910] (-306.760) (-307.617) * [-307.556] (-306.643) (-311.891) (-309.833) -- 0:00:49
Average standard deviation of split frequencies: 0.018332
125500 -- (-309.856) (-309.665) [-306.151] (-307.872) * (-309.759) [-310.769] (-307.997) (-305.824) -- 0:00:48
126000 -- (-309.974) [-308.450] (-306.177) (-307.517) * [-307.135] (-306.327) (-306.337) (-307.049) -- 0:00:48
126500 -- (-306.790) [-306.763] (-306.908) (-306.529) * [-308.461] (-308.464) (-310.928) (-312.223) -- 0:00:48
127000 -- (-308.416) (-306.018) (-305.989) [-309.195] * (-308.470) [-306.531] (-306.771) (-306.215) -- 0:00:48
127500 -- (-306.594) (-309.294) (-306.546) [-307.565] * [-307.172] (-306.713) (-306.416) (-307.124) -- 0:00:47
128000 -- (-312.576) [-306.246] (-308.145) (-308.121) * [-307.318] (-306.972) (-305.896) (-306.323) -- 0:00:47
128500 -- (-307.419) (-310.969) [-306.840] (-306.845) * (-308.481) [-310.297] (-308.901) (-310.049) -- 0:00:47
129000 -- (-308.625) [-308.884] (-306.854) (-308.089) * (-308.991) [-310.718] (-308.228) (-312.732) -- 0:00:47
129500 -- (-309.764) [-308.129] (-307.961) (-308.958) * [-306.469] (-306.993) (-308.163) (-308.286) -- 0:00:47
130000 -- [-308.826] (-305.522) (-306.884) (-312.380) * (-306.893) (-306.905) [-307.420] (-309.990) -- 0:00:46
Average standard deviation of split frequencies: 0.019178
130500 -- (-307.573) [-306.332] (-306.018) (-309.777) * [-306.372] (-309.331) (-305.628) (-308.818) -- 0:00:46
131000 -- (-310.404) [-306.419] (-308.317) (-312.841) * (-310.107) (-307.685) [-306.874] (-306.840) -- 0:00:46
131500 -- (-313.464) [-307.844] (-307.439) (-311.950) * (-312.229) (-308.500) (-307.615) [-307.062] -- 0:00:46
132000 -- (-307.744) [-307.064] (-309.911) (-309.056) * (-308.710) (-306.389) [-308.581] (-307.525) -- 0:00:46
132500 -- (-306.525) (-307.070) (-307.090) [-306.409] * (-307.390) [-307.862] (-309.279) (-307.331) -- 0:00:45
133000 -- (-310.604) (-307.091) (-307.588) [-306.905] * [-305.855] (-307.191) (-308.695) (-307.240) -- 0:00:45
133500 -- [-307.796] (-307.339) (-306.995) (-308.283) * [-307.354] (-307.459) (-307.181) (-309.769) -- 0:00:45
134000 -- (-309.226) [-305.540] (-308.930) (-307.580) * (-306.852) [-306.916] (-305.856) (-307.892) -- 0:00:45
134500 -- (-307.130) (-307.925) [-308.809] (-308.951) * (-306.215) [-311.175] (-306.874) (-308.632) -- 0:00:51
135000 -- (-310.245) [-308.175] (-308.583) (-310.067) * (-307.549) [-306.838] (-306.669) (-308.707) -- 0:00:51
Average standard deviation of split frequencies: 0.018371
135500 -- (-307.481) (-306.741) (-308.536) [-308.665] * [-306.236] (-308.146) (-308.834) (-308.308) -- 0:00:51
136000 -- [-306.604] (-308.527) (-309.285) (-308.098) * (-307.444) (-307.161) (-309.035) [-307.738] -- 0:00:50
136500 -- (-308.149) (-308.017) (-307.421) [-306.804] * (-306.108) (-307.090) [-306.274] (-308.722) -- 0:00:50
137000 -- [-306.289] (-307.540) (-308.743) (-308.383) * [-308.456] (-307.831) (-306.879) (-306.046) -- 0:00:50
137500 -- [-307.276] (-309.063) (-309.913) (-308.918) * (-307.060) [-307.072] (-308.546) (-306.527) -- 0:00:50
138000 -- [-306.049] (-307.508) (-315.535) (-308.250) * (-307.775) (-309.756) [-310.169] (-306.009) -- 0:00:49
138500 -- (-306.037) (-308.160) [-308.266] (-307.409) * [-307.406] (-307.668) (-306.515) (-308.361) -- 0:00:49
139000 -- [-308.498] (-306.744) (-306.413) (-309.598) * (-312.316) (-307.632) (-310.354) [-306.250] -- 0:00:49
139500 -- (-306.809) (-307.603) (-307.318) [-307.705] * [-311.011] (-309.138) (-309.023) (-311.426) -- 0:00:49
140000 -- (-305.935) [-308.865] (-306.732) (-306.205) * [-308.694] (-307.882) (-309.750) (-307.610) -- 0:00:49
Average standard deviation of split frequencies: 0.016756
140500 -- (-310.586) (-306.826) [-309.130] (-306.138) * [-307.975] (-308.511) (-307.590) (-308.067) -- 0:00:48
141000 -- (-308.959) (-310.663) [-306.398] (-307.102) * (-307.042) (-312.171) [-307.542] (-306.523) -- 0:00:48
141500 -- (-311.506) (-307.175) (-308.690) [-306.106] * (-306.297) (-309.040) [-308.516] (-307.148) -- 0:00:48
142000 -- [-311.799] (-306.477) (-309.506) (-305.426) * (-307.407) (-307.838) (-309.051) [-306.688] -- 0:00:48
142500 -- (-311.508) [-308.102] (-306.556) (-306.160) * (-305.716) (-308.457) [-306.672] (-309.029) -- 0:00:48
143000 -- (-308.474) (-307.350) [-308.734] (-309.228) * (-306.536) (-307.149) [-307.284] (-308.203) -- 0:00:47
143500 -- (-306.217) [-306.480] (-306.657) (-310.739) * (-308.017) (-307.914) (-306.176) [-309.706] -- 0:00:47
144000 -- (-309.094) (-309.509) (-307.289) [-309.611] * (-309.937) (-309.299) (-306.085) [-311.029] -- 0:00:47
144500 -- (-307.146) [-308.748] (-308.515) (-307.645) * [-311.875] (-308.512) (-308.881) (-307.832) -- 0:00:47
145000 -- (-309.300) (-306.327) (-307.559) [-309.648] * (-311.265) (-307.326) [-306.188] (-309.894) -- 0:00:47
Average standard deviation of split frequencies: 0.018523
145500 -- (-307.209) (-307.054) (-307.033) [-308.499] * (-309.788) (-306.301) [-307.748] (-306.107) -- 0:00:46
146000 -- (-312.755) (-311.615) (-307.781) [-311.069] * [-307.985] (-306.435) (-307.376) (-310.234) -- 0:00:46
146500 -- (-306.415) (-309.291) (-309.652) [-307.482] * (-306.160) [-307.903] (-309.032) (-309.094) -- 0:00:46
147000 -- [-306.769] (-306.147) (-310.070) (-308.925) * [-306.714] (-308.279) (-313.379) (-306.182) -- 0:00:46
147500 -- (-307.913) [-306.642] (-306.870) (-309.489) * [-308.284] (-309.432) (-308.501) (-306.126) -- 0:00:46
148000 -- (-306.820) (-307.029) (-307.560) [-307.332] * (-307.249) (-308.022) [-308.325] (-311.997) -- 0:00:46
148500 -- (-305.937) [-307.407] (-306.773) (-307.087) * (-308.313) [-308.436] (-306.514) (-310.547) -- 0:00:45
149000 -- [-305.762] (-306.392) (-307.417) (-317.248) * (-307.143) [-307.253] (-308.882) (-309.667) -- 0:00:45
149500 -- (-307.970) (-306.736) (-310.430) [-308.850] * (-309.173) [-307.322] (-312.073) (-306.911) -- 0:00:45
150000 -- (-307.773) [-310.706] (-311.784) (-305.777) * (-306.946) [-309.176] (-310.330) (-307.958) -- 0:00:45
Average standard deviation of split frequencies: 0.019399
150500 -- (-306.720) (-310.885) (-309.139) [-310.705] * (-309.643) [-308.946] (-309.013) (-313.363) -- 0:00:45
151000 -- (-306.933) (-308.950) (-308.502) [-307.262] * [-310.490] (-307.416) (-310.374) (-308.716) -- 0:00:50
151500 -- [-311.333] (-306.339) (-305.422) (-308.896) * (-306.260) (-311.836) [-312.529] (-309.276) -- 0:00:50
152000 -- (-309.844) (-307.783) [-306.285] (-306.951) * (-306.259) [-308.148] (-310.713) (-307.791) -- 0:00:50
152500 -- (-308.179) [-306.658] (-308.652) (-309.038) * (-309.395) (-309.148) [-307.983] (-308.772) -- 0:00:50
153000 -- (-306.541) (-307.983) (-306.194) [-307.593] * (-312.893) (-307.643) (-306.969) [-308.144] -- 0:00:49
153500 -- (-310.507) [-309.095] (-309.953) (-306.107) * [-306.921] (-307.707) (-308.966) (-306.041) -- 0:00:49
154000 -- (-310.001) [-308.411] (-306.075) (-307.082) * [-306.298] (-309.510) (-309.949) (-307.660) -- 0:00:49
154500 -- (-307.398) (-306.489) [-311.314] (-307.277) * (-305.483) (-305.867) [-308.216] (-308.335) -- 0:00:49
155000 -- (-306.422) (-309.544) [-308.630] (-307.303) * (-306.148) (-307.612) [-305.709] (-308.018) -- 0:00:49
Average standard deviation of split frequencies: 0.019810
155500 -- (-307.773) (-308.749) (-307.745) [-306.569] * [-306.734] (-309.226) (-307.638) (-307.853) -- 0:00:48
156000 -- (-307.374) [-307.874] (-307.346) (-309.064) * (-307.183) (-308.326) [-306.739] (-310.879) -- 0:00:48
156500 -- [-309.068] (-307.136) (-307.075) (-307.886) * (-311.460) [-307.508] (-307.692) (-308.198) -- 0:00:48
157000 -- (-307.597) (-306.831) (-307.857) [-307.080] * (-306.225) (-309.437) [-307.380] (-311.122) -- 0:00:48
157500 -- (-307.681) (-306.678) [-308.182] (-307.198) * (-308.691) [-308.189] (-310.438) (-311.504) -- 0:00:48
158000 -- [-308.989] (-310.607) (-306.933) (-307.147) * (-308.831) (-309.212) [-306.890] (-307.886) -- 0:00:47
158500 -- (-307.900) (-306.486) (-307.807) [-309.064] * (-307.939) (-311.833) [-306.677] (-305.801) -- 0:00:47
159000 -- [-307.695] (-309.282) (-310.923) (-307.825) * (-312.281) (-306.156) [-307.891] (-305.797) -- 0:00:47
159500 -- (-311.628) (-308.668) (-307.802) [-308.532] * (-315.208) (-307.768) (-307.087) [-308.560] -- 0:00:47
160000 -- [-309.345] (-309.649) (-311.888) (-306.720) * (-306.018) (-308.057) (-306.119) [-306.585] -- 0:00:47
Average standard deviation of split frequencies: 0.018812
160500 -- (-309.466) (-310.881) [-307.976] (-306.945) * (-308.015) (-309.623) (-305.949) [-307.587] -- 0:00:47
161000 -- (-306.346) (-306.995) [-309.425] (-306.168) * [-311.643] (-311.010) (-306.584) (-307.657) -- 0:00:46
161500 -- (-309.246) [-309.570] (-310.425) (-307.138) * (-307.369) (-308.575) (-308.267) [-305.857] -- 0:00:46
162000 -- [-306.568] (-306.727) (-306.866) (-309.941) * (-308.663) (-308.639) (-310.503) [-308.143] -- 0:00:46
162500 -- (-308.566) (-307.737) [-308.644] (-307.651) * (-307.218) (-308.713) [-306.873] (-307.229) -- 0:00:46
163000 -- (-307.689) (-307.136) (-306.869) [-307.087] * (-307.566) [-307.410] (-306.543) (-310.205) -- 0:00:46
163500 -- (-305.574) (-310.471) (-310.839) [-306.286] * (-307.710) [-309.744] (-309.002) (-306.300) -- 0:00:46
164000 -- [-306.838] (-311.621) (-307.225) (-308.834) * (-310.620) (-308.241) (-306.978) [-306.715] -- 0:00:45
164500 -- (-307.013) (-309.140) [-308.234] (-310.978) * [-306.848] (-307.352) (-308.458) (-307.000) -- 0:00:45
165000 -- (-307.619) (-309.606) (-308.522) [-308.255] * (-310.143) (-306.813) (-309.663) [-307.645] -- 0:00:45
Average standard deviation of split frequencies: 0.018301
165500 -- (-305.788) [-307.268] (-306.526) (-307.234) * (-307.164) [-305.886] (-306.481) (-308.066) -- 0:00:45
166000 -- [-307.656] (-306.555) (-308.560) (-308.573) * [-307.248] (-307.110) (-315.035) (-306.426) -- 0:00:45
166500 -- (-306.484) (-305.521) (-307.753) [-306.487] * (-308.326) (-308.469) [-307.978] (-309.361) -- 0:00:45
167000 -- (-307.279) (-306.861) [-306.581] (-305.906) * [-308.000] (-308.919) (-307.643) (-307.216) -- 0:00:44
167500 -- [-310.700] (-306.169) (-307.264) (-306.082) * [-307.335] (-307.365) (-309.222) (-308.675) -- 0:00:44
168000 -- (-307.018) (-308.668) (-306.952) [-308.112] * (-306.525) (-306.445) [-307.139] (-307.046) -- 0:00:49
168500 -- (-306.834) (-307.680) (-310.778) [-307.081] * (-310.703) (-314.286) (-306.309) [-308.400] -- 0:00:49
169000 -- (-308.015) (-306.770) (-309.315) [-308.328] * (-306.279) [-308.264] (-306.308) (-308.701) -- 0:00:49
169500 -- (-306.647) [-306.489] (-314.148) (-309.107) * (-311.359) [-307.188] (-306.723) (-308.904) -- 0:00:48
170000 -- [-308.496] (-306.835) (-308.370) (-309.538) * (-313.041) (-313.688) (-307.678) [-306.434] -- 0:00:48
Average standard deviation of split frequencies: 0.017494
170500 -- [-308.117] (-308.289) (-308.295) (-307.670) * [-305.676] (-309.263) (-306.701) (-307.894) -- 0:00:48
171000 -- (-306.125) [-310.310] (-307.723) (-309.772) * (-308.618) (-308.947) [-307.903] (-305.553) -- 0:00:48
171500 -- (-307.392) (-308.453) (-311.124) [-311.843] * (-309.202) (-308.904) [-307.073] (-307.092) -- 0:00:48
172000 -- (-306.475) (-306.963) (-308.704) [-307.507] * (-311.537) [-308.827] (-306.617) (-306.816) -- 0:00:48
172500 -- (-308.700) [-307.834] (-309.133) (-307.250) * (-307.462) (-305.726) [-306.137] (-307.612) -- 0:00:47
173000 -- (-307.139) (-307.005) (-308.311) [-307.451] * (-306.334) [-306.708] (-309.825) (-308.863) -- 0:00:47
173500 -- (-308.981) (-308.123) (-308.343) [-309.341] * (-307.414) [-308.620] (-307.354) (-309.386) -- 0:00:47
174000 -- [-308.479] (-309.821) (-306.481) (-307.678) * (-307.960) (-306.247) [-306.623] (-309.239) -- 0:00:47
174500 -- (-312.898) [-306.770] (-309.064) (-308.250) * (-308.631) [-305.885] (-307.723) (-308.676) -- 0:00:47
175000 -- (-310.186) [-306.904] (-306.762) (-307.665) * (-310.702) (-306.907) (-310.979) [-309.965] -- 0:00:47
Average standard deviation of split frequencies: 0.017559
175500 -- [-310.206] (-307.114) (-308.655) (-308.890) * (-307.009) [-306.125] (-311.615) (-307.883) -- 0:00:46
176000 -- (-307.531) (-306.181) (-307.420) [-307.726] * (-308.955) (-308.069) (-313.651) [-306.033] -- 0:00:46
176500 -- (-308.584) (-308.316) (-310.391) [-310.104] * [-311.353] (-307.927) (-310.837) (-306.370) -- 0:00:46
177000 -- (-307.258) (-307.459) [-310.257] (-309.546) * (-306.057) (-306.315) [-306.276] (-309.330) -- 0:00:46
177500 -- (-306.995) (-306.521) (-306.522) [-309.732] * (-309.287) (-309.249) [-306.549] (-310.558) -- 0:00:46
178000 -- (-308.299) [-305.839] (-307.350) (-310.370) * (-306.529) [-308.337] (-308.991) (-310.027) -- 0:00:46
178500 -- (-308.880) [-311.433] (-306.634) (-311.708) * (-308.947) (-307.202) (-308.207) [-306.571] -- 0:00:46
179000 -- (-307.309) (-312.984) (-308.075) [-308.098] * (-308.678) (-310.436) (-306.320) [-307.952] -- 0:00:45
179500 -- [-305.681] (-312.627) (-310.115) (-306.897) * (-306.000) [-306.523] (-306.452) (-307.388) -- 0:00:45
180000 -- [-307.345] (-308.641) (-307.969) (-307.193) * (-308.863) (-311.827) [-307.431] (-305.986) -- 0:00:45
Average standard deviation of split frequencies: 0.017105
180500 -- (-309.199) (-311.048) (-307.391) [-305.778] * (-310.700) (-310.590) [-307.491] (-305.755) -- 0:00:45
181000 -- (-307.000) (-308.360) [-307.223] (-308.537) * [-308.798] (-309.668) (-308.785) (-306.307) -- 0:00:45
181500 -- (-309.619) (-309.957) [-306.253] (-307.584) * (-309.664) (-307.092) [-310.664] (-309.764) -- 0:00:45
182000 -- [-305.796] (-308.505) (-311.708) (-306.677) * (-309.357) [-307.471] (-306.442) (-311.362) -- 0:00:44
182500 -- [-307.153] (-313.519) (-306.819) (-307.646) * [-307.049] (-309.526) (-306.898) (-310.810) -- 0:00:44
183000 -- (-306.398) [-309.199] (-307.332) (-310.878) * [-309.071] (-308.117) (-308.611) (-307.892) -- 0:00:44
183500 -- [-309.902] (-309.459) (-307.863) (-306.411) * (-307.943) (-312.500) [-308.434] (-306.197) -- 0:00:44
184000 -- (-308.078) (-308.148) (-308.895) [-311.011] * [-305.632] (-306.880) (-312.434) (-306.052) -- 0:00:44
184500 -- (-308.174) (-306.453) [-308.925] (-311.050) * (-307.846) [-306.545] (-306.196) (-309.320) -- 0:00:44
185000 -- (-306.014) [-305.928] (-311.441) (-307.710) * [-307.100] (-306.507) (-309.150) (-306.904) -- 0:00:44
Average standard deviation of split frequencies: 0.015629
185500 -- [-310.075] (-307.395) (-309.213) (-311.710) * (-306.339) (-305.804) [-309.622] (-308.303) -- 0:00:48
186000 -- (-306.710) (-310.563) (-307.012) [-309.978] * (-306.793) (-306.583) (-312.978) [-310.046] -- 0:00:48
186500 -- (-308.553) [-308.425] (-307.944) (-306.567) * (-307.027) [-309.986] (-308.256) (-309.993) -- 0:00:47
187000 -- (-309.646) (-308.207) [-307.328] (-306.830) * (-309.135) (-305.815) [-311.552] (-307.115) -- 0:00:47
187500 -- (-310.920) (-308.186) (-308.449) [-306.596] * (-308.108) [-307.611] (-309.797) (-306.616) -- 0:00:47
188000 -- (-306.479) (-310.740) (-309.208) [-306.730] * (-307.135) (-306.382) (-308.644) [-307.367] -- 0:00:47
188500 -- (-310.094) (-308.173) [-307.277] (-309.073) * (-311.022) (-313.957) [-307.907] (-308.748) -- 0:00:47
189000 -- (-311.752) (-307.309) (-306.773) [-308.796] * (-306.856) (-309.710) [-307.933] (-309.091) -- 0:00:47
189500 -- [-308.868] (-307.901) (-307.992) (-306.152) * [-307.488] (-306.995) (-306.517) (-309.855) -- 0:00:47
190000 -- (-311.214) (-307.469) [-305.829] (-309.896) * (-306.760) (-306.907) [-305.982] (-310.956) -- 0:00:46
Average standard deviation of split frequencies: 0.015875
190500 -- (-313.162) (-308.135) [-306.993] (-307.610) * [-306.691] (-306.823) (-306.518) (-310.821) -- 0:00:46
191000 -- (-313.146) (-310.647) [-306.928] (-307.625) * [-306.925] (-308.653) (-311.467) (-311.229) -- 0:00:46
191500 -- (-306.742) (-311.920) (-308.697) [-308.568] * (-310.407) (-307.770) [-309.932] (-306.742) -- 0:00:46
192000 -- [-305.964] (-314.645) (-309.688) (-310.320) * (-311.998) (-308.621) (-313.139) [-308.846] -- 0:00:46
192500 -- (-307.349) (-311.641) [-308.613] (-309.983) * (-306.416) [-306.723] (-314.246) (-306.754) -- 0:00:46
193000 -- (-308.198) [-310.566] (-308.584) (-311.645) * (-308.462) (-312.035) (-307.534) [-308.407] -- 0:00:45
193500 -- (-309.612) (-306.301) (-306.418) [-307.013] * (-307.595) [-307.225] (-307.086) (-309.032) -- 0:00:45
194000 -- (-307.071) [-307.523] (-306.592) (-309.809) * (-307.428) (-308.226) [-306.488] (-308.146) -- 0:00:45
194500 -- (-309.733) (-309.052) (-309.419) [-306.519] * [-306.836] (-307.232) (-306.717) (-308.572) -- 0:00:45
195000 -- (-309.432) [-306.985] (-307.379) (-310.290) * (-306.522) (-307.245) (-307.108) [-306.530] -- 0:00:45
Average standard deviation of split frequencies: 0.015500
195500 -- [-307.120] (-307.144) (-305.789) (-310.329) * [-309.332] (-306.473) (-307.956) (-308.395) -- 0:00:45
196000 -- (-307.661) (-306.545) [-310.141] (-309.625) * (-307.605) [-306.602] (-307.663) (-307.528) -- 0:00:45
196500 -- (-310.690) [-307.036] (-308.349) (-311.520) * [-306.846] (-308.891) (-306.392) (-307.309) -- 0:00:44
197000 -- (-306.972) (-306.007) [-309.508] (-310.153) * [-307.354] (-310.787) (-306.597) (-306.577) -- 0:00:44
197500 -- (-307.421) (-306.197) [-309.057] (-306.504) * [-308.789] (-308.609) (-308.602) (-307.753) -- 0:00:44
198000 -- (-307.458) [-307.106] (-306.724) (-307.320) * [-307.502] (-307.686) (-310.112) (-306.768) -- 0:00:44
198500 -- (-314.379) [-310.195] (-306.762) (-309.991) * (-308.258) (-311.082) (-309.380) [-307.939] -- 0:00:44
199000 -- (-307.205) (-307.729) [-307.212] (-310.114) * (-306.374) (-308.668) [-306.974] (-309.742) -- 0:00:44
199500 -- (-307.052) (-306.340) (-307.969) [-309.919] * (-307.456) [-309.600] (-309.545) (-307.458) -- 0:00:44
200000 -- [-306.865] (-307.357) (-312.222) (-310.443) * (-305.843) (-309.660) [-311.323] (-310.135) -- 0:00:44
Average standard deviation of split frequencies: 0.016183
200500 -- (-308.522) (-306.959) [-307.682] (-307.059) * (-306.688) (-311.558) [-306.853] (-309.524) -- 0:00:43
201000 -- (-306.850) (-307.505) (-308.046) [-306.965] * (-308.097) (-306.409) [-307.089] (-305.944) -- 0:00:43
201500 -- (-309.295) (-308.802) (-310.673) [-307.663] * [-307.606] (-307.943) (-306.349) (-306.210) -- 0:00:43
202000 -- (-308.777) [-307.032] (-309.290) (-306.568) * (-308.505) (-311.471) (-312.645) [-307.544] -- 0:00:43
202500 -- (-306.053) (-307.012) [-308.980] (-312.593) * [-306.195] (-308.725) (-308.727) (-306.601) -- 0:00:47
203000 -- (-309.404) [-306.522] (-308.708) (-308.219) * (-306.247) (-307.650) [-307.410] (-309.081) -- 0:00:47
203500 -- [-308.842] (-305.924) (-306.202) (-307.030) * (-308.083) (-306.998) (-307.537) [-307.962] -- 0:00:46
204000 -- (-307.866) (-308.415) (-305.676) [-314.190] * [-306.496] (-307.307) (-308.619) (-306.278) -- 0:00:46
204500 -- (-310.629) (-308.810) [-309.728] (-309.210) * (-306.818) (-311.544) [-307.464] (-308.962) -- 0:00:46
205000 -- [-306.823] (-310.345) (-309.116) (-309.318) * (-306.906) (-307.742) (-310.726) [-307.910] -- 0:00:46
Average standard deviation of split frequencies: 0.016781
205500 -- (-308.476) [-308.160] (-306.550) (-305.926) * (-309.803) (-307.790) [-313.029] (-312.245) -- 0:00:46
206000 -- (-307.809) [-306.370] (-306.396) (-308.856) * (-309.724) [-311.704] (-310.609) (-308.265) -- 0:00:46
206500 -- (-309.907) (-305.894) [-306.813] (-308.625) * [-307.206] (-311.099) (-311.145) (-307.034) -- 0:00:46
207000 -- [-309.157] (-306.094) (-308.749) (-312.255) * (-309.113) (-308.053) (-311.046) [-307.719] -- 0:00:45
207500 -- (-307.162) (-308.830) [-307.225] (-315.262) * (-310.705) (-309.302) [-307.234] (-309.864) -- 0:00:45
208000 -- (-309.936) (-305.677) [-307.904] (-308.627) * (-306.596) (-310.522) [-308.612] (-306.583) -- 0:00:45
208500 -- (-307.257) (-306.781) (-309.540) [-307.391] * (-306.934) (-306.876) [-310.387] (-306.599) -- 0:00:45
209000 -- [-306.550] (-309.028) (-306.570) (-306.907) * (-306.144) (-307.642) [-309.953] (-306.966) -- 0:00:45
209500 -- [-306.241] (-311.677) (-309.494) (-306.781) * [-306.696] (-314.513) (-310.703) (-308.066) -- 0:00:45
210000 -- (-310.714) (-305.745) (-309.850) [-305.844] * (-306.271) [-307.292] (-309.629) (-313.202) -- 0:00:45
Average standard deviation of split frequencies: 0.017156
210500 -- (-310.937) (-306.376) (-312.452) [-306.735] * (-307.007) (-307.303) [-306.625] (-309.993) -- 0:00:45
211000 -- (-307.939) (-308.085) [-307.483] (-307.698) * (-308.152) [-309.659] (-308.919) (-306.868) -- 0:00:44
211500 -- (-308.475) (-310.823) [-307.334] (-308.494) * (-307.779) (-306.297) (-308.673) [-307.884] -- 0:00:44
212000 -- (-308.094) (-307.399) [-305.784] (-308.937) * (-306.841) [-306.787] (-311.978) (-308.458) -- 0:00:44
212500 -- (-307.005) (-306.380) [-305.797] (-311.547) * (-308.495) (-306.669) (-307.821) [-308.141] -- 0:00:44
213000 -- [-306.764] (-305.848) (-308.157) (-309.920) * [-308.343] (-308.273) (-310.708) (-307.198) -- 0:00:44
213500 -- (-310.017) (-307.235) (-306.968) [-307.018] * (-306.410) (-306.223) (-307.046) [-308.443] -- 0:00:44
214000 -- [-307.128] (-307.949) (-307.895) (-310.122) * (-306.900) (-306.401) [-310.361] (-307.697) -- 0:00:44
214500 -- [-306.278] (-307.164) (-308.527) (-306.250) * [-305.966] (-310.144) (-305.932) (-308.930) -- 0:00:43
215000 -- (-313.415) [-306.961] (-307.028) (-306.033) * [-307.738] (-308.358) (-308.732) (-308.213) -- 0:00:43
Average standard deviation of split frequencies: 0.018793
215500 -- (-307.549) [-308.085] (-309.164) (-306.599) * (-309.478) (-309.722) [-309.021] (-306.739) -- 0:00:43
216000 -- (-305.970) (-313.015) [-309.188] (-305.758) * (-307.306) (-308.438) (-306.641) [-307.626] -- 0:00:43
216500 -- (-306.574) (-308.967) (-306.601) [-307.832] * (-307.843) [-307.247] (-309.265) (-307.571) -- 0:00:43
217000 -- (-309.360) [-309.498] (-308.740) (-306.860) * (-308.438) (-307.607) [-307.321] (-309.887) -- 0:00:43
217500 -- (-308.472) [-308.168] (-308.496) (-311.549) * [-310.927] (-308.031) (-306.965) (-311.190) -- 0:00:43
218000 -- (-310.964) (-311.270) (-308.071) [-309.276] * (-307.724) (-310.974) [-309.442] (-309.532) -- 0:00:43
218500 -- (-307.305) (-307.819) [-307.042] (-306.446) * (-308.144) (-307.365) (-308.589) [-306.489] -- 0:00:42
219000 -- [-306.524] (-307.171) (-306.407) (-306.237) * [-309.550] (-306.932) (-306.976) (-307.362) -- 0:00:42
219500 -- (-308.542) [-306.318] (-306.645) (-307.422) * (-310.641) (-311.811) (-307.291) [-306.108] -- 0:00:46
220000 -- (-306.120) (-306.628) [-307.713] (-307.054) * (-309.577) [-307.399] (-306.982) (-308.111) -- 0:00:46
Average standard deviation of split frequencies: 0.018327
220500 -- (-307.252) (-313.970) [-308.001] (-307.656) * (-311.399) (-307.602) (-308.714) [-307.433] -- 0:00:45
221000 -- [-307.772] (-307.340) (-310.821) (-307.591) * [-307.521] (-309.532) (-308.206) (-310.388) -- 0:00:45
221500 -- (-308.905) [-307.593] (-309.019) (-305.823) * (-310.083) (-307.868) (-309.740) [-309.905] -- 0:00:45
222000 -- (-308.208) [-306.273] (-309.010) (-312.828) * [-307.490] (-306.618) (-306.635) (-309.480) -- 0:00:45
222500 -- [-307.388] (-306.045) (-311.490) (-310.810) * (-306.810) (-309.696) (-307.126) [-307.082] -- 0:00:45
223000 -- (-307.425) (-316.296) [-310.894] (-311.353) * (-306.278) (-308.256) [-306.910] (-306.987) -- 0:00:45
223500 -- (-307.877) [-307.998] (-312.511) (-308.052) * [-307.638] (-308.170) (-306.447) (-308.617) -- 0:00:45
224000 -- (-308.537) (-319.066) [-310.302] (-306.142) * (-307.791) [-308.466] (-307.775) (-308.826) -- 0:00:45
224500 -- (-309.338) (-308.956) [-310.834] (-306.529) * (-309.860) (-309.173) (-306.517) [-308.427] -- 0:00:44
225000 -- [-305.808] (-307.142) (-308.001) (-308.668) * (-309.099) (-306.601) (-308.156) [-306.163] -- 0:00:44
Average standard deviation of split frequencies: 0.018553
225500 -- (-309.600) [-309.974] (-309.593) (-307.932) * (-307.084) [-306.495] (-306.808) (-308.388) -- 0:00:44
226000 -- [-309.921] (-308.924) (-308.955) (-306.827) * (-310.207) (-307.185) (-306.989) [-306.163] -- 0:00:44
226500 -- [-307.680] (-306.508) (-307.634) (-309.440) * (-310.955) (-309.444) (-307.162) [-308.880] -- 0:00:44
227000 -- (-307.770) [-306.920] (-309.637) (-310.078) * (-307.640) [-306.658] (-308.971) (-306.613) -- 0:00:44
227500 -- [-313.121] (-308.493) (-308.496) (-310.986) * (-306.709) [-305.671] (-307.235) (-310.647) -- 0:00:44
228000 -- [-308.846] (-314.177) (-306.662) (-307.528) * (-307.188) (-307.038) (-310.966) [-306.545] -- 0:00:44
228500 -- (-306.743) (-309.059) [-307.539] (-307.642) * (-314.262) (-309.105) [-307.461] (-307.478) -- 0:00:43
229000 -- (-308.145) [-309.023] (-308.648) (-305.772) * [-307.132] (-305.709) (-306.429) (-311.927) -- 0:00:43
229500 -- (-309.898) (-306.801) (-308.310) [-310.340] * (-309.180) [-306.150] (-307.930) (-308.146) -- 0:00:43
230000 -- [-307.621] (-305.633) (-309.008) (-306.570) * [-308.079] (-309.093) (-306.369) (-311.924) -- 0:00:43
Average standard deviation of split frequencies: 0.016995
230500 -- (-306.823) (-307.921) [-306.024] (-306.353) * [-307.905] (-309.151) (-310.576) (-308.657) -- 0:00:43
231000 -- [-307.144] (-307.698) (-307.109) (-307.062) * (-310.360) (-307.107) (-307.268) [-308.430] -- 0:00:43
231500 -- [-307.514] (-308.561) (-306.413) (-309.351) * [-309.626] (-307.967) (-306.466) (-309.364) -- 0:00:43
232000 -- (-306.809) [-307.247] (-306.056) (-310.038) * (-305.988) (-309.953) (-307.319) [-306.446] -- 0:00:43
232500 -- (-307.132) (-308.302) (-308.600) [-307.958] * (-308.667) [-306.270] (-311.524) (-308.782) -- 0:00:42
233000 -- (-306.390) (-307.290) (-306.421) [-309.637] * [-307.816] (-306.144) (-310.632) (-308.559) -- 0:00:42
233500 -- (-306.408) [-307.907] (-309.942) (-306.089) * (-309.790) (-309.053) [-307.264] (-307.370) -- 0:00:42
234000 -- [-307.782] (-309.068) (-307.943) (-312.036) * [-308.574] (-306.621) (-306.714) (-311.873) -- 0:00:42
234500 -- (-308.184) (-307.817) (-307.105) [-308.399] * [-306.490] (-306.456) (-306.359) (-307.449) -- 0:00:42
235000 -- (-306.799) [-306.262] (-311.535) (-309.412) * [-306.588] (-308.138) (-308.414) (-307.224) -- 0:00:42
Average standard deviation of split frequencies: 0.016190
235500 -- (-309.564) [-306.847] (-308.505) (-307.692) * [-307.138] (-309.992) (-307.674) (-308.312) -- 0:00:42
236000 -- (-308.229) (-307.509) (-308.605) [-308.113] * [-306.688] (-307.559) (-307.142) (-308.372) -- 0:00:45
236500 -- [-308.760] (-308.835) (-308.223) (-308.453) * (-308.603) [-305.980] (-308.757) (-307.429) -- 0:00:45
237000 -- (-307.294) (-308.869) [-306.585] (-307.982) * (-308.925) (-305.925) (-306.862) [-306.733] -- 0:00:45
237500 -- [-308.911] (-309.266) (-307.588) (-309.308) * (-308.414) [-308.201] (-310.260) (-308.088) -- 0:00:44
238000 -- [-310.682] (-310.356) (-307.776) (-306.948) * (-308.292) (-308.500) [-311.041] (-307.331) -- 0:00:44
238500 -- (-312.927) (-308.202) (-307.039) [-308.215] * (-309.390) [-308.274] (-310.641) (-307.862) -- 0:00:44
239000 -- (-307.930) (-306.031) [-306.896] (-307.774) * [-305.934] (-305.920) (-310.628) (-309.974) -- 0:00:44
239500 -- [-309.592] (-311.571) (-306.061) (-307.658) * [-306.832] (-306.350) (-310.132) (-309.698) -- 0:00:44
240000 -- (-308.017) (-306.685) [-306.632] (-309.633) * [-306.624] (-307.275) (-307.304) (-308.199) -- 0:00:44
Average standard deviation of split frequencies: 0.018173
240500 -- (-309.030) [-308.801] (-308.810) (-308.317) * [-306.205] (-306.517) (-310.016) (-308.817) -- 0:00:44
241000 -- (-308.073) [-307.603] (-311.044) (-309.903) * (-307.539) [-307.483] (-308.863) (-308.028) -- 0:00:44
241500 -- (-309.785) (-308.373) (-308.221) [-306.679] * (-307.013) (-309.108) (-309.083) [-313.975] -- 0:00:43
242000 -- [-307.713] (-308.243) (-308.417) (-308.201) * (-309.517) [-305.750] (-309.353) (-311.859) -- 0:00:43
242500 -- (-306.839) (-307.790) (-308.839) [-307.397] * (-307.544) [-305.564] (-307.592) (-312.361) -- 0:00:43
243000 -- (-310.156) (-306.599) [-312.080] (-307.957) * (-308.728) (-306.596) [-307.730] (-308.696) -- 0:00:43
243500 -- (-306.437) [-308.250] (-307.516) (-308.532) * [-308.173] (-308.021) (-307.815) (-306.488) -- 0:00:43
244000 -- (-309.486) (-309.220) [-307.394] (-308.223) * (-309.199) [-306.339] (-318.484) (-307.967) -- 0:00:43
244500 -- (-311.524) [-306.474] (-308.266) (-307.239) * (-308.684) (-306.875) (-311.383) [-306.043] -- 0:00:43
245000 -- (-307.591) (-309.842) [-306.412] (-308.217) * (-308.653) (-306.873) [-307.799] (-307.876) -- 0:00:43
Average standard deviation of split frequencies: 0.018950
245500 -- (-308.823) (-308.366) [-308.199] (-306.582) * (-309.259) (-309.210) (-307.419) [-309.898] -- 0:00:43
246000 -- (-307.302) (-308.078) [-307.100] (-306.883) * (-308.042) (-306.395) [-308.276] (-309.726) -- 0:00:42
246500 -- [-306.310] (-307.487) (-306.771) (-308.963) * (-307.850) (-306.908) [-307.103] (-309.759) -- 0:00:42
247000 -- (-307.876) (-308.847) (-308.735) [-307.109] * [-307.095] (-308.588) (-309.473) (-308.032) -- 0:00:42
247500 -- [-307.231] (-310.258) (-311.594) (-314.222) * (-307.544) [-308.368] (-310.383) (-306.814) -- 0:00:42
248000 -- (-307.063) [-307.218] (-310.830) (-308.612) * [-307.339] (-309.200) (-308.033) (-307.555) -- 0:00:42
248500 -- [-307.411] (-309.212) (-310.994) (-306.854) * (-308.225) (-309.053) [-307.203] (-306.515) -- 0:00:42
249000 -- [-310.188] (-307.592) (-306.861) (-310.694) * [-307.957] (-306.218) (-308.411) (-306.388) -- 0:00:42
249500 -- (-307.002) (-308.365) [-310.306] (-311.023) * [-307.487] (-305.860) (-306.813) (-310.776) -- 0:00:42
250000 -- [-311.604] (-310.087) (-310.885) (-308.335) * (-306.533) (-308.249) [-307.178] (-309.039) -- 0:00:42
Average standard deviation of split frequencies: 0.017761
250500 -- (-311.222) (-309.109) (-310.096) [-308.094] * (-308.036) (-307.690) (-308.447) [-307.818] -- 0:00:41
251000 -- (-311.957) (-307.290) (-313.459) [-306.207] * (-308.919) (-307.984) [-307.168] (-306.966) -- 0:00:41
251500 -- (-311.195) (-308.392) [-310.034] (-306.907) * (-309.545) [-309.216] (-310.975) (-307.646) -- 0:00:41
252000 -- (-308.783) [-308.802] (-305.903) (-305.733) * (-306.736) (-309.446) (-306.428) [-306.424] -- 0:00:41
252500 -- (-309.149) (-306.655) [-306.007] (-307.445) * (-307.383) (-309.476) (-308.266) [-310.334] -- 0:00:41
253000 -- [-307.648] (-307.632) (-311.499) (-308.205) * (-309.027) (-307.341) (-308.033) [-307.413] -- 0:00:41
253500 -- (-307.696) (-308.640) [-307.831] (-306.825) * (-305.592) [-309.963] (-306.036) (-306.225) -- 0:00:44
254000 -- [-308.405] (-309.664) (-307.462) (-307.058) * (-309.935) (-312.534) (-305.891) [-307.733] -- 0:00:44
254500 -- (-307.010) [-307.373] (-307.796) (-311.122) * (-308.186) (-309.513) (-307.754) [-305.775] -- 0:00:43
255000 -- [-307.767] (-310.710) (-307.486) (-307.665) * [-308.063] (-309.636) (-305.923) (-308.024) -- 0:00:43
Average standard deviation of split frequencies: 0.016880
255500 -- (-309.547) (-308.720) (-307.736) [-307.201] * (-308.672) (-308.131) [-305.842] (-308.888) -- 0:00:43
256000 -- (-311.135) (-306.967) (-307.027) [-307.168] * [-308.791] (-314.928) (-308.116) (-306.515) -- 0:00:43
256500 -- (-310.727) (-307.388) [-306.693] (-310.921) * (-307.800) [-307.666] (-309.052) (-308.146) -- 0:00:43
257000 -- (-310.310) (-307.209) (-308.909) [-306.468] * (-309.314) [-310.846] (-307.870) (-307.035) -- 0:00:43
257500 -- (-314.547) (-309.272) [-308.394] (-311.266) * (-310.737) (-309.278) (-307.156) [-309.795] -- 0:00:43
258000 -- (-312.443) (-309.444) [-306.835] (-308.107) * (-307.593) (-309.479) [-310.326] (-312.363) -- 0:00:43
258500 -- [-311.514] (-307.756) (-306.633) (-306.515) * [-308.064] (-311.818) (-307.709) (-312.408) -- 0:00:43
259000 -- (-307.443) (-306.342) [-306.785] (-306.222) * (-309.211) [-306.692] (-307.517) (-314.472) -- 0:00:42
259500 -- [-306.210] (-310.693) (-309.214) (-307.010) * (-308.840) (-306.940) (-308.200) [-310.057] -- 0:00:42
260000 -- [-309.144] (-308.058) (-312.627) (-306.600) * (-310.215) (-307.988) [-308.431] (-310.133) -- 0:00:42
Average standard deviation of split frequencies: 0.017683
260500 -- (-309.611) (-308.338) [-310.088] (-311.010) * (-308.807) [-308.800] (-311.969) (-306.718) -- 0:00:42
261000 -- (-306.354) (-310.342) (-308.762) [-308.831] * [-307.813] (-306.683) (-307.803) (-308.777) -- 0:00:42
261500 -- (-309.632) [-308.510] (-306.466) (-309.297) * (-307.665) (-307.929) [-305.923] (-306.079) -- 0:00:42
262000 -- (-308.996) (-305.918) [-310.119] (-308.474) * (-310.539) (-310.245) [-308.602] (-306.670) -- 0:00:42
262500 -- [-309.466] (-307.420) (-308.762) (-306.851) * (-308.227) [-308.196] (-308.356) (-306.378) -- 0:00:42
263000 -- (-310.441) [-308.287] (-307.561) (-308.268) * (-307.510) [-306.783] (-308.118) (-306.151) -- 0:00:42
263500 -- (-307.737) (-307.403) (-306.687) [-306.789] * (-309.522) (-307.310) (-306.521) [-306.292] -- 0:00:41
264000 -- (-309.238) [-307.662] (-307.010) (-312.446) * (-308.310) [-305.970] (-306.300) (-307.669) -- 0:00:41
264500 -- (-311.335) [-307.167] (-306.139) (-306.227) * (-317.148) [-310.313] (-306.195) (-308.870) -- 0:00:41
265000 -- (-308.012) (-306.801) [-306.441] (-308.148) * (-315.716) [-310.420] (-307.081) (-308.907) -- 0:00:41
Average standard deviation of split frequencies: 0.017525
265500 -- (-312.960) (-307.291) (-310.380) [-309.165] * (-311.662) (-308.162) [-308.701] (-310.528) -- 0:00:41
266000 -- [-306.700] (-306.294) (-310.141) (-310.370) * (-311.374) (-308.193) [-306.257] (-308.939) -- 0:00:41
266500 -- (-306.183) (-308.838) [-308.221] (-307.572) * [-308.332] (-308.441) (-309.375) (-306.137) -- 0:00:41
267000 -- (-312.535) (-306.223) [-305.667] (-306.318) * (-310.262) (-315.090) (-308.733) [-306.452] -- 0:00:41
267500 -- (-307.341) (-307.533) (-307.426) [-306.033] * (-305.996) (-308.524) [-310.347] (-306.131) -- 0:00:41
268000 -- (-306.577) (-306.474) [-306.724] (-307.521) * [-308.589] (-309.759) (-307.305) (-306.527) -- 0:00:40
268500 -- (-308.438) (-306.397) [-307.225] (-311.925) * (-307.805) (-308.585) [-308.907] (-310.214) -- 0:00:43
269000 -- (-309.924) (-307.376) (-310.215) [-307.193] * (-307.870) (-308.179) [-307.809] (-306.757) -- 0:00:43
269500 -- (-307.764) (-310.971) [-310.515] (-307.481) * [-309.259] (-307.257) (-308.242) (-308.097) -- 0:00:43
270000 -- (-308.143) (-307.979) (-309.514) [-306.400] * (-309.223) (-307.928) (-310.613) [-305.893] -- 0:00:43
Average standard deviation of split frequencies: 0.016642
270500 -- [-307.927] (-314.267) (-309.094) (-307.423) * (-307.824) [-306.991] (-306.124) (-306.829) -- 0:00:43
271000 -- (-307.471) (-313.042) (-306.707) [-306.892] * (-306.388) [-306.695] (-307.869) (-306.342) -- 0:00:43
271500 -- (-307.569) [-307.314] (-308.461) (-310.558) * (-308.337) [-306.561] (-309.672) (-307.380) -- 0:00:42
272000 -- (-306.304) [-308.920] (-307.648) (-307.272) * (-310.950) (-309.444) (-309.041) [-307.034] -- 0:00:42
272500 -- (-306.994) (-308.929) [-309.756] (-306.281) * (-308.809) (-308.632) [-307.112] (-309.585) -- 0:00:42
273000 -- [-312.138] (-307.535) (-306.776) (-309.016) * (-308.747) [-306.874] (-306.766) (-311.462) -- 0:00:42
273500 -- [-307.752] (-306.809) (-307.795) (-306.833) * (-312.634) (-307.374) [-307.089] (-306.724) -- 0:00:42
274000 -- (-307.338) (-306.452) (-307.429) [-307.077] * (-309.604) (-308.710) [-308.157] (-308.688) -- 0:00:42
274500 -- (-307.564) [-307.917] (-309.090) (-309.815) * (-308.279) [-308.936] (-308.118) (-307.541) -- 0:00:42
275000 -- (-308.245) [-306.196] (-308.566) (-306.577) * (-309.775) (-309.361) [-307.160] (-308.285) -- 0:00:42
Average standard deviation of split frequencies: 0.015751
275500 -- (-307.644) (-306.298) (-306.246) [-308.291] * (-310.681) (-307.918) (-307.046) [-309.076] -- 0:00:42
276000 -- (-308.407) (-309.006) [-306.688] (-312.274) * (-308.485) [-306.903] (-308.436) (-308.585) -- 0:00:41
276500 -- (-307.261) (-310.678) (-308.313) [-308.993] * (-309.602) (-305.931) [-307.830] (-312.420) -- 0:00:41
277000 -- (-310.566) (-309.522) [-307.877] (-308.098) * [-309.607] (-310.573) (-306.589) (-306.725) -- 0:00:41
277500 -- (-306.743) [-308.855] (-307.613) (-309.262) * (-309.698) (-309.901) [-306.481] (-305.671) -- 0:00:41
278000 -- [-306.553] (-313.903) (-311.741) (-311.898) * (-308.817) (-309.322) [-307.867] (-308.095) -- 0:00:41
278500 -- [-308.110] (-313.754) (-310.508) (-314.067) * (-307.492) [-306.782] (-306.238) (-306.711) -- 0:00:41
279000 -- [-310.795] (-307.970) (-308.245) (-307.077) * (-309.629) (-312.539) (-307.187) [-308.742] -- 0:00:41
279500 -- (-309.999) [-305.937] (-306.614) (-307.939) * (-307.897) (-309.439) [-307.566] (-309.704) -- 0:00:41
280000 -- (-307.199) (-308.371) [-306.565] (-311.337) * (-306.566) (-306.291) [-306.323] (-307.894) -- 0:00:41
Average standard deviation of split frequencies: 0.014650
280500 -- (-308.535) (-309.102) [-310.275] (-308.649) * (-307.992) (-306.613) [-307.740] (-314.093) -- 0:00:41
281000 -- (-307.600) [-307.761] (-307.955) (-312.627) * (-307.957) [-309.452] (-306.201) (-309.720) -- 0:00:40
281500 -- [-308.127] (-308.011) (-312.422) (-305.875) * (-308.961) (-309.965) [-306.971] (-311.778) -- 0:00:40
282000 -- [-307.359] (-306.807) (-305.668) (-311.609) * (-307.438) (-307.139) [-307.964] (-306.840) -- 0:00:40
282500 -- (-306.930) (-310.253) (-310.788) [-306.820] * [-306.395] (-307.602) (-311.089) (-307.099) -- 0:00:40
283000 -- (-306.407) [-311.870] (-307.635) (-313.088) * (-314.203) [-307.121] (-306.950) (-308.426) -- 0:00:40
283500 -- (-307.147) (-310.508) [-309.018] (-306.884) * (-312.804) (-311.076) (-308.897) [-306.296] -- 0:00:40
284000 -- (-307.413) (-307.627) (-307.199) [-307.486] * (-310.953) [-306.479] (-308.466) (-307.121) -- 0:00:40
284500 -- (-310.852) (-311.129) (-307.131) [-309.463] * (-311.134) [-309.450] (-310.336) (-306.612) -- 0:00:40
285000 -- (-307.139) (-309.519) (-308.812) [-309.718] * (-306.408) [-309.435] (-307.924) (-308.739) -- 0:00:40
Average standard deviation of split frequencies: 0.014651
285500 -- (-309.462) (-306.292) [-306.193] (-309.040) * [-306.833] (-306.800) (-307.854) (-309.365) -- 0:00:42
286000 -- (-308.074) (-307.393) [-307.033] (-306.324) * [-309.326] (-307.209) (-307.371) (-306.752) -- 0:00:42
286500 -- [-309.699] (-307.164) (-309.016) (-308.751) * (-310.211) (-307.543) (-306.214) [-309.840] -- 0:00:42
287000 -- (-311.125) [-308.548] (-308.768) (-307.597) * (-306.470) [-311.951] (-306.466) (-312.483) -- 0:00:42
287500 -- [-307.794] (-308.928) (-308.927) (-311.590) * (-306.478) (-308.451) (-306.193) [-307.908] -- 0:00:42
288000 -- (-310.127) (-306.001) [-306.722] (-306.742) * (-308.716) [-306.795] (-306.458) (-308.170) -- 0:00:42
288500 -- (-306.087) [-308.365] (-312.182) (-306.194) * (-306.683) (-309.515) [-307.525] (-309.245) -- 0:00:41
289000 -- (-309.123) (-309.000) [-307.117] (-306.397) * (-309.072) (-312.379) [-310.029] (-309.067) -- 0:00:41
289500 -- [-308.105] (-308.434) (-308.402) (-313.132) * (-307.890) [-309.129] (-308.001) (-307.612) -- 0:00:41
290000 -- (-306.923) [-309.321] (-308.126) (-308.800) * (-309.987) (-310.606) (-308.490) [-307.554] -- 0:00:41
Average standard deviation of split frequencies: 0.013695
290500 -- [-310.008] (-307.511) (-309.788) (-310.157) * (-311.160) (-306.586) (-308.766) [-307.398] -- 0:00:41
291000 -- (-306.721) (-309.560) [-309.141] (-307.239) * (-306.871) [-308.192] (-307.799) (-311.039) -- 0:00:41
291500 -- (-308.376) (-310.354) [-311.009] (-306.596) * [-307.633] (-306.912) (-308.067) (-307.048) -- 0:00:41
292000 -- (-309.351) [-307.411] (-306.029) (-307.020) * [-307.117] (-308.471) (-309.245) (-306.192) -- 0:00:41
292500 -- (-306.746) [-307.902] (-306.391) (-308.889) * [-306.166] (-307.914) (-308.411) (-305.866) -- 0:00:41
293000 -- (-311.989) (-306.754) (-306.098) [-308.817] * [-308.125] (-309.570) (-306.146) (-307.574) -- 0:00:41
293500 -- (-311.063) [-310.084] (-312.522) (-307.718) * (-311.354) (-308.377) [-309.872] (-310.113) -- 0:00:40
294000 -- [-308.557] (-307.587) (-306.863) (-310.719) * [-309.334] (-312.527) (-310.638) (-306.625) -- 0:00:40
294500 -- (-308.757) (-307.027) [-308.381] (-307.375) * [-308.237] (-308.102) (-306.754) (-308.067) -- 0:00:40
295000 -- [-309.288] (-307.960) (-308.103) (-306.375) * (-307.790) (-310.410) [-308.129] (-307.613) -- 0:00:40
Average standard deviation of split frequencies: 0.012387
295500 -- [-305.769] (-309.138) (-307.818) (-312.684) * (-309.883) [-311.405] (-307.843) (-310.671) -- 0:00:40
296000 -- (-309.811) (-308.539) [-306.504] (-309.108) * [-307.250] (-314.219) (-308.713) (-309.036) -- 0:00:40
296500 -- (-306.736) [-307.135] (-307.057) (-308.299) * (-308.279) (-309.202) [-308.392] (-307.076) -- 0:00:40
297000 -- (-310.908) (-305.836) [-309.442] (-307.041) * (-307.729) (-307.611) [-309.422] (-307.957) -- 0:00:40
297500 -- (-306.069) [-308.496] (-308.097) (-307.000) * [-307.608] (-310.135) (-306.323) (-307.955) -- 0:00:40
298000 -- (-309.193) [-305.947] (-309.094) (-312.339) * (-308.023) [-306.873] (-307.980) (-308.283) -- 0:00:40
298500 -- (-310.384) [-307.926] (-307.610) (-310.724) * (-309.454) [-308.788] (-306.663) (-310.240) -- 0:00:39
299000 -- (-314.460) [-308.381] (-308.637) (-308.452) * (-306.392) (-308.345) (-307.974) [-308.247] -- 0:00:39
299500 -- (-307.540) [-313.716] (-309.289) (-311.283) * (-307.131) [-306.921] (-306.589) (-310.893) -- 0:00:39
300000 -- [-306.472] (-306.919) (-307.675) (-316.570) * (-307.117) [-306.787] (-306.380) (-308.518) -- 0:00:39
Average standard deviation of split frequencies: 0.012456
300500 -- (-307.524) (-306.761) [-307.553] (-306.792) * (-308.886) (-310.544) [-307.504] (-306.515) -- 0:00:39
301000 -- (-307.608) (-308.202) (-306.733) [-307.879] * [-306.467] (-310.802) (-309.751) (-307.889) -- 0:00:39
301500 -- (-311.585) (-312.872) (-306.350) [-306.725] * (-306.343) (-307.848) (-307.837) [-307.062] -- 0:00:39
302000 -- [-309.134] (-307.677) (-306.803) (-307.384) * (-306.430) (-312.611) (-309.043) [-306.521] -- 0:00:41
302500 -- [-307.721] (-310.388) (-309.294) (-307.675) * (-312.344) (-307.510) (-309.303) [-307.052] -- 0:00:41
303000 -- (-306.671) (-315.117) [-310.683] (-307.421) * (-307.388) [-305.835] (-307.095) (-308.742) -- 0:00:41
303500 -- (-311.608) (-313.759) (-309.533) [-306.269] * (-310.816) (-306.905) (-305.766) [-306.502] -- 0:00:41
304000 -- [-306.724] (-314.716) (-306.675) (-309.136) * (-306.112) [-306.689] (-309.056) (-308.439) -- 0:00:41
304500 -- [-310.437] (-313.567) (-306.753) (-308.145) * (-306.155) (-307.513) (-306.061) [-305.885] -- 0:00:41
305000 -- (-306.935) (-313.828) [-311.414] (-312.328) * (-305.950) (-305.821) [-308.239] (-307.197) -- 0:00:41
Average standard deviation of split frequencies: 0.012667
305500 -- (-307.232) (-316.583) [-307.743] (-307.094) * [-305.886] (-306.862) (-309.761) (-308.525) -- 0:00:40
306000 -- (-308.417) [-314.437] (-308.945) (-307.508) * (-308.989) [-307.259] (-308.466) (-306.352) -- 0:00:40
306500 -- (-308.881) (-307.882) (-307.675) [-309.551] * [-308.751] (-308.565) (-308.291) (-312.484) -- 0:00:40
307000 -- (-307.877) (-307.696) [-307.739] (-308.785) * [-309.829] (-305.560) (-307.434) (-308.059) -- 0:00:40
307500 -- (-307.869) [-306.924] (-311.544) (-312.134) * (-307.099) (-306.464) (-307.292) [-306.512] -- 0:00:40
308000 -- (-308.739) [-307.395] (-309.110) (-312.904) * (-308.483) (-306.236) (-306.768) [-307.747] -- 0:00:40
308500 -- (-307.744) (-307.243) (-311.250) [-312.238] * (-305.920) (-307.351) [-306.608] (-311.574) -- 0:00:40
309000 -- [-308.299] (-306.969) (-308.540) (-307.794) * (-309.331) [-308.947] (-308.938) (-308.769) -- 0:00:40
309500 -- [-306.359] (-307.470) (-307.746) (-307.270) * [-308.022] (-309.127) (-308.924) (-308.642) -- 0:00:40
310000 -- [-309.159] (-307.895) (-307.144) (-311.395) * (-314.973) (-310.116) (-307.731) [-307.369] -- 0:00:40
Average standard deviation of split frequencies: 0.013032
310500 -- [-306.062] (-309.388) (-306.414) (-310.164) * (-308.722) (-309.023) (-306.471) [-309.491] -- 0:00:39
311000 -- (-306.263) [-308.345] (-307.046) (-306.397) * (-308.668) (-307.286) [-306.018] (-305.787) -- 0:00:39
311500 -- (-310.158) (-307.662) (-306.500) [-307.996] * [-308.346] (-307.252) (-306.330) (-309.353) -- 0:00:39
312000 -- (-306.524) (-307.627) [-306.255] (-306.756) * (-316.272) (-308.799) [-307.250] (-308.085) -- 0:00:39
312500 -- (-307.927) [-306.915] (-307.119) (-309.406) * (-309.934) (-311.339) (-309.005) [-308.537] -- 0:00:39
313000 -- (-305.934) (-307.737) [-309.875] (-308.627) * [-307.320] (-308.773) (-307.212) (-312.254) -- 0:00:39
313500 -- (-306.296) (-307.372) (-312.248) [-310.117] * (-307.209) (-307.068) (-306.863) [-307.935] -- 0:00:39
314000 -- (-311.169) (-305.768) [-310.455] (-308.819) * (-310.168) (-309.436) (-307.666) [-307.266] -- 0:00:39
314500 -- (-310.921) [-306.550] (-309.354) (-309.875) * [-310.309] (-309.916) (-307.949) (-308.679) -- 0:00:39
315000 -- [-306.023] (-308.397) (-310.540) (-307.826) * (-307.731) (-307.589) (-308.380) [-308.850] -- 0:00:39
Average standard deviation of split frequencies: 0.013953
315500 -- [-307.614] (-306.251) (-309.742) (-309.501) * (-309.912) (-310.301) [-306.471] (-308.000) -- 0:00:39
316000 -- [-308.786] (-306.881) (-307.987) (-308.736) * [-310.179] (-308.072) (-308.455) (-306.927) -- 0:00:38
316500 -- (-308.262) [-307.596] (-308.421) (-306.406) * (-306.383) (-311.055) (-306.561) [-308.682] -- 0:00:38
317000 -- (-309.440) [-309.858] (-306.702) (-307.128) * (-306.347) (-310.095) [-313.747] (-310.263) -- 0:00:38
317500 -- (-306.404) (-312.639) [-306.359] (-311.350) * [-307.926] (-306.333) (-310.597) (-308.654) -- 0:00:38
318000 -- (-307.912) (-306.319) (-306.606) [-314.693] * [-308.754] (-308.337) (-308.311) (-309.582) -- 0:00:38
318500 -- (-309.059) (-308.587) (-307.837) [-308.826] * (-306.017) (-308.170) [-306.336] (-306.332) -- 0:00:38
319000 -- [-305.910] (-308.690) (-309.684) (-310.553) * (-308.457) [-307.946] (-306.731) (-309.088) -- 0:00:40
319500 -- (-309.466) (-306.225) (-306.620) [-308.208] * (-311.715) (-306.902) (-307.062) [-308.995] -- 0:00:40
320000 -- (-306.290) (-309.295) (-308.555) [-308.308] * (-306.754) (-310.694) (-308.371) [-306.872] -- 0:00:40
Average standard deviation of split frequencies: 0.013312
320500 -- [-308.482] (-308.625) (-309.506) (-307.365) * (-309.152) (-306.183) (-306.058) [-306.296] -- 0:00:40
321000 -- (-307.122) (-308.473) (-307.924) [-307.536] * (-306.392) [-309.953] (-306.786) (-306.728) -- 0:00:40
321500 -- [-307.633] (-307.137) (-308.253) (-306.712) * (-307.265) (-308.593) [-306.439] (-306.822) -- 0:00:40
322000 -- (-312.250) [-308.682] (-310.026) (-310.068) * (-307.201) [-307.981] (-308.276) (-307.423) -- 0:00:40
322500 -- (-309.518) (-306.018) (-311.134) [-307.635] * (-310.653) [-306.390] (-308.862) (-313.551) -- 0:00:39
323000 -- (-307.752) (-305.652) (-311.210) [-306.953] * (-306.617) (-306.917) (-309.046) [-310.926] -- 0:00:39
323500 -- (-309.433) (-307.908) [-309.712] (-306.392) * (-310.519) (-308.184) [-307.932] (-307.188) -- 0:00:39
324000 -- [-306.751] (-310.130) (-308.095) (-307.134) * [-306.645] (-306.135) (-309.218) (-305.604) -- 0:00:39
324500 -- (-307.926) (-308.791) (-309.592) [-309.037] * [-308.330] (-308.374) (-307.432) (-305.930) -- 0:00:39
325000 -- (-307.442) (-309.659) [-306.353] (-309.150) * (-309.295) [-311.402] (-306.921) (-306.535) -- 0:00:39
Average standard deviation of split frequencies: 0.013255
325500 -- (-305.843) (-306.120) [-306.819] (-309.787) * [-312.835] (-307.887) (-309.164) (-308.780) -- 0:00:39
326000 -- (-309.268) (-312.035) (-307.983) [-307.673] * (-308.954) (-309.601) [-309.022] (-310.353) -- 0:00:39
326500 -- (-308.558) (-308.414) (-306.798) [-309.072] * (-314.119) (-306.223) [-308.686] (-307.384) -- 0:00:39
327000 -- (-307.597) (-308.572) (-308.318) [-306.656] * (-306.850) [-306.582] (-309.523) (-305.840) -- 0:00:39
327500 -- (-308.498) (-307.120) [-306.990] (-308.596) * (-307.818) [-310.855] (-306.934) (-309.381) -- 0:00:39
328000 -- [-308.519] (-305.818) (-307.392) (-307.796) * (-306.894) (-310.068) [-307.842] (-308.776) -- 0:00:38
328500 -- (-306.592) [-309.298] (-307.564) (-305.911) * (-306.284) (-314.755) [-306.640] (-308.973) -- 0:00:38
329000 -- (-307.718) (-306.113) (-308.167) [-306.899] * [-306.139] (-310.957) (-307.748) (-309.421) -- 0:00:38
329500 -- (-307.738) (-307.483) [-310.596] (-307.182) * (-308.128) [-307.598] (-307.514) (-307.151) -- 0:00:38
330000 -- (-308.891) (-307.073) [-307.963] (-305.933) * [-308.016] (-306.474) (-306.867) (-306.334) -- 0:00:38
Average standard deviation of split frequencies: 0.013227
330500 -- (-308.220) (-308.445) [-306.089] (-308.686) * (-307.781) (-306.116) [-308.590] (-306.735) -- 0:00:38
331000 -- (-307.433) (-312.197) (-307.451) [-306.356] * (-307.887) [-307.301] (-308.705) (-307.392) -- 0:00:38
331500 -- (-308.511) (-310.552) [-307.565] (-310.731) * (-307.291) [-306.910] (-308.595) (-306.980) -- 0:00:38
332000 -- (-309.371) (-307.525) (-307.904) [-307.235] * (-306.550) (-308.864) [-310.434] (-309.211) -- 0:00:38
332500 -- (-309.054) [-307.100] (-307.032) (-309.208) * (-307.173) (-305.489) [-306.248] (-308.370) -- 0:00:38
333000 -- [-306.710] (-306.291) (-308.255) (-308.695) * (-306.230) (-307.274) [-306.322] (-307.903) -- 0:00:38
333500 -- [-306.782] (-307.217) (-307.053) (-307.903) * (-307.766) (-306.821) (-310.356) [-306.926] -- 0:00:37
334000 -- [-307.150] (-310.890) (-309.698) (-309.727) * (-309.292) (-308.822) [-308.235] (-310.783) -- 0:00:37
334500 -- (-307.441) (-307.692) (-310.349) [-306.747] * (-307.364) (-308.784) (-306.104) [-313.564] -- 0:00:37
335000 -- (-307.976) (-306.860) [-311.295] (-307.017) * (-308.036) (-307.967) (-308.313) [-309.284] -- 0:00:37
Average standard deviation of split frequencies: 0.013173
335500 -- (-308.342) (-307.931) [-309.210] (-311.910) * (-306.334) (-307.741) (-308.823) [-311.867] -- 0:00:37
336000 -- [-307.809] (-306.430) (-307.678) (-310.475) * (-306.352) [-307.006] (-311.307) (-309.397) -- 0:00:39
336500 -- (-307.077) (-307.267) [-307.412] (-309.094) * (-310.150) (-309.549) (-306.158) [-307.914] -- 0:00:39
337000 -- (-308.846) (-309.871) (-311.063) [-306.549] * (-312.047) (-308.856) [-309.750] (-306.755) -- 0:00:39
337500 -- (-306.244) [-306.442] (-306.398) (-308.624) * (-306.552) (-309.992) [-308.401] (-307.472) -- 0:00:39
338000 -- (-306.113) [-306.150] (-308.139) (-309.006) * (-306.487) (-307.675) [-307.992] (-308.358) -- 0:00:39
338500 -- (-311.124) (-306.860) (-309.952) [-308.417] * (-306.626) (-307.410) [-306.535] (-309.612) -- 0:00:39
339000 -- [-309.361] (-309.161) (-308.268) (-311.497) * [-305.876] (-307.155) (-305.922) (-309.222) -- 0:00:38
339500 -- (-307.573) (-306.026) [-307.371] (-309.018) * (-306.664) [-308.491] (-308.000) (-308.535) -- 0:00:38
340000 -- (-311.773) [-307.249] (-309.689) (-308.697) * (-306.695) (-308.423) (-305.613) [-309.577] -- 0:00:38
Average standard deviation of split frequencies: 0.012454
340500 -- (-308.288) [-306.331] (-309.443) (-306.683) * (-306.961) (-308.166) [-309.021] (-307.201) -- 0:00:38
341000 -- (-308.113) [-309.307] (-309.636) (-307.847) * [-306.729] (-308.242) (-308.765) (-308.308) -- 0:00:38
341500 -- (-305.556) [-307.131] (-306.189) (-307.240) * [-307.680] (-308.135) (-307.918) (-307.985) -- 0:00:38
342000 -- (-307.476) (-306.952) (-308.884) [-307.470] * (-307.871) (-308.645) [-307.490] (-310.050) -- 0:00:38
342500 -- [-306.982] (-307.990) (-311.642) (-307.267) * (-306.350) [-308.569] (-307.280) (-310.948) -- 0:00:38
343000 -- (-307.235) [-308.621] (-310.211) (-306.288) * (-310.583) (-306.877) [-311.069] (-309.693) -- 0:00:38
343500 -- (-307.661) (-306.010) (-314.506) [-306.640] * (-308.297) (-309.370) [-310.161] (-310.606) -- 0:00:38
344000 -- (-306.727) [-311.388] (-308.257) (-310.650) * (-309.568) (-305.895) (-306.514) [-305.753] -- 0:00:38
344500 -- (-310.408) (-312.159) (-313.386) [-307.916] * (-308.829) [-305.465] (-306.251) (-310.147) -- 0:00:38
345000 -- [-307.630] (-308.216) (-307.446) (-308.815) * (-309.925) (-306.537) [-308.000] (-309.488) -- 0:00:37
Average standard deviation of split frequencies: 0.012262
345500 -- (-310.039) (-308.957) [-307.201] (-306.942) * [-310.658] (-308.270) (-308.566) (-308.493) -- 0:00:37
346000 -- (-311.312) (-307.601) (-312.278) [-306.913] * (-306.284) (-308.074) (-306.144) [-307.150] -- 0:00:37
346500 -- [-306.622] (-306.946) (-308.340) (-310.243) * (-306.589) (-309.150) (-306.230) [-306.651] -- 0:00:37
347000 -- (-308.821) (-307.304) [-310.449] (-313.100) * [-307.414] (-306.361) (-306.215) (-307.610) -- 0:00:37
347500 -- [-306.042] (-307.506) (-307.413) (-310.612) * (-307.806) [-307.185] (-306.921) (-308.353) -- 0:00:37
348000 -- (-306.255) [-307.845] (-305.996) (-308.298) * (-310.545) (-307.383) [-306.264] (-307.139) -- 0:00:37
348500 -- (-306.767) (-309.239) [-312.407] (-306.722) * [-308.140] (-307.294) (-306.443) (-309.199) -- 0:00:37
349000 -- (-308.931) (-314.030) (-307.326) [-306.382] * (-306.475) [-310.031] (-308.805) (-307.780) -- 0:00:37
349500 -- [-305.755] (-307.959) (-308.175) (-311.075) * (-306.211) (-307.572) (-309.680) [-308.918] -- 0:00:37
350000 -- (-307.166) (-310.673) (-308.525) [-307.130] * (-310.191) (-308.516) (-310.517) [-308.620] -- 0:00:37
Average standard deviation of split frequencies: 0.011782
350500 -- (-307.172) [-310.175] (-310.223) (-307.369) * (-310.497) (-305.745) (-308.570) [-306.966] -- 0:00:37
351000 -- (-310.894) [-309.483] (-308.122) (-307.924) * (-309.689) [-308.558] (-307.966) (-307.430) -- 0:00:36
351500 -- (-309.356) [-309.786] (-307.223) (-311.464) * (-306.119) (-308.459) [-307.022] (-306.437) -- 0:00:36
352000 -- (-307.682) (-307.699) (-307.139) [-309.326] * (-308.171) (-307.951) (-306.983) [-310.576] -- 0:00:36
352500 -- (-308.908) (-307.517) (-306.724) [-310.849] * [-307.404] (-306.209) (-306.794) (-309.659) -- 0:00:36
353000 -- [-307.395] (-308.623) (-313.850) (-306.870) * [-308.999] (-306.666) (-311.857) (-311.529) -- 0:00:36
353500 -- (-308.784) (-310.248) (-309.252) [-308.382] * (-308.180) (-307.099) [-307.248] (-307.568) -- 0:00:38
354000 -- [-309.794] (-307.888) (-310.378) (-307.879) * (-306.418) (-307.818) (-310.196) [-310.532] -- 0:00:38
354500 -- (-309.421) (-306.048) (-308.996) [-309.636] * [-306.969] (-308.027) (-308.488) (-306.785) -- 0:00:38
355000 -- (-307.487) (-310.114) [-307.261] (-309.788) * (-307.864) (-309.732) [-308.035] (-308.314) -- 0:00:38
Average standard deviation of split frequencies: 0.011995
355500 -- [-307.057] (-307.937) (-310.038) (-307.221) * (-309.917) (-307.232) [-306.430] (-307.913) -- 0:00:38
356000 -- (-308.961) (-308.483) (-307.178) [-307.255] * (-309.342) (-308.542) (-309.213) [-306.751] -- 0:00:37
356500 -- (-308.441) (-308.832) (-310.329) [-308.568] * (-308.221) (-306.896) (-309.296) [-307.763] -- 0:00:37
357000 -- (-306.955) (-310.968) [-308.674] (-308.009) * [-312.486] (-308.215) (-308.389) (-306.996) -- 0:00:37
357500 -- [-307.370] (-310.379) (-307.473) (-307.193) * [-308.407] (-308.159) (-308.778) (-310.498) -- 0:00:37
358000 -- (-306.876) (-307.910) [-306.336] (-308.784) * (-307.028) [-305.845] (-306.981) (-308.831) -- 0:00:37
358500 -- (-311.018) (-309.939) (-307.827) [-313.516] * (-309.732) [-306.481] (-307.902) (-311.739) -- 0:00:37
359000 -- (-308.712) [-308.013] (-307.692) (-306.534) * (-306.547) [-309.777] (-309.903) (-306.680) -- 0:00:37
359500 -- [-307.038] (-306.063) (-310.799) (-306.274) * (-307.442) [-307.446] (-312.685) (-306.597) -- 0:00:37
360000 -- (-308.120) (-309.461) (-310.240) [-307.253] * [-311.081] (-308.826) (-309.281) (-309.442) -- 0:00:37
Average standard deviation of split frequencies: 0.011840
360500 -- (-310.276) (-313.722) (-307.036) [-307.853] * (-310.321) (-309.452) (-309.210) [-307.673] -- 0:00:37
361000 -- (-308.752) (-307.375) [-312.344] (-308.328) * (-310.576) (-308.674) [-307.652] (-309.800) -- 0:00:37
361500 -- [-308.644] (-309.435) (-308.020) (-307.675) * (-308.909) (-308.113) (-307.462) [-307.529] -- 0:00:37
362000 -- (-306.751) (-307.973) [-308.254] (-307.620) * (-306.103) [-309.565] (-312.079) (-308.392) -- 0:00:37
362500 -- (-306.463) (-307.135) [-307.235] (-307.104) * (-312.190) [-308.799] (-310.250) (-310.923) -- 0:00:36
363000 -- [-311.879] (-310.643) (-309.590) (-307.449) * (-309.349) [-307.076] (-312.334) (-308.957) -- 0:00:36
363500 -- (-312.913) (-309.101) (-309.742) [-306.885] * (-306.862) [-307.678] (-307.241) (-312.299) -- 0:00:36
364000 -- (-308.144) (-307.414) (-309.053) [-307.564] * (-305.973) [-308.412] (-307.408) (-305.539) -- 0:00:36
364500 -- (-308.496) (-307.882) (-316.268) [-307.216] * (-306.592) (-306.796) (-306.051) [-307.268] -- 0:00:36
365000 -- (-306.791) (-308.216) [-307.209] (-308.242) * (-306.715) [-307.537] (-307.306) (-306.779) -- 0:00:36
Average standard deviation of split frequencies: 0.012164
365500 -- [-308.805] (-308.632) (-308.634) (-308.315) * [-310.015] (-306.914) (-307.713) (-310.008) -- 0:00:36
366000 -- [-309.706] (-307.195) (-308.414) (-316.435) * [-307.060] (-306.404) (-308.623) (-306.473) -- 0:00:36
366500 -- (-308.906) [-306.800] (-307.095) (-312.268) * (-309.256) (-306.897) (-311.603) [-306.963] -- 0:00:36
367000 -- (-308.578) (-307.517) (-306.926) [-308.002] * (-309.416) [-307.119] (-310.760) (-306.102) -- 0:00:36
367500 -- (-309.075) [-309.369] (-306.254) (-312.924) * (-306.401) (-308.116) (-306.282) [-306.223] -- 0:00:36
368000 -- [-307.103] (-306.530) (-307.264) (-307.284) * (-307.807) (-310.168) (-305.878) [-307.749] -- 0:00:36
368500 -- (-306.835) (-307.618) (-307.019) [-308.293] * (-306.512) [-309.692] (-306.554) (-308.175) -- 0:00:35
369000 -- (-308.364) [-307.818] (-306.455) (-309.766) * (-306.550) (-308.190) [-309.026] (-307.329) -- 0:00:35
369500 -- (-309.815) (-310.568) [-308.823] (-307.480) * (-309.187) (-306.599) [-309.032] (-307.667) -- 0:00:35
370000 -- (-308.787) (-308.715) (-305.811) [-307.380] * (-312.778) (-308.302) [-306.476] (-309.100) -- 0:00:35
Average standard deviation of split frequencies: 0.012223
370500 -- (-306.574) (-307.224) (-306.169) [-306.839] * [-308.654] (-307.116) (-310.492) (-306.474) -- 0:00:37
371000 -- (-307.404) (-307.934) (-306.449) [-312.306] * [-310.571] (-308.105) (-307.108) (-307.101) -- 0:00:37
371500 -- (-306.149) [-306.609] (-309.437) (-308.768) * (-310.949) (-310.596) [-308.496] (-306.739) -- 0:00:37
372000 -- (-310.300) (-308.725) [-307.275] (-308.169) * (-309.695) (-311.381) (-307.046) [-307.446] -- 0:00:37
372500 -- (-308.056) (-307.446) (-308.996) [-311.444] * (-307.667) [-309.756] (-308.310) (-309.238) -- 0:00:37
373000 -- [-306.873] (-307.154) (-307.114) (-308.136) * [-307.413] (-308.005) (-308.188) (-305.666) -- 0:00:36
373500 -- (-308.671) (-309.862) [-307.436] (-308.043) * [-306.061] (-308.402) (-311.228) (-307.611) -- 0:00:36
374000 -- (-306.884) (-310.671) [-306.301] (-306.364) * [-307.673] (-307.992) (-306.191) (-308.474) -- 0:00:36
374500 -- (-306.906) (-312.548) (-307.136) [-307.728] * (-308.329) (-307.056) (-308.444) [-308.659] -- 0:00:36
375000 -- (-308.254) (-307.474) (-306.926) [-309.204] * (-308.316) (-306.378) [-306.521] (-306.118) -- 0:00:36
Average standard deviation of split frequencies: 0.011632
375500 -- (-307.446) (-308.223) (-305.837) [-308.934] * (-307.596) (-307.598) (-308.237) [-308.227] -- 0:00:36
376000 -- (-308.520) (-307.581) [-310.019] (-307.029) * (-308.211) [-307.819] (-305.629) (-307.289) -- 0:00:36
376500 -- (-308.122) (-309.780) (-309.612) [-306.532] * [-312.358] (-308.005) (-306.032) (-306.626) -- 0:00:36
377000 -- (-306.585) [-306.748] (-308.450) (-307.810) * [-314.538] (-306.467) (-306.405) (-307.848) -- 0:00:36
377500 -- (-307.839) (-310.376) (-312.882) [-306.397] * [-309.350] (-308.303) (-308.296) (-310.290) -- 0:00:36
378000 -- (-309.941) [-305.717] (-309.126) (-307.345) * (-308.810) [-308.079] (-310.660) (-309.895) -- 0:00:36
378500 -- (-310.348) [-306.502] (-309.231) (-309.406) * (-307.526) (-306.226) (-308.433) [-311.647] -- 0:00:36
379000 -- (-308.377) (-306.649) (-307.238) [-306.010] * [-308.452] (-307.946) (-309.543) (-310.412) -- 0:00:36
379500 -- (-307.635) (-305.948) [-306.904] (-307.060) * [-309.186] (-305.606) (-309.260) (-307.043) -- 0:00:35
380000 -- [-306.682] (-311.093) (-307.185) (-307.998) * (-308.167) (-307.162) [-308.294] (-306.155) -- 0:00:35
Average standard deviation of split frequencies: 0.011489
380500 -- (-306.900) (-310.253) (-308.275) [-309.689] * (-307.183) [-307.329] (-306.857) (-306.948) -- 0:00:35
381000 -- (-306.635) (-309.315) (-308.143) [-308.573] * (-306.388) (-309.360) [-307.168] (-306.417) -- 0:00:35
381500 -- (-307.542) (-309.990) [-307.335] (-311.606) * (-306.452) (-307.979) [-305.880] (-308.035) -- 0:00:35
382000 -- (-307.101) (-310.156) [-307.883] (-307.417) * (-306.255) (-310.058) (-306.759) [-306.189] -- 0:00:35
382500 -- (-306.804) (-309.205) [-308.880] (-307.380) * (-309.448) [-306.535] (-306.968) (-307.215) -- 0:00:35
383000 -- [-309.261] (-306.967) (-307.905) (-306.931) * (-311.847) (-306.666) [-308.368] (-308.637) -- 0:00:35
383500 -- [-308.023] (-313.922) (-306.909) (-310.721) * (-307.308) [-306.390] (-308.962) (-309.245) -- 0:00:35
384000 -- (-309.912) (-305.511) (-307.419) [-308.659] * (-309.933) [-307.318] (-308.321) (-308.210) -- 0:00:35
384500 -- (-309.712) (-306.845) [-305.830] (-307.695) * (-307.964) (-307.432) [-307.228] (-306.025) -- 0:00:35
385000 -- (-306.320) [-309.351] (-309.244) (-311.751) * (-305.958) (-306.230) (-308.209) [-308.240] -- 0:00:35
Average standard deviation of split frequencies: 0.010417
385500 -- (-308.109) (-308.869) [-306.889] (-308.509) * (-308.750) [-310.303] (-308.260) (-309.844) -- 0:00:35
386000 -- (-308.429) [-307.817] (-306.553) (-307.866) * (-307.032) [-308.707] (-309.273) (-311.931) -- 0:00:34
386500 -- (-310.942) (-306.182) (-310.045) [-307.798] * (-306.507) (-314.958) (-307.499) [-307.583] -- 0:00:34
387000 -- [-307.954] (-312.461) (-307.866) (-307.694) * [-308.353] (-309.226) (-308.316) (-308.464) -- 0:00:34
387500 -- (-308.638) (-307.666) [-308.187] (-307.938) * [-307.597] (-307.873) (-307.999) (-307.793) -- 0:00:36
388000 -- [-308.567] (-307.502) (-308.490) (-311.536) * (-309.229) (-306.679) [-311.078] (-307.041) -- 0:00:36
388500 -- (-308.556) [-306.204] (-306.833) (-309.442) * (-308.167) [-308.147] (-307.421) (-309.040) -- 0:00:36
389000 -- [-306.692] (-306.317) (-307.085) (-308.220) * (-312.455) (-311.269) (-307.003) [-307.549] -- 0:00:36
389500 -- (-307.348) [-306.934] (-308.785) (-308.432) * [-308.027] (-311.310) (-309.012) (-309.535) -- 0:00:36
390000 -- (-308.870) [-308.104] (-307.724) (-308.135) * (-308.162) (-307.729) [-308.264] (-306.954) -- 0:00:35
Average standard deviation of split frequencies: 0.009921
390500 -- (-310.751) (-307.595) (-312.281) [-309.795] * (-306.845) (-307.394) [-306.599] (-308.933) -- 0:00:35
391000 -- (-310.455) (-306.630) (-307.950) [-309.022] * (-308.980) (-309.104) (-306.711) [-308.274] -- 0:00:35
391500 -- (-310.654) (-312.494) (-307.607) [-306.649] * (-312.044) [-306.224] (-306.124) (-307.059) -- 0:00:35
392000 -- (-308.062) (-310.898) [-308.013] (-311.383) * [-306.016] (-306.430) (-306.646) (-307.774) -- 0:00:35
392500 -- (-306.823) (-309.862) [-306.716] (-308.710) * (-310.348) (-309.811) (-307.506) [-306.164] -- 0:00:35
393000 -- (-307.547) (-306.300) [-306.485] (-308.351) * [-309.278] (-306.022) (-307.128) (-306.456) -- 0:00:35
393500 -- [-307.198] (-307.270) (-307.639) (-309.417) * (-306.077) (-305.847) (-306.565) [-306.724] -- 0:00:35
394000 -- (-315.893) (-310.311) [-307.817] (-312.166) * (-309.042) [-307.838] (-309.877) (-311.203) -- 0:00:35
394500 -- (-306.721) (-306.750) (-307.486) [-310.383] * [-317.959] (-307.985) (-308.379) (-311.923) -- 0:00:35
395000 -- (-313.767) (-309.016) [-307.755] (-306.652) * [-308.987] (-314.347) (-306.883) (-307.070) -- 0:00:35
Average standard deviation of split frequencies: 0.010185
395500 -- (-308.699) (-306.392) (-308.476) [-309.240] * (-308.346) [-307.799] (-312.766) (-306.817) -- 0:00:35
396000 -- (-305.823) (-309.030) (-306.964) [-309.495] * [-306.199] (-307.900) (-308.739) (-306.399) -- 0:00:35
396500 -- [-306.587] (-308.521) (-306.994) (-306.392) * (-308.532) (-306.715) [-307.442] (-311.359) -- 0:00:35
397000 -- (-308.961) (-310.214) (-307.322) [-306.328] * [-306.832] (-309.529) (-309.182) (-310.723) -- 0:00:34
397500 -- (-307.423) [-309.769] (-306.594) (-307.053) * (-311.274) [-306.586] (-306.745) (-309.011) -- 0:00:34
398000 -- [-309.131] (-308.691) (-312.722) (-307.071) * [-306.021] (-306.740) (-308.626) (-306.891) -- 0:00:34
398500 -- [-307.199] (-307.537) (-306.454) (-307.849) * (-306.658) (-310.340) [-307.227] (-306.425) -- 0:00:34
399000 -- (-307.709) (-307.319) (-305.978) [-312.170] * [-310.598] (-309.605) (-309.383) (-306.854) -- 0:00:34
399500 -- (-306.439) (-307.108) (-310.465) [-308.427] * (-309.965) (-308.684) (-306.851) [-305.968] -- 0:00:34
400000 -- (-308.359) (-306.964) [-307.205] (-306.466) * (-309.473) (-305.937) (-307.564) [-307.004] -- 0:00:34
Average standard deviation of split frequencies: 0.010327
400500 -- (-306.381) [-307.416] (-310.645) (-308.401) * (-308.210) [-311.970] (-313.196) (-310.372) -- 0:00:34
401000 -- (-306.083) (-308.280) [-306.024] (-310.522) * (-307.872) [-306.854] (-306.623) (-309.716) -- 0:00:34
401500 -- (-310.905) [-307.759] (-309.551) (-306.691) * (-308.086) [-306.879] (-307.123) (-310.283) -- 0:00:34
402000 -- (-306.766) (-311.209) [-307.106] (-306.802) * (-310.235) [-307.638] (-311.401) (-309.530) -- 0:00:34
402500 -- (-306.894) (-309.994) [-307.822] (-308.382) * (-307.013) [-307.403] (-309.920) (-305.952) -- 0:00:34
403000 -- (-307.234) (-308.750) (-309.297) [-306.132] * [-307.281] (-307.259) (-306.960) (-305.970) -- 0:00:34
403500 -- (-311.153) (-309.506) [-309.439] (-308.657) * [-306.866] (-310.010) (-306.158) (-307.742) -- 0:00:34
404000 -- (-310.224) (-305.720) [-310.333] (-306.646) * (-310.850) [-311.337] (-306.445) (-306.109) -- 0:00:33
404500 -- (-309.054) (-306.338) (-310.720) [-307.985] * (-310.745) (-308.984) (-306.017) [-306.867] -- 0:00:35
405000 -- (-308.741) (-306.186) [-307.467] (-307.951) * (-315.862) [-308.149] (-306.509) (-308.653) -- 0:00:35
Average standard deviation of split frequencies: 0.010450
405500 -- (-306.260) (-306.680) (-309.826) [-308.677] * (-312.910) (-306.817) (-307.996) [-306.707] -- 0:00:35
406000 -- (-307.893) (-309.958) [-305.570] (-309.414) * (-308.506) [-305.967] (-308.185) (-308.232) -- 0:00:35
406500 -- (-307.107) (-308.535) (-308.438) [-309.086] * (-307.678) [-306.860] (-306.700) (-308.566) -- 0:00:35
407000 -- (-307.236) (-307.829) (-307.520) [-308.344] * (-309.597) (-309.284) (-306.534) [-308.712] -- 0:00:34
407500 -- (-309.496) (-306.932) (-307.276) [-308.780] * (-310.970) [-308.762] (-307.763) (-308.242) -- 0:00:34
408000 -- (-309.594) [-306.613] (-310.174) (-306.581) * (-310.717) (-310.401) (-307.759) [-307.465] -- 0:00:34
408500 -- [-306.254] (-307.872) (-308.932) (-308.191) * (-307.373) (-309.542) [-307.682] (-309.890) -- 0:00:34
409000 -- (-310.303) [-310.195] (-307.339) (-306.372) * (-306.085) (-308.070) (-308.505) [-307.039] -- 0:00:34
409500 -- [-307.779] (-306.520) (-307.197) (-308.527) * [-305.849] (-308.235) (-307.495) (-306.891) -- 0:00:34
410000 -- (-306.790) (-310.157) [-307.363] (-307.013) * (-308.046) [-308.256] (-306.297) (-312.425) -- 0:00:34
Average standard deviation of split frequencies: 0.011096
410500 -- [-306.615] (-308.343) (-308.456) (-308.859) * (-307.222) (-308.028) (-307.117) [-307.227] -- 0:00:34
411000 -- (-307.118) (-307.150) [-306.522] (-310.891) * [-307.683] (-306.209) (-306.911) (-307.448) -- 0:00:34
411500 -- (-308.637) (-310.014) [-306.597] (-307.775) * (-306.435) [-307.680] (-309.003) (-311.533) -- 0:00:34
412000 -- (-307.566) [-308.668] (-309.521) (-311.220) * (-306.715) [-316.063] (-307.903) (-310.691) -- 0:00:34
412500 -- (-307.046) (-308.344) (-310.846) [-310.344] * (-308.809) (-314.646) (-307.800) [-307.956] -- 0:00:34
413000 -- (-308.197) (-310.745) [-308.597] (-316.817) * [-309.451] (-309.095) (-306.966) (-307.948) -- 0:00:34
413500 -- (-308.849) [-306.404] (-307.062) (-307.092) * (-310.041) (-312.456) [-309.768] (-311.466) -- 0:00:34
414000 -- (-307.272) (-309.314) [-307.901] (-306.664) * (-309.262) [-309.094] (-308.314) (-309.529) -- 0:00:33
414500 -- (-311.567) [-308.776] (-305.944) (-305.920) * (-308.396) [-305.641] (-308.899) (-307.658) -- 0:00:33
415000 -- (-308.650) [-306.722] (-308.806) (-307.236) * (-305.886) (-308.098) [-307.313] (-307.840) -- 0:00:33
Average standard deviation of split frequencies: 0.011017
415500 -- (-308.512) [-306.557] (-306.277) (-307.833) * (-308.649) (-305.564) (-308.720) [-310.967] -- 0:00:33
416000 -- (-307.986) [-309.623] (-308.535) (-310.248) * [-306.687] (-306.137) (-306.457) (-308.960) -- 0:00:33
416500 -- (-308.160) (-308.006) [-306.166] (-307.304) * (-307.205) [-307.758] (-306.962) (-308.733) -- 0:00:33
417000 -- [-310.188] (-307.160) (-309.076) (-311.241) * (-307.572) [-307.593] (-310.198) (-311.336) -- 0:00:33
417500 -- (-307.150) (-308.180) (-307.810) [-307.064] * [-306.838] (-307.201) (-306.068) (-310.563) -- 0:00:33
418000 -- (-311.541) (-310.521) [-311.493] (-309.736) * [-307.780] (-308.014) (-307.113) (-310.715) -- 0:00:33
418500 -- [-306.637] (-307.354) (-308.169) (-309.922) * [-308.235] (-307.451) (-310.126) (-310.559) -- 0:00:33
419000 -- (-307.817) (-308.542) [-306.624] (-307.280) * (-308.644) [-309.310] (-311.867) (-310.823) -- 0:00:33
419500 -- [-313.743] (-309.357) (-306.945) (-308.996) * (-309.365) [-307.911] (-306.452) (-306.109) -- 0:00:33
420000 -- (-307.198) [-307.740] (-308.791) (-307.239) * (-311.928) (-308.533) (-308.332) [-306.859] -- 0:00:33
Average standard deviation of split frequencies: 0.010679
420500 -- (-307.450) (-307.921) [-307.589] (-307.683) * (-306.029) [-309.516] (-309.456) (-306.663) -- 0:00:33
421000 -- (-309.985) (-306.635) [-306.039] (-306.285) * [-306.170] (-309.347) (-306.365) (-306.562) -- 0:00:34
421500 -- (-309.556) [-307.064] (-309.756) (-312.549) * (-307.189) (-309.974) (-307.772) [-307.203] -- 0:00:34
422000 -- (-308.272) [-307.878] (-307.441) (-306.582) * (-307.503) (-306.217) (-317.681) [-308.154] -- 0:00:34
422500 -- [-307.667] (-307.568) (-306.973) (-308.501) * (-311.314) [-306.982] (-309.681) (-307.549) -- 0:00:34
423000 -- (-308.230) (-306.513) (-307.005) [-308.135] * (-308.286) (-310.879) (-306.500) [-306.699] -- 0:00:34
423500 -- (-311.368) [-307.214] (-307.731) (-308.665) * (-307.338) [-309.358] (-307.438) (-307.203) -- 0:00:34
424000 -- (-309.517) (-314.970) [-308.139] (-305.974) * (-307.518) (-305.882) (-307.969) [-307.433] -- 0:00:33
424500 -- (-311.495) (-309.413) (-308.007) [-307.447] * (-309.944) (-307.066) [-306.335] (-306.193) -- 0:00:33
425000 -- (-307.463) (-308.424) [-308.836] (-307.062) * (-309.440) [-310.702] (-308.501) (-307.979) -- 0:00:33
Average standard deviation of split frequencies: 0.010415
425500 -- (-306.635) [-308.425] (-307.830) (-310.031) * (-306.743) [-313.478] (-306.727) (-309.834) -- 0:00:33
426000 -- (-307.414) (-308.579) [-313.383] (-308.398) * (-306.913) [-309.474] (-306.149) (-307.286) -- 0:00:33
426500 -- (-308.254) (-312.737) (-309.208) [-308.540] * (-308.957) (-310.725) [-307.357] (-309.174) -- 0:00:33
427000 -- (-309.423) (-309.314) [-307.691] (-306.594) * [-307.615] (-307.709) (-307.496) (-313.913) -- 0:00:33
427500 -- (-310.364) (-306.202) (-308.010) [-306.121] * (-307.466) (-308.574) (-306.711) [-306.690] -- 0:00:33
428000 -- (-306.419) [-307.152] (-307.575) (-307.630) * (-310.326) [-310.243] (-306.679) (-307.333) -- 0:00:33
428500 -- [-307.715] (-307.866) (-308.011) (-307.574) * (-308.706) (-307.178) [-307.726] (-309.197) -- 0:00:33
429000 -- (-306.129) (-309.044) (-308.065) [-311.823] * [-306.544] (-307.603) (-305.614) (-309.144) -- 0:00:33
429500 -- (-310.832) (-305.616) (-306.274) [-306.569] * (-306.617) [-306.209] (-306.410) (-307.047) -- 0:00:33
430000 -- [-306.563] (-307.090) (-307.374) (-306.150) * [-307.563] (-306.535) (-306.285) (-306.782) -- 0:00:33
Average standard deviation of split frequencies: 0.010173
430500 -- [-307.312] (-305.848) (-308.249) (-308.205) * (-306.081) (-308.320) (-306.130) [-305.864] -- 0:00:33
431000 -- (-306.437) (-307.081) (-307.706) [-308.041] * (-310.154) (-308.641) (-308.752) [-307.237] -- 0:00:33
431500 -- (-308.829) (-309.236) (-307.351) [-309.283] * (-310.835) [-309.655] (-310.081) (-307.289) -- 0:00:32
432000 -- (-307.003) (-307.555) (-305.653) [-306.306] * (-309.665) (-305.882) [-306.921] (-307.190) -- 0:00:32
432500 -- [-306.343] (-308.932) (-305.712) (-307.846) * [-307.238] (-306.014) (-306.841) (-307.488) -- 0:00:32
433000 -- (-308.160) (-309.193) [-308.724] (-306.759) * (-306.563) (-306.322) (-306.606) [-312.374] -- 0:00:32
433500 -- [-307.769] (-308.226) (-313.970) (-310.731) * (-305.738) (-307.402) (-305.982) [-308.052] -- 0:00:32
434000 -- (-310.499) [-306.415] (-308.471) (-306.847) * [-306.802] (-307.417) (-307.290) (-307.156) -- 0:00:32
434500 -- (-309.455) (-307.843) (-309.808) [-306.198] * [-306.842] (-306.071) (-307.673) (-308.268) -- 0:00:32
435000 -- (-308.935) (-307.893) (-305.961) [-306.653] * [-308.406] (-306.219) (-308.242) (-307.440) -- 0:00:32
Average standard deviation of split frequencies: 0.009922
435500 -- (-307.729) (-308.818) (-306.698) [-307.189] * [-309.022] (-312.337) (-310.967) (-308.719) -- 0:00:32
436000 -- (-307.457) (-309.443) (-309.881) [-309.986] * (-306.146) (-309.528) [-307.298] (-313.841) -- 0:00:32
436500 -- (-307.484) (-306.909) [-311.685] (-309.660) * (-312.090) (-310.449) (-307.875) [-311.201] -- 0:00:32
437000 -- (-306.074) (-308.762) [-306.136] (-319.472) * [-307.528] (-308.301) (-307.397) (-315.919) -- 0:00:32
437500 -- (-307.043) (-308.911) [-307.455] (-308.281) * [-306.533] (-307.502) (-306.403) (-312.125) -- 0:00:32
438000 -- [-307.087] (-310.360) (-307.218) (-307.675) * [-305.754] (-306.201) (-308.193) (-310.071) -- 0:00:32
438500 -- (-310.273) (-311.993) (-307.607) [-306.637] * [-306.648] (-308.123) (-312.003) (-308.158) -- 0:00:33
439000 -- [-307.575] (-310.868) (-309.037) (-307.782) * (-306.649) (-308.930) (-310.432) [-307.414] -- 0:00:33
439500 -- (-306.089) [-307.690] (-310.834) (-307.202) * (-306.053) (-310.339) (-306.349) [-306.690] -- 0:00:33
440000 -- (-306.751) (-308.635) [-307.033] (-308.943) * (-305.823) (-307.529) (-305.544) [-311.092] -- 0:00:33
Average standard deviation of split frequencies: 0.010068
440500 -- (-308.684) [-307.183] (-306.993) (-309.513) * (-307.412) [-309.572] (-307.801) (-309.036) -- 0:00:33
441000 -- (-306.501) (-305.975) [-309.355] (-312.086) * [-310.834] (-309.287) (-306.537) (-310.815) -- 0:00:32
441500 -- [-309.007] (-307.526) (-309.362) (-312.651) * [-308.375] (-305.792) (-312.870) (-309.038) -- 0:00:32
442000 -- (-312.819) [-309.558] (-307.354) (-308.200) * [-309.874] (-307.914) (-307.247) (-306.685) -- 0:00:32
442500 -- [-308.048] (-310.842) (-310.110) (-306.332) * (-308.787) (-307.074) (-310.372) [-306.110] -- 0:00:32
443000 -- [-315.281] (-308.708) (-308.830) (-308.213) * (-307.023) (-309.359) (-309.396) [-306.544] -- 0:00:32
443500 -- (-311.068) [-309.464] (-307.910) (-306.702) * (-308.890) [-309.631] (-307.595) (-307.151) -- 0:00:32
444000 -- (-309.178) (-306.003) [-309.418] (-309.508) * (-314.093) (-306.341) [-307.163] (-307.082) -- 0:00:32
444500 -- (-308.143) (-307.846) [-309.428] (-307.863) * (-309.629) (-306.737) [-309.406] (-307.098) -- 0:00:32
445000 -- (-308.758) (-306.950) (-306.471) [-309.420] * [-307.245] (-308.823) (-309.194) (-315.910) -- 0:00:32
Average standard deviation of split frequencies: 0.009575
445500 -- (-307.934) (-306.946) [-307.138] (-308.177) * (-307.549) (-307.717) [-306.747] (-308.503) -- 0:00:32
446000 -- (-307.597) (-306.503) (-308.808) [-308.681] * (-305.835) (-312.225) (-309.774) [-307.464] -- 0:00:32
446500 -- (-306.882) [-306.142] (-306.399) (-313.070) * (-305.707) (-309.281) [-306.583] (-307.592) -- 0:00:32
447000 -- (-309.451) [-306.275] (-308.606) (-307.383) * (-306.955) (-309.860) (-308.071) [-308.888] -- 0:00:32
447500 -- (-312.302) (-308.695) (-307.424) [-309.478] * [-308.081] (-307.070) (-306.485) (-308.362) -- 0:00:32
448000 -- (-308.639) (-309.501) (-306.931) [-307.685] * (-308.520) (-307.622) (-306.499) [-311.653] -- 0:00:32
448500 -- [-308.431] (-311.619) (-309.892) (-311.060) * (-307.146) (-307.974) [-312.000] (-306.908) -- 0:00:31
449000 -- (-306.167) [-307.502] (-308.767) (-310.643) * (-307.307) (-307.778) (-310.174) [-306.394] -- 0:00:31
449500 -- (-309.649) (-306.153) [-310.887] (-306.280) * (-310.437) (-307.101) [-306.638] (-306.650) -- 0:00:31
450000 -- (-310.388) (-308.697) (-313.942) [-309.525] * (-308.010) (-308.397) (-305.656) [-306.291] -- 0:00:31
Average standard deviation of split frequencies: 0.009414
450500 -- (-308.116) (-310.587) (-313.128) [-306.092] * (-308.778) (-308.131) (-306.329) [-306.354] -- 0:00:31
451000 -- (-307.799) (-318.992) (-307.330) [-307.385] * [-307.585] (-308.675) (-308.025) (-307.181) -- 0:00:31
451500 -- (-306.196) [-306.056] (-309.147) (-306.893) * [-307.540] (-307.742) (-306.708) (-306.934) -- 0:00:31
452000 -- [-307.611] (-308.334) (-307.530) (-307.545) * (-307.255) [-308.629] (-309.602) (-306.886) -- 0:00:31
452500 -- (-306.674) [-307.810] (-312.033) (-308.225) * (-308.227) [-309.196] (-307.066) (-306.428) -- 0:00:31
453000 -- (-308.164) (-306.862) (-310.774) [-308.941] * [-309.530] (-310.017) (-307.087) (-308.636) -- 0:00:31
453500 -- (-308.438) (-308.338) [-307.413] (-310.138) * (-309.219) (-306.026) (-307.043) [-309.253] -- 0:00:31
454000 -- (-307.544) [-308.346] (-307.511) (-306.445) * (-309.462) (-309.699) (-307.299) [-306.622] -- 0:00:31
454500 -- [-306.912] (-311.942) (-305.908) (-306.157) * (-307.943) (-307.628) (-311.688) [-308.087] -- 0:00:31
455000 -- (-312.485) (-308.360) (-307.258) [-305.823] * (-306.881) [-310.305] (-308.839) (-307.622) -- 0:00:31
Average standard deviation of split frequencies: 0.009973
455500 -- (-306.306) (-308.964) [-307.175] (-308.608) * (-307.100) (-309.503) [-307.011] (-307.472) -- 0:00:32
456000 -- (-306.611) (-307.236) [-306.925] (-308.214) * (-306.959) (-307.243) (-312.763) [-308.178] -- 0:00:32
456500 -- (-309.568) (-308.653) (-306.796) [-308.038] * (-310.481) (-310.899) [-307.340] (-308.534) -- 0:00:32
457000 -- (-307.311) (-307.043) (-307.664) [-308.356] * (-306.450) (-306.936) [-307.562] (-306.198) -- 0:00:32
457500 -- (-309.885) [-306.780] (-309.727) (-310.573) * [-307.624] (-306.886) (-309.622) (-305.743) -- 0:00:32
458000 -- (-309.519) [-307.441] (-312.003) (-307.819) * (-307.799) (-311.875) (-306.845) [-307.275] -- 0:00:31
458500 -- (-307.541) (-306.622) [-307.019] (-307.671) * (-307.348) [-308.192] (-306.705) (-309.412) -- 0:00:31
459000 -- (-306.201) (-308.799) (-306.858) [-307.078] * (-306.672) [-307.359] (-308.762) (-307.917) -- 0:00:31
459500 -- (-311.835) [-305.955] (-312.362) (-308.732) * [-307.336] (-307.301) (-310.636) (-306.542) -- 0:00:31
460000 -- (-306.289) (-308.202) (-308.595) [-307.766] * (-310.116) (-307.478) [-309.686] (-307.765) -- 0:00:31
Average standard deviation of split frequencies: 0.009691
460500 -- (-309.190) (-307.958) [-307.528] (-308.618) * (-307.367) (-309.049) [-306.898] (-310.983) -- 0:00:31
461000 -- (-310.233) (-306.633) (-307.440) [-306.999] * (-311.574) (-306.813) [-306.765] (-310.298) -- 0:00:31
461500 -- (-308.527) (-305.963) (-308.437) [-306.276] * (-310.498) [-310.980] (-311.050) (-311.238) -- 0:00:31
462000 -- (-307.581) (-310.024) (-307.541) [-305.994] * (-307.666) (-307.713) [-308.108] (-306.350) -- 0:00:31
462500 -- (-308.105) [-306.067] (-308.928) (-306.804) * (-307.819) (-310.121) (-306.442) [-306.740] -- 0:00:31
463000 -- (-307.131) [-305.778] (-312.419) (-307.943) * (-309.601) (-311.539) (-306.028) [-307.488] -- 0:00:31
463500 -- (-311.934) (-306.759) [-309.316] (-306.101) * (-306.856) (-314.326) [-306.122] (-306.163) -- 0:00:31
464000 -- (-306.909) (-310.779) [-309.642] (-305.542) * (-309.338) [-308.260] (-306.355) (-307.317) -- 0:00:31
464500 -- (-310.841) (-307.427) [-308.715] (-306.354) * (-308.499) (-307.356) [-311.618] (-310.937) -- 0:00:31
465000 -- (-311.093) (-310.734) (-307.200) [-306.267] * (-312.005) (-306.353) [-307.028] (-309.932) -- 0:00:31
Average standard deviation of split frequencies: 0.010004
465500 -- (-308.929) (-309.803) [-306.536] (-309.102) * (-308.638) (-306.282) (-308.359) [-308.513] -- 0:00:31
466000 -- [-312.546] (-310.380) (-308.064) (-308.172) * (-307.531) (-309.230) (-309.637) [-308.336] -- 0:00:30
466500 -- (-307.760) [-307.267] (-312.487) (-308.815) * (-310.203) (-309.703) (-307.807) [-307.106] -- 0:00:30
467000 -- (-306.990) [-306.637] (-314.581) (-308.918) * (-309.210) (-308.353) [-306.951] (-309.334) -- 0:00:30
467500 -- [-307.878] (-307.571) (-306.848) (-307.617) * [-310.616] (-308.295) (-306.927) (-307.101) -- 0:00:30
468000 -- (-307.583) (-307.943) (-312.096) [-306.817] * (-306.396) (-310.810) (-310.834) [-307.005] -- 0:00:30
468500 -- (-307.506) [-308.219] (-307.394) (-306.404) * [-307.406] (-309.774) (-307.960) (-308.240) -- 0:00:30
469000 -- (-306.206) (-308.338) [-307.486] (-310.563) * (-306.913) (-309.172) (-306.778) [-308.140] -- 0:00:30
469500 -- (-306.644) (-308.621) [-308.777] (-308.646) * (-308.359) [-307.593] (-306.455) (-309.504) -- 0:00:30
470000 -- [-306.015] (-308.371) (-307.024) (-307.183) * [-307.093] (-306.726) (-306.175) (-308.047) -- 0:00:30
Average standard deviation of split frequencies: 0.009292
470500 -- (-306.913) (-311.071) [-309.055] (-308.944) * (-309.597) (-307.910) (-308.878) [-307.660] -- 0:00:30
471000 -- (-309.204) (-310.930) [-308.096] (-306.448) * (-306.367) (-307.227) [-309.447] (-307.987) -- 0:00:30
471500 -- [-307.826] (-310.230) (-315.917) (-307.257) * (-310.802) [-308.881] (-309.870) (-309.224) -- 0:00:30
472000 -- (-311.655) [-306.585] (-311.636) (-308.482) * [-307.885] (-307.935) (-308.254) (-311.746) -- 0:00:31
472500 -- (-308.139) (-308.577) [-310.002] (-311.378) * (-312.570) (-307.045) [-306.091] (-310.476) -- 0:00:31
473000 -- [-307.204] (-308.083) (-307.282) (-312.510) * (-306.833) [-306.899] (-309.596) (-307.943) -- 0:00:31
473500 -- (-310.228) [-306.000] (-306.195) (-312.366) * (-308.889) (-307.590) [-307.755] (-307.247) -- 0:00:31
474000 -- (-308.278) (-307.806) (-305.545) [-309.123] * (-309.791) (-308.502) [-306.487] (-308.260) -- 0:00:31
474500 -- [-306.463] (-306.918) (-312.298) (-308.563) * (-308.544) (-306.605) (-307.891) [-307.754] -- 0:00:31
475000 -- [-310.170] (-307.680) (-309.188) (-307.912) * (-308.927) [-306.056] (-309.705) (-311.577) -- 0:00:30
Average standard deviation of split frequencies: 0.008680
475500 -- (-306.497) (-306.981) (-309.429) [-307.665] * (-306.481) (-307.952) (-308.858) [-307.720] -- 0:00:30
476000 -- (-307.151) (-308.605) [-308.822] (-308.030) * (-307.954) [-305.511] (-308.039) (-306.858) -- 0:00:30
476500 -- [-307.597] (-309.836) (-306.610) (-308.748) * (-311.341) (-307.911) [-307.991] (-311.070) -- 0:00:30
477000 -- (-306.690) (-306.487) [-307.123] (-312.245) * (-308.454) [-307.953] (-307.383) (-313.355) -- 0:00:30
477500 -- [-306.597] (-307.175) (-307.676) (-308.236) * [-307.162] (-308.158) (-305.802) (-312.181) -- 0:00:30
478000 -- (-307.049) (-309.735) (-307.380) [-307.882] * (-306.832) [-308.172] (-307.005) (-307.929) -- 0:00:30
478500 -- [-307.998] (-306.962) (-309.601) (-308.799) * [-307.523] (-308.196) (-308.313) (-309.523) -- 0:00:30
479000 -- (-306.759) (-306.486) (-309.186) [-307.587] * (-307.495) [-306.198] (-311.364) (-309.295) -- 0:00:30
479500 -- (-307.938) (-306.854) [-308.541] (-308.904) * (-308.177) (-305.807) (-308.643) [-307.366] -- 0:00:30
480000 -- (-310.303) (-307.808) (-307.633) [-306.126] * (-306.352) (-309.550) [-308.405] (-308.410) -- 0:00:30
Average standard deviation of split frequencies: 0.008019
480500 -- [-306.331] (-308.669) (-306.912) (-307.496) * (-306.837) (-311.378) (-309.527) [-306.496] -- 0:00:30
481000 -- (-306.153) [-306.645] (-305.606) (-310.257) * (-309.431) [-306.335] (-306.527) (-310.312) -- 0:00:30
481500 -- (-306.509) (-306.950) (-306.074) [-309.567] * (-309.719) (-310.393) [-305.918] (-305.939) -- 0:00:30
482000 -- (-308.375) (-310.481) (-309.181) [-310.507] * [-306.886] (-308.094) (-308.681) (-306.602) -- 0:00:30
482500 -- (-308.353) (-306.549) [-311.098] (-309.306) * (-306.142) (-308.676) (-308.115) [-307.746] -- 0:00:30
483000 -- (-306.131) (-310.901) (-308.710) [-307.308] * (-306.539) [-307.897] (-307.130) (-306.918) -- 0:00:29
483500 -- (-308.981) (-309.002) (-310.928) [-308.443] * [-307.905] (-307.557) (-308.458) (-306.498) -- 0:00:29
484000 -- (-307.733) (-308.735) (-308.431) [-306.407] * (-309.632) (-308.451) [-306.352] (-308.622) -- 0:00:29
484500 -- [-306.953] (-307.619) (-305.873) (-309.076) * (-309.271) (-310.107) (-307.457) [-309.326] -- 0:00:29
485000 -- (-306.666) [-306.243] (-309.294) (-307.890) * (-318.885) [-306.737] (-308.164) (-307.698) -- 0:00:29
Average standard deviation of split frequencies: 0.007760
485500 -- (-309.247) (-307.514) [-306.507] (-307.197) * (-309.063) [-307.089] (-309.251) (-308.060) -- 0:00:29
486000 -- [-306.509] (-311.429) (-308.993) (-308.393) * (-306.627) (-308.685) (-307.847) [-307.506] -- 0:00:29
486500 -- (-307.135) (-308.995) [-307.030] (-310.164) * [-307.301] (-306.371) (-307.201) (-306.182) -- 0:00:29
487000 -- (-310.392) (-307.805) (-306.358) [-306.654] * [-307.435] (-307.170) (-306.090) (-307.728) -- 0:00:29
487500 -- (-307.022) (-307.894) [-307.924] (-310.115) * (-306.632) (-307.224) (-307.943) [-307.539] -- 0:00:29
488000 -- (-308.116) [-306.903] (-306.285) (-309.081) * [-311.253] (-306.571) (-307.920) (-308.714) -- 0:00:29
488500 -- (-310.756) [-307.089] (-307.475) (-306.749) * (-309.586) (-309.221) (-308.859) [-306.812] -- 0:00:30
489000 -- (-310.285) [-308.834] (-307.794) (-306.299) * (-308.027) [-309.664] (-308.491) (-309.826) -- 0:00:30
489500 -- (-308.691) [-306.959] (-306.543) (-306.345) * (-311.785) [-311.148] (-309.229) (-306.487) -- 0:00:30
490000 -- (-307.278) (-307.064) (-306.348) [-309.528] * (-308.768) (-307.371) [-309.188] (-306.136) -- 0:00:30
Average standard deviation of split frequencies: 0.008760
490500 -- (-307.115) [-306.358] (-306.399) (-308.275) * (-309.547) (-306.521) [-307.507] (-307.871) -- 0:00:30
491000 -- [-306.095] (-308.116) (-306.205) (-307.942) * (-314.277) (-312.975) (-307.657) [-306.941] -- 0:00:30
491500 -- (-312.991) (-305.838) (-311.644) [-306.475] * [-311.086] (-307.395) (-308.023) (-305.882) -- 0:00:30
492000 -- (-306.539) [-305.758] (-310.717) (-307.432) * [-309.639] (-308.067) (-311.616) (-312.490) -- 0:00:29
492500 -- (-309.589) (-306.668) (-310.795) [-306.829] * (-309.482) [-306.428] (-309.337) (-307.682) -- 0:00:29
493000 -- (-310.224) (-309.703) (-306.926) [-307.640] * [-305.620] (-308.768) (-307.036) (-310.131) -- 0:00:29
493500 -- (-309.808) [-307.232] (-314.411) (-308.200) * (-307.808) (-310.059) (-309.689) [-310.852] -- 0:00:29
494000 -- [-307.637] (-312.080) (-307.294) (-306.486) * (-308.332) (-307.737) (-310.945) [-308.117] -- 0:00:29
494500 -- [-307.496] (-308.229) (-306.461) (-306.476) * (-310.100) (-309.047) (-307.954) [-306.540] -- 0:00:29
495000 -- (-306.159) (-312.132) (-306.154) [-309.664] * (-307.249) [-308.919] (-307.931) (-307.221) -- 0:00:29
Average standard deviation of split frequencies: 0.008554
495500 -- (-307.651) [-309.438] (-306.311) (-306.028) * (-309.215) (-306.223) (-311.777) [-306.622] -- 0:00:29
496000 -- (-307.959) [-306.106] (-309.236) (-306.179) * (-312.894) [-306.494] (-307.782) (-311.876) -- 0:00:29
496500 -- (-310.962) (-306.225) (-307.661) [-307.107] * (-308.154) [-307.058] (-307.412) (-305.799) -- 0:00:29
497000 -- (-306.042) [-307.214] (-308.363) (-306.545) * (-314.054) (-312.990) (-306.265) [-309.523] -- 0:00:29
497500 -- [-307.308] (-306.069) (-312.161) (-307.606) * (-310.096) (-316.896) [-306.039] (-307.175) -- 0:00:29
498000 -- (-307.054) (-308.611) [-307.808] (-307.193) * [-308.331] (-307.956) (-312.517) (-308.457) -- 0:00:29
498500 -- (-305.879) (-308.986) [-306.792] (-307.720) * [-310.074] (-307.949) (-308.554) (-306.078) -- 0:00:29
499000 -- (-306.704) (-310.352) [-307.673] (-306.782) * (-308.030) (-308.127) (-315.893) [-306.216] -- 0:00:29
499500 -- (-308.518) [-309.048] (-306.531) (-307.501) * (-307.342) (-307.727) [-307.429] (-307.832) -- 0:00:29
500000 -- [-310.222] (-312.006) (-307.045) (-307.308) * [-306.845] (-308.193) (-308.401) (-310.084) -- 0:00:29
Average standard deviation of split frequencies: 0.008806
500500 -- (-307.581) (-308.578) [-308.260] (-309.870) * (-309.324) [-306.040] (-309.522) (-307.275) -- 0:00:28
501000 -- (-306.562) [-310.233] (-306.993) (-306.918) * (-311.379) (-308.009) [-306.920] (-306.606) -- 0:00:28
501500 -- (-308.359) (-307.596) [-307.046] (-306.484) * [-306.999] (-307.120) (-310.098) (-308.573) -- 0:00:28
502000 -- (-310.899) [-306.344] (-306.916) (-309.077) * (-308.866) (-306.495) [-308.393] (-306.601) -- 0:00:28
502500 -- (-308.093) [-306.112] (-307.657) (-310.058) * (-308.921) (-306.960) [-309.248] (-306.536) -- 0:00:28
503000 -- (-306.629) (-305.906) [-306.720] (-308.673) * [-306.453] (-308.271) (-308.738) (-305.767) -- 0:00:28
503500 -- [-306.872] (-305.906) (-308.579) (-307.622) * (-307.136) (-306.381) [-307.251] (-310.535) -- 0:00:28
504000 -- (-310.866) (-307.275) (-311.129) [-311.084] * (-307.263) [-308.673] (-309.771) (-308.329) -- 0:00:28
504500 -- (-312.081) [-306.067] (-308.867) (-310.854) * (-308.813) (-311.307) (-310.948) [-313.050] -- 0:00:29
505000 -- [-307.561] (-308.966) (-308.135) (-309.528) * [-308.345] (-308.706) (-311.254) (-308.170) -- 0:00:29
Average standard deviation of split frequencies: 0.008933
505500 -- (-306.984) (-306.206) (-309.557) [-311.287] * (-305.808) [-309.675] (-307.624) (-309.477) -- 0:00:29
506000 -- (-307.607) (-307.312) (-307.332) [-307.312] * [-308.027] (-312.424) (-307.066) (-310.735) -- 0:00:29
506500 -- (-311.541) (-307.158) [-307.358] (-311.652) * (-307.977) [-308.881] (-306.006) (-308.887) -- 0:00:29
507000 -- (-309.074) (-309.710) [-308.601] (-309.618) * [-307.036] (-306.072) (-305.893) (-307.534) -- 0:00:29
507500 -- (-308.381) (-311.064) (-308.096) [-307.226] * (-306.866) [-311.635] (-307.035) (-308.035) -- 0:00:29
508000 -- (-309.160) (-312.220) (-307.897) [-305.871] * (-309.327) [-307.101] (-311.151) (-305.781) -- 0:00:29
508500 -- (-306.580) (-309.641) [-307.350] (-305.696) * (-305.653) (-307.727) [-309.250] (-308.088) -- 0:00:28
509000 -- (-307.198) (-309.261) (-307.309) [-314.190] * (-307.515) [-307.100] (-306.590) (-306.201) -- 0:00:28
509500 -- (-307.293) (-309.567) [-308.884] (-308.715) * (-306.791) (-306.893) [-311.571] (-311.259) -- 0:00:28
510000 -- (-307.151) (-310.447) (-308.064) [-310.832] * (-307.461) [-306.950] (-308.915) (-308.951) -- 0:00:28
Average standard deviation of split frequencies: 0.009666
510500 -- [-308.131] (-308.640) (-306.061) (-309.157) * (-307.984) (-306.851) (-308.995) [-309.162] -- 0:00:28
511000 -- (-305.944) (-306.843) (-305.707) [-309.053] * (-310.598) [-308.479] (-308.855) (-314.448) -- 0:00:28
511500 -- (-309.389) (-311.526) [-306.352] (-308.026) * (-307.447) [-306.481] (-306.538) (-306.754) -- 0:00:28
512000 -- (-310.899) [-309.246] (-308.101) (-311.073) * (-306.090) (-306.898) [-310.855] (-308.627) -- 0:00:28
512500 -- (-309.113) (-307.035) (-310.600) [-307.540] * (-305.842) (-306.245) [-309.426] (-307.269) -- 0:00:28
513000 -- (-311.596) (-307.277) (-309.031) [-307.807] * (-306.215) [-307.141] (-309.829) (-308.800) -- 0:00:28
513500 -- (-307.553) (-309.195) [-308.778] (-309.193) * (-306.029) [-307.378] (-309.039) (-309.344) -- 0:00:28
514000 -- (-309.959) (-307.072) [-306.207] (-309.353) * (-308.690) (-305.710) (-307.297) [-307.242] -- 0:00:28
514500 -- [-310.046] (-310.773) (-307.916) (-311.654) * (-308.939) (-307.679) (-308.377) [-306.874] -- 0:00:28
515000 -- (-307.745) [-308.587] (-315.618) (-307.647) * (-306.450) (-307.690) (-306.074) [-307.514] -- 0:00:28
Average standard deviation of split frequencies: 0.009404
515500 -- (-307.263) (-308.897) [-308.277] (-306.431) * (-306.746) (-306.045) (-309.432) [-307.010] -- 0:00:28
516000 -- [-306.679] (-308.979) (-307.829) (-307.175) * (-305.979) (-306.150) (-308.931) [-307.127] -- 0:00:28
516500 -- (-308.430) [-308.887] (-309.032) (-307.053) * (-309.059) (-306.334) (-309.262) [-306.796] -- 0:00:28
517000 -- (-308.239) (-308.816) [-308.031] (-307.000) * (-309.325) (-306.916) (-307.634) [-306.105] -- 0:00:28
517500 -- (-310.094) (-309.017) [-310.104] (-309.950) * (-306.795) [-305.788] (-306.473) (-312.451) -- 0:00:27
518000 -- (-305.826) [-309.074] (-311.696) (-311.577) * [-309.905] (-309.411) (-309.176) (-308.702) -- 0:00:27
518500 -- (-306.177) (-317.465) (-307.694) [-312.285] * [-308.784] (-309.525) (-309.197) (-311.847) -- 0:00:27
519000 -- [-306.223] (-311.350) (-313.771) (-306.507) * (-307.818) (-308.238) [-308.338] (-305.980) -- 0:00:27
519500 -- (-306.621) (-307.409) [-310.794] (-307.507) * (-308.818) (-312.146) (-306.089) [-305.954] -- 0:00:27
520000 -- (-309.513) (-309.261) [-309.257] (-307.929) * [-310.274] (-309.991) (-307.402) (-306.687) -- 0:00:27
Average standard deviation of split frequencies: 0.009640
520500 -- [-310.331] (-307.612) (-315.132) (-309.743) * (-307.421) (-308.479) [-307.123] (-307.069) -- 0:00:27
521000 -- (-307.008) [-308.270] (-315.854) (-307.181) * (-307.343) (-307.951) [-306.437] (-308.060) -- 0:00:28
521500 -- (-305.955) (-307.899) [-306.940] (-305.714) * [-306.841] (-306.061) (-310.547) (-309.092) -- 0:00:28
522000 -- (-307.031) [-306.064] (-307.830) (-308.667) * (-306.699) (-306.576) (-311.538) [-307.354] -- 0:00:28
522500 -- (-308.001) (-306.315) (-305.906) [-307.329] * (-311.031) [-306.549] (-312.489) (-305.742) -- 0:00:28
523000 -- (-310.213) (-310.126) [-306.767] (-306.324) * (-308.026) (-306.642) (-311.475) [-309.372] -- 0:00:28
523500 -- (-308.594) (-307.449) [-306.217] (-306.955) * (-307.709) [-306.849] (-312.401) (-309.102) -- 0:00:28
524000 -- [-307.330] (-310.953) (-306.875) (-306.601) * [-307.090] (-307.485) (-306.212) (-307.476) -- 0:00:28
524500 -- [-309.719] (-305.556) (-314.447) (-308.380) * (-309.466) [-308.434] (-307.475) (-307.394) -- 0:00:28
525000 -- (-311.009) (-309.270) [-306.717] (-307.361) * (-306.908) (-308.661) (-305.701) [-308.130] -- 0:00:28
Average standard deviation of split frequencies: 0.008698
525500 -- (-306.590) [-305.614] (-307.376) (-306.300) * (-309.553) [-307.864] (-308.629) (-307.211) -- 0:00:27
526000 -- (-307.392) [-305.667] (-306.062) (-306.472) * [-307.692] (-306.412) (-306.337) (-312.029) -- 0:00:27
526500 -- (-307.108) [-307.562] (-307.456) (-308.177) * (-310.569) [-308.582] (-306.960) (-306.354) -- 0:00:27
527000 -- (-311.698) (-314.227) [-310.495] (-307.936) * [-307.612] (-307.366) (-306.847) (-309.264) -- 0:00:27
527500 -- [-307.189] (-308.337) (-309.085) (-307.402) * (-307.668) (-306.577) [-306.582] (-311.477) -- 0:00:27
528000 -- (-309.372) (-309.634) (-308.142) [-311.182] * (-309.263) [-305.911] (-307.020) (-313.533) -- 0:00:27
528500 -- (-306.327) (-308.006) [-307.426] (-309.505) * (-309.960) (-309.600) [-306.963] (-307.873) -- 0:00:27
529000 -- (-307.729) (-308.497) [-307.626] (-307.339) * (-307.303) (-308.439) [-306.524] (-310.598) -- 0:00:27
529500 -- (-307.892) (-311.968) (-309.251) [-306.665] * (-307.500) (-309.358) [-307.247] (-308.166) -- 0:00:27
530000 -- (-307.772) (-309.453) [-307.150] (-309.417) * (-308.425) (-308.214) (-307.341) [-305.906] -- 0:00:27
Average standard deviation of split frequencies: 0.008550
530500 -- [-308.267] (-308.472) (-306.623) (-307.894) * (-307.295) (-306.718) [-306.483] (-310.724) -- 0:00:27
531000 -- (-309.623) [-308.746] (-309.654) (-306.923) * (-308.364) [-309.176] (-308.442) (-306.564) -- 0:00:27
531500 -- (-307.170) [-309.060] (-307.225) (-306.341) * (-307.552) (-308.154) [-309.932] (-306.262) -- 0:00:27
532000 -- (-310.466) (-306.235) [-308.350] (-307.525) * [-308.144] (-308.325) (-311.601) (-310.620) -- 0:00:27
532500 -- (-307.052) [-306.330] (-308.398) (-308.330) * (-309.917) (-311.473) [-309.135] (-315.683) -- 0:00:27
533000 -- [-309.886] (-306.965) (-308.847) (-307.036) * (-310.163) (-306.739) (-311.554) [-307.921] -- 0:00:27
533500 -- (-307.565) (-306.792) [-306.465] (-311.019) * (-307.796) [-307.199] (-309.777) (-311.045) -- 0:00:27
534000 -- (-308.337) (-306.664) [-310.941] (-315.860) * [-306.725] (-307.528) (-308.116) (-309.897) -- 0:00:27
534500 -- (-306.049) [-306.922] (-306.950) (-311.263) * (-306.554) [-305.949] (-306.316) (-307.596) -- 0:00:26
535000 -- (-307.873) [-306.008] (-311.298) (-309.070) * (-309.097) (-305.624) [-307.489] (-307.721) -- 0:00:26
Average standard deviation of split frequencies: 0.008575
535500 -- [-307.575] (-306.625) (-311.427) (-307.323) * [-310.480] (-305.705) (-309.474) (-308.391) -- 0:00:26
536000 -- (-309.352) (-306.668) (-311.158) [-308.873] * (-306.406) [-308.131] (-313.892) (-307.005) -- 0:00:26
536500 -- (-308.904) [-309.294] (-311.439) (-311.426) * (-306.680) [-311.193] (-306.136) (-306.115) -- 0:00:26
537000 -- (-308.379) [-310.621] (-307.486) (-308.706) * (-308.412) (-308.656) [-306.367] (-306.112) -- 0:00:26
537500 -- (-310.260) (-306.643) [-307.563] (-306.888) * (-306.917) (-310.266) [-306.576] (-308.915) -- 0:00:26
538000 -- (-310.527) (-306.452) (-306.440) [-306.682] * (-309.062) [-307.255] (-309.892) (-305.944) -- 0:00:27
538500 -- [-308.439] (-307.337) (-308.020) (-306.256) * (-307.605) [-306.093] (-308.714) (-308.376) -- 0:00:27
539000 -- [-308.256] (-306.844) (-311.497) (-307.091) * (-309.574) (-308.071) (-308.643) [-307.767] -- 0:00:27
539500 -- (-309.762) (-309.782) [-306.325] (-307.655) * (-307.351) (-306.693) (-308.139) [-306.080] -- 0:00:27
540000 -- (-307.360) (-306.728) [-307.281] (-308.584) * (-307.249) [-306.539] (-310.512) (-308.651) -- 0:00:27
Average standard deviation of split frequencies: 0.009334
540500 -- (-306.086) (-306.420) [-306.611] (-306.272) * (-309.108) (-308.566) (-308.878) [-307.318] -- 0:00:27
541000 -- [-307.759] (-306.769) (-307.852) (-307.651) * (-309.699) [-306.760] (-308.495) (-307.424) -- 0:00:27
541500 -- (-307.720) (-308.390) (-308.972) [-309.024] * (-309.169) (-306.598) [-308.407] (-307.035) -- 0:00:27
542000 -- [-308.050] (-308.672) (-312.422) (-306.504) * (-309.549) [-308.366] (-310.493) (-314.166) -- 0:00:27
542500 -- [-310.970] (-307.896) (-308.929) (-306.560) * [-308.701] (-306.161) (-310.870) (-306.981) -- 0:00:26
543000 -- [-308.591] (-309.030) (-306.475) (-312.390) * [-308.848] (-309.405) (-312.594) (-310.971) -- 0:00:26
543500 -- (-306.429) (-314.292) [-307.384] (-308.962) * (-310.566) (-314.945) [-309.550] (-309.487) -- 0:00:26
544000 -- (-305.557) (-307.683) (-307.200) [-307.588] * [-305.986] (-307.764) (-314.306) (-308.523) -- 0:00:26
544500 -- (-307.381) [-306.933] (-307.615) (-311.805) * [-306.044] (-308.490) (-306.821) (-309.786) -- 0:00:26
545000 -- (-309.218) (-308.127) (-307.794) [-307.881] * (-306.295) (-310.647) [-305.997] (-307.530) -- 0:00:26
Average standard deviation of split frequencies: 0.008796
545500 -- (-308.705) (-307.915) (-308.438) [-306.990] * (-308.770) (-309.224) [-306.076] (-308.103) -- 0:00:26
546000 -- (-309.340) (-307.230) [-307.398] (-305.953) * (-305.995) [-309.968] (-306.709) (-306.066) -- 0:00:26
546500 -- (-312.411) (-307.624) [-312.874] (-307.378) * (-307.737) (-307.752) [-309.616] (-308.103) -- 0:00:26
547000 -- (-309.941) (-307.497) (-313.029) [-307.355] * (-307.627) [-305.823] (-307.447) (-306.540) -- 0:00:26
547500 -- (-308.675) (-311.351) (-307.085) [-312.348] * (-309.173) [-306.574] (-306.922) (-307.577) -- 0:00:26
548000 -- (-306.654) [-312.997] (-309.691) (-309.516) * (-306.465) (-306.077) [-306.709] (-306.533) -- 0:00:26
548500 -- (-308.132) [-307.547] (-307.830) (-308.216) * (-307.914) (-306.659) [-310.246] (-308.061) -- 0:00:26
549000 -- (-309.996) [-307.575] (-307.799) (-309.612) * (-307.164) [-307.047] (-306.303) (-307.346) -- 0:00:26
549500 -- [-307.607] (-306.714) (-308.885) (-309.377) * [-307.568] (-308.306) (-309.406) (-306.163) -- 0:00:26
550000 -- [-306.591] (-308.048) (-307.989) (-309.914) * (-309.140) [-309.473] (-314.214) (-308.738) -- 0:00:26
Average standard deviation of split frequencies: 0.007972
550500 -- (-307.316) (-309.993) [-307.292] (-308.772) * [-308.044] (-307.471) (-308.241) (-311.120) -- 0:00:26
551000 -- [-309.700] (-308.839) (-306.851) (-306.965) * (-306.497) (-310.733) [-311.494] (-307.435) -- 0:00:26
551500 -- [-309.055] (-312.219) (-307.073) (-306.296) * [-306.772] (-307.404) (-311.128) (-305.897) -- 0:00:26
552000 -- (-307.345) (-307.802) (-307.905) [-307.700] * (-312.768) (-308.319) [-311.832] (-309.223) -- 0:00:25
552500 -- (-309.655) [-307.135] (-308.866) (-307.940) * (-307.304) [-307.690] (-312.579) (-313.447) -- 0:00:25
553000 -- (-308.193) [-306.853] (-306.878) (-311.833) * (-310.724) (-308.645) (-310.684) [-311.424] -- 0:00:25
553500 -- (-307.126) (-306.010) (-307.695) [-307.238] * [-309.955] (-310.785) (-308.348) (-307.840) -- 0:00:25
554000 -- [-306.927] (-307.334) (-306.190) (-306.633) * (-309.367) (-307.282) [-308.503] (-309.478) -- 0:00:25
554500 -- (-308.539) (-308.463) (-307.687) [-306.407] * [-306.407] (-312.210) (-309.570) (-308.154) -- 0:00:26
555000 -- [-309.774] (-311.880) (-306.597) (-307.021) * [-309.113] (-307.663) (-308.749) (-309.294) -- 0:00:26
Average standard deviation of split frequencies: 0.007472
555500 -- [-307.908] (-306.604) (-314.426) (-306.771) * (-309.912) (-309.558) (-308.556) [-307.984] -- 0:00:26
556000 -- (-308.182) (-306.677) [-310.645] (-306.750) * (-309.731) [-306.820] (-312.629) (-309.246) -- 0:00:26
556500 -- (-305.900) (-306.273) (-310.893) [-306.695] * (-307.442) (-306.402) (-309.984) [-306.811] -- 0:00:26
557000 -- (-308.658) [-309.136] (-307.457) (-308.997) * (-306.333) (-309.904) [-310.407] (-307.083) -- 0:00:26
557500 -- (-308.421) [-306.324] (-307.696) (-309.842) * [-307.282] (-310.248) (-309.212) (-308.102) -- 0:00:26
558000 -- (-306.862) (-308.688) [-306.054] (-306.518) * [-307.097] (-308.440) (-311.975) (-308.114) -- 0:00:26
558500 -- (-307.547) (-307.120) [-307.005] (-307.581) * [-306.911] (-309.123) (-308.395) (-307.209) -- 0:00:26
559000 -- (-308.169) [-307.782] (-307.211) (-307.952) * (-307.237) [-306.998] (-307.843) (-307.408) -- 0:00:26
559500 -- (-306.887) [-306.646] (-307.958) (-307.315) * (-307.095) (-308.889) (-307.848) [-310.545] -- 0:00:25
560000 -- (-306.155) (-309.686) (-309.184) [-306.460] * [-308.822] (-306.685) (-309.724) (-314.671) -- 0:00:25
Average standard deviation of split frequencies: 0.008040
560500 -- [-308.336] (-309.615) (-308.153) (-310.300) * (-305.746) (-309.145) (-308.015) [-309.489] -- 0:00:25
561000 -- (-310.288) (-309.264) (-307.816) [-306.627] * [-307.591] (-307.972) (-308.529) (-308.329) -- 0:00:25
561500 -- [-308.811] (-310.178) (-307.658) (-308.257) * (-308.163) (-308.033) [-306.704] (-310.408) -- 0:00:25
562000 -- (-308.199) [-306.962] (-305.907) (-310.714) * [-310.479] (-308.293) (-307.407) (-309.446) -- 0:00:25
562500 -- (-307.676) (-307.598) [-305.941] (-310.185) * (-312.060) (-310.414) [-311.183] (-306.829) -- 0:00:25
563000 -- [-306.091] (-309.385) (-307.575) (-311.643) * (-312.769) (-307.254) [-306.372] (-308.883) -- 0:00:25
563500 -- (-308.386) (-306.979) (-306.564) [-306.832] * (-308.193) (-309.883) [-306.632] (-310.458) -- 0:00:25
564000 -- (-306.158) (-309.103) (-306.687) [-307.251] * (-308.948) [-308.959] (-310.049) (-311.074) -- 0:00:25
564500 -- (-307.574) (-308.238) [-305.552] (-309.850) * (-307.160) (-305.743) (-309.270) [-309.652] -- 0:00:25
565000 -- (-308.176) (-307.421) (-306.224) [-308.868] * (-306.345) (-307.192) (-307.041) [-306.666] -- 0:00:25
Average standard deviation of split frequencies: 0.008433
565500 -- (-306.583) (-307.481) (-307.985) [-306.108] * (-307.105) (-307.248) [-309.321] (-310.144) -- 0:00:25
566000 -- (-307.630) (-307.906) (-308.146) [-309.935] * (-308.594) (-307.195) (-306.051) [-307.261] -- 0:00:25
566500 -- (-307.122) (-312.287) [-307.758] (-308.038) * (-308.704) (-311.891) (-307.560) [-308.435] -- 0:00:25
567000 -- (-306.396) (-308.611) (-308.277) [-307.690] * (-310.909) (-307.367) [-305.859] (-308.306) -- 0:00:25
567500 -- [-306.522] (-308.363) (-307.622) (-306.055) * (-307.381) (-307.252) [-307.839] (-309.158) -- 0:00:25
568000 -- (-311.482) (-308.296) (-308.019) [-308.315] * (-306.004) [-307.365] (-310.692) (-306.409) -- 0:00:25
568500 -- (-309.744) [-308.094] (-307.272) (-309.320) * (-306.110) (-309.387) (-307.265) [-306.189] -- 0:00:25
569000 -- [-305.966] (-306.911) (-308.097) (-305.818) * [-306.174] (-311.294) (-309.745) (-306.194) -- 0:00:24
569500 -- (-306.224) (-307.366) (-306.274) [-307.929] * (-306.669) (-317.298) (-308.228) [-306.573] -- 0:00:24
570000 -- (-305.645) (-312.506) [-309.630] (-306.284) * (-307.081) (-310.930) (-308.967) [-307.551] -- 0:00:24
Average standard deviation of split frequencies: 0.008406
570500 -- (-306.575) (-309.399) [-306.586] (-309.202) * (-309.854) [-306.099] (-307.237) (-306.463) -- 0:00:25
571000 -- (-306.392) (-307.993) [-306.036] (-308.079) * (-309.963) (-311.439) [-309.020] (-306.465) -- 0:00:25
571500 -- (-306.382) (-308.439) (-307.104) [-307.275] * (-310.369) [-311.562] (-308.038) (-307.180) -- 0:00:25
572000 -- [-307.247] (-308.542) (-311.084) (-308.399) * (-309.057) (-311.420) [-307.177] (-307.660) -- 0:00:25
572500 -- (-307.692) [-308.109] (-311.542) (-307.812) * (-307.008) (-309.170) (-308.163) [-307.804] -- 0:00:25
573000 -- (-313.359) (-308.693) (-305.810) [-306.892] * [-306.012] (-308.158) (-307.916) (-307.557) -- 0:00:25
573500 -- (-306.773) (-309.390) (-308.404) [-306.873] * (-307.176) (-307.755) (-308.333) [-309.640] -- 0:00:25
574000 -- (-310.492) (-308.790) (-307.169) [-306.316] * (-310.752) [-307.668] (-308.188) (-306.686) -- 0:00:25
574500 -- (-308.917) (-307.923) (-307.258) [-306.681] * (-311.705) (-307.328) (-308.397) [-307.556] -- 0:00:25
575000 -- (-309.004) (-306.655) (-309.927) [-309.317] * (-309.001) [-307.047] (-307.125) (-308.779) -- 0:00:25
Average standard deviation of split frequencies: 0.008714
575500 -- (-308.541) [-310.673] (-306.686) (-308.829) * [-306.257] (-308.212) (-307.363) (-309.504) -- 0:00:25
576000 -- (-309.798) (-308.511) [-312.245] (-307.275) * (-306.063) (-306.802) [-309.047] (-307.954) -- 0:00:25
576500 -- [-310.624] (-306.586) (-311.724) (-307.431) * (-310.735) [-308.532] (-308.653) (-311.924) -- 0:00:24
577000 -- [-308.085] (-307.037) (-309.315) (-306.129) * [-307.148] (-308.487) (-306.928) (-309.625) -- 0:00:24
577500 -- [-306.841] (-307.132) (-307.860) (-305.867) * (-313.735) (-309.078) [-306.606] (-307.610) -- 0:00:24
578000 -- (-308.880) (-308.521) (-308.927) [-307.021] * (-307.946) [-306.948] (-309.777) (-308.868) -- 0:00:24
578500 -- (-309.455) (-309.442) [-307.533] (-308.496) * (-309.313) (-306.205) [-308.297] (-306.257) -- 0:00:24
579000 -- [-308.653] (-308.548) (-308.785) (-307.598) * (-306.811) [-308.153] (-309.169) (-307.519) -- 0:00:24
579500 -- [-308.091] (-306.592) (-307.678) (-307.175) * [-307.192] (-313.512) (-307.880) (-306.078) -- 0:00:24
580000 -- (-308.667) [-307.028] (-307.370) (-307.747) * (-309.307) [-308.462] (-309.616) (-307.760) -- 0:00:24
Average standard deviation of split frequencies: 0.007975
580500 -- (-307.137) (-309.173) [-306.394] (-309.078) * (-308.770) (-310.903) (-311.010) [-306.423] -- 0:00:24
581000 -- (-305.873) (-307.444) [-307.195] (-307.669) * (-307.209) (-306.720) [-307.431] (-311.484) -- 0:00:24
581500 -- [-305.818] (-307.472) (-306.083) (-308.653) * (-305.895) (-306.714) [-308.513] (-315.231) -- 0:00:24
582000 -- [-306.393] (-306.374) (-308.358) (-308.916) * (-306.255) [-309.411] (-307.553) (-307.213) -- 0:00:24
582500 -- [-308.684] (-307.788) (-307.984) (-307.199) * (-306.988) [-306.946] (-306.348) (-308.369) -- 0:00:24
583000 -- (-306.236) (-311.978) (-306.955) [-306.920] * (-306.372) [-306.292] (-310.747) (-310.943) -- 0:00:24
583500 -- (-307.426) (-308.095) (-311.701) [-308.218] * [-308.104] (-311.630) (-314.952) (-308.137) -- 0:00:24
584000 -- (-308.459) [-307.605] (-309.360) (-308.610) * (-308.179) (-307.482) (-308.450) [-306.847] -- 0:00:24
584500 -- (-309.176) (-307.561) [-310.856] (-309.225) * (-311.725) (-305.718) [-307.354] (-308.594) -- 0:00:24
585000 -- (-308.149) (-307.138) (-311.395) [-306.300] * [-310.867] (-308.485) (-310.585) (-306.288) -- 0:00:24
Average standard deviation of split frequencies: 0.007761
585500 -- (-307.448) [-307.987] (-307.274) (-307.198) * (-307.960) [-309.595] (-308.601) (-308.013) -- 0:00:24
586000 -- (-311.221) (-307.545) (-309.434) [-308.676] * (-305.988) (-309.306) [-308.591] (-306.716) -- 0:00:24
586500 -- [-309.080] (-309.727) (-308.939) (-308.034) * (-307.834) [-309.518] (-307.497) (-306.524) -- 0:00:23
587000 -- (-308.987) (-308.668) (-307.383) [-306.162] * (-308.239) (-307.941) [-307.578] (-307.398) -- 0:00:24
587500 -- (-310.013) (-308.835) (-308.379) [-309.451] * (-306.634) [-306.455] (-308.319) (-306.892) -- 0:00:24
588000 -- (-310.838) [-309.945] (-307.826) (-305.764) * (-307.187) (-306.669) [-307.710] (-307.362) -- 0:00:24
588500 -- (-306.070) [-306.420] (-306.848) (-307.616) * (-305.847) (-308.238) (-306.703) [-307.221] -- 0:00:24
589000 -- [-305.824] (-307.029) (-310.761) (-311.008) * (-314.946) (-308.101) [-306.708] (-308.233) -- 0:00:24
589500 -- (-307.828) [-306.176] (-308.138) (-306.361) * (-308.578) (-307.396) [-305.795] (-307.762) -- 0:00:24
590000 -- (-308.193) (-306.171) [-308.327] (-311.291) * (-308.940) (-309.272) [-305.796] (-306.884) -- 0:00:24
Average standard deviation of split frequencies: 0.008081
590500 -- (-306.175) (-307.388) (-309.943) [-309.717] * (-310.231) (-307.727) [-308.998] (-309.112) -- 0:00:24
591000 -- [-305.905] (-307.403) (-307.363) (-309.039) * (-308.024) (-309.601) [-308.999] (-308.279) -- 0:00:24
591500 -- (-307.778) [-310.152] (-312.523) (-314.793) * (-305.856) [-309.292] (-308.968) (-310.370) -- 0:00:24
592000 -- (-306.724) (-310.242) [-306.222] (-312.803) * (-307.315) (-310.885) (-307.549) [-309.649] -- 0:00:24
592500 -- [-307.733] (-306.111) (-306.868) (-311.843) * [-307.844] (-308.755) (-306.979) (-307.460) -- 0:00:24
593000 -- [-307.267] (-308.587) (-310.199) (-310.499) * (-307.057) (-306.322) [-307.885] (-309.862) -- 0:00:24
593500 -- (-308.671) (-308.742) [-308.159] (-310.078) * (-310.241) (-307.845) (-306.768) [-308.332] -- 0:00:23
594000 -- (-307.430) (-311.519) (-308.117) [-313.424] * (-306.694) (-305.619) (-311.012) [-308.488] -- 0:00:23
594500 -- [-308.091] (-311.923) (-309.417) (-309.307) * [-306.766] (-309.081) (-310.260) (-308.136) -- 0:00:23
595000 -- (-308.161) [-306.996] (-307.094) (-306.162) * (-306.433) (-307.528) [-305.942] (-306.284) -- 0:00:23
Average standard deviation of split frequencies: 0.008189
595500 -- [-306.415] (-308.645) (-306.558) (-306.126) * (-306.455) (-311.880) (-307.620) [-309.890] -- 0:00:23
596000 -- [-308.448] (-309.615) (-307.062) (-308.030) * [-307.263] (-310.382) (-308.474) (-310.198) -- 0:00:23
596500 -- [-307.320] (-308.196) (-306.494) (-312.673) * (-307.687) [-306.443] (-309.451) (-310.547) -- 0:00:23
597000 -- (-310.062) [-309.098] (-308.154) (-305.797) * (-305.797) [-307.505] (-312.726) (-306.177) -- 0:00:23
597500 -- (-309.031) (-307.138) (-306.375) [-305.906] * (-305.843) (-306.885) [-306.516] (-311.572) -- 0:00:23
598000 -- (-309.267) [-307.515] (-307.246) (-308.308) * [-305.805] (-306.519) (-308.462) (-308.522) -- 0:00:23
598500 -- (-314.025) (-307.212) [-306.507] (-307.804) * (-308.619) [-308.970] (-307.761) (-309.537) -- 0:00:23
599000 -- (-305.835) (-306.985) [-309.430] (-307.763) * (-308.348) (-306.557) (-306.474) [-311.514] -- 0:00:23
599500 -- [-305.960] (-306.541) (-309.209) (-308.011) * (-307.821) (-306.379) (-307.023) [-307.839] -- 0:00:23
600000 -- (-307.527) [-306.723] (-307.359) (-308.746) * (-309.100) (-309.265) (-307.006) [-309.244] -- 0:00:23
Average standard deviation of split frequencies: 0.008289
600500 -- [-307.953] (-307.149) (-308.319) (-308.556) * [-309.879] (-309.636) (-306.268) (-309.184) -- 0:00:23
601000 -- (-314.412) [-307.033] (-309.200) (-308.656) * (-310.663) (-308.152) [-307.756] (-306.311) -- 0:00:23
601500 -- (-311.703) [-309.762] (-306.179) (-307.224) * (-306.294) (-309.838) (-307.148) [-307.024] -- 0:00:23
602000 -- (-306.780) (-309.503) (-312.702) [-306.562] * [-306.761] (-309.746) (-308.866) (-308.909) -- 0:00:23
602500 -- (-307.828) (-306.594) (-308.469) [-307.322] * (-306.997) [-309.459] (-311.182) (-306.439) -- 0:00:23
603000 -- (-307.185) [-306.667] (-308.826) (-306.070) * (-307.730) (-307.430) [-309.187] (-307.528) -- 0:00:23
603500 -- (-307.119) (-307.203) [-306.179] (-306.915) * (-308.270) [-306.297] (-308.580) (-306.514) -- 0:00:23
604000 -- (-309.044) (-308.461) [-306.620] (-306.173) * (-310.171) [-307.362] (-307.815) (-305.631) -- 0:00:23
604500 -- (-306.103) [-307.393] (-306.757) (-306.845) * (-305.983) (-309.652) [-307.507] (-311.569) -- 0:00:23
605000 -- (-306.320) (-306.154) [-308.464] (-310.035) * (-308.276) [-308.899] (-306.435) (-306.353) -- 0:00:23
Average standard deviation of split frequencies: 0.008237
605500 -- (-306.565) [-306.425] (-310.318) (-309.748) * (-313.315) (-308.914) (-313.442) [-306.781] -- 0:00:23
606000 -- (-308.043) (-307.837) (-310.061) [-307.189] * [-310.415] (-306.598) (-312.521) (-306.757) -- 0:00:23
606500 -- (-309.402) (-309.656) [-308.409] (-307.851) * [-307.926] (-306.535) (-309.857) (-307.230) -- 0:00:23
607000 -- (-309.860) (-308.641) (-307.166) [-306.707] * (-307.027) (-309.177) (-308.712) [-307.318] -- 0:00:23
607500 -- (-307.005) (-313.510) [-306.751] (-312.452) * (-309.106) (-310.077) [-306.822] (-307.599) -- 0:00:23
608000 -- (-309.911) [-307.904] (-307.140) (-312.536) * (-306.475) [-307.622] (-306.338) (-306.435) -- 0:00:23
608500 -- (-312.801) [-306.559] (-307.795) (-309.937) * (-305.966) (-307.983) (-307.208) [-306.077] -- 0:00:23
609000 -- [-306.471] (-307.784) (-310.606) (-307.554) * (-307.486) [-309.304] (-307.130) (-309.334) -- 0:00:23
609500 -- (-306.071) (-307.887) (-310.873) [-308.429] * (-310.585) (-311.715) (-307.469) [-309.831] -- 0:00:23
610000 -- (-309.339) (-306.559) [-307.056] (-306.474) * [-307.532] (-307.898) (-307.127) (-306.894) -- 0:00:23
Average standard deviation of split frequencies: 0.008733
610500 -- [-312.964] (-308.276) (-309.042) (-307.885) * (-310.009) (-308.301) [-306.938] (-310.349) -- 0:00:22
611000 -- (-311.233) (-305.595) (-307.828) [-313.557] * (-308.824) (-308.338) (-308.893) [-307.101] -- 0:00:22
611500 -- (-310.355) (-309.057) (-309.546) [-310.962] * [-309.069] (-310.497) (-310.617) (-306.653) -- 0:00:22
612000 -- [-306.842] (-306.873) (-307.467) (-309.012) * [-308.635] (-309.168) (-307.819) (-310.109) -- 0:00:22
612500 -- (-306.592) (-305.937) (-306.608) [-306.514] * (-306.575) [-309.514] (-305.970) (-310.670) -- 0:00:22
613000 -- [-308.807] (-305.728) (-310.603) (-309.401) * (-306.396) [-310.020] (-307.459) (-309.384) -- 0:00:22
613500 -- (-306.265) (-306.806) (-305.787) [-307.071] * (-310.076) (-313.115) (-308.498) [-308.090] -- 0:00:22
614000 -- (-307.222) (-308.231) (-309.713) [-308.074] * (-307.599) (-306.191) (-309.028) [-308.240] -- 0:00:22
614500 -- [-305.742] (-306.371) (-308.075) (-307.810) * [-307.338] (-310.745) (-314.576) (-307.328) -- 0:00:22
615000 -- (-306.625) (-308.882) (-312.460) [-307.160] * (-306.059) (-307.090) (-313.194) [-310.022] -- 0:00:22
Average standard deviation of split frequencies: 0.008753
615500 -- (-307.991) (-307.184) [-305.761] (-308.168) * (-307.291) [-307.290] (-305.760) (-315.833) -- 0:00:22
616000 -- (-309.656) (-309.161) [-307.026] (-309.833) * (-311.137) (-309.970) (-308.178) [-307.994] -- 0:00:22
616500 -- (-306.893) (-307.421) (-307.348) [-307.636] * (-308.080) [-310.111] (-306.645) (-307.252) -- 0:00:22
617000 -- (-306.856) (-309.294) [-305.768] (-306.076) * [-308.939] (-308.814) (-311.093) (-305.535) -- 0:00:22
617500 -- (-307.619) (-308.822) (-307.558) [-308.023] * [-306.336] (-319.479) (-309.353) (-306.236) -- 0:00:22
618000 -- (-305.845) (-310.353) [-307.447] (-308.462) * (-312.615) [-312.283] (-308.801) (-305.693) -- 0:00:22
618500 -- (-309.931) (-308.029) (-310.047) [-307.633] * (-308.005) (-312.138) [-311.010] (-308.611) -- 0:00:22
619000 -- [-308.686] (-307.986) (-316.498) (-306.284) * (-308.826) (-308.767) [-307.019] (-308.082) -- 0:00:22
619500 -- [-306.454] (-307.265) (-312.774) (-305.913) * (-311.933) (-306.553) [-306.168] (-308.271) -- 0:00:22
620000 -- (-307.048) (-307.867) [-309.651] (-309.023) * (-308.593) [-308.816] (-307.050) (-307.202) -- 0:00:22
Average standard deviation of split frequencies: 0.008924
620500 -- [-309.506] (-307.702) (-308.336) (-307.208) * [-307.278] (-306.423) (-308.497) (-306.618) -- 0:00:22
621000 -- (-307.210) [-311.774] (-309.921) (-305.675) * (-307.988) (-307.858) [-306.721] (-306.945) -- 0:00:22
621500 -- [-308.817] (-308.771) (-316.388) (-307.025) * (-308.341) (-308.087) [-306.744] (-308.416) -- 0:00:22
622000 -- [-307.503] (-310.071) (-315.559) (-308.430) * (-307.039) (-309.314) (-306.548) [-306.188] -- 0:00:22
622500 -- (-306.510) (-307.914) (-310.981) [-306.375] * (-310.722) [-306.546] (-307.223) (-308.421) -- 0:00:22
623000 -- [-306.105] (-308.696) (-306.806) (-305.969) * [-306.600] (-306.582) (-309.593) (-308.271) -- 0:00:22
623500 -- [-306.099] (-306.880) (-306.897) (-308.529) * [-306.530] (-314.996) (-308.481) (-308.671) -- 0:00:22
624000 -- (-307.806) (-307.227) [-306.812] (-308.516) * (-309.422) (-308.378) (-308.829) [-305.816] -- 0:00:22
624500 -- [-305.661] (-308.671) (-307.379) (-307.985) * [-309.422] (-310.565) (-307.646) (-307.993) -- 0:00:22
625000 -- [-307.386] (-310.238) (-308.671) (-313.165) * (-306.768) (-305.523) (-305.948) [-307.686] -- 0:00:22
Average standard deviation of split frequencies: 0.008378
625500 -- [-308.664] (-308.776) (-309.290) (-311.023) * (-307.044) (-311.587) (-310.899) [-306.766] -- 0:00:22
626000 -- (-308.579) [-314.329] (-309.243) (-309.822) * (-308.832) (-310.403) [-311.810] (-306.801) -- 0:00:22
626500 -- (-307.649) (-307.922) (-307.729) [-307.390] * (-307.092) (-308.989) [-308.679] (-306.246) -- 0:00:22
627000 -- (-308.278) [-308.159] (-306.796) (-306.722) * (-312.999) (-306.595) [-309.447] (-309.001) -- 0:00:22
627500 -- [-307.093] (-307.692) (-308.494) (-306.847) * [-306.120] (-306.785) (-307.748) (-308.670) -- 0:00:21
628000 -- (-306.674) [-308.229] (-308.519) (-306.616) * [-307.339] (-306.525) (-308.179) (-308.848) -- 0:00:21
628500 -- (-308.024) (-306.967) (-307.025) [-307.088] * (-310.171) [-306.518] (-307.359) (-306.736) -- 0:00:21
629000 -- (-306.173) [-311.239] (-306.962) (-308.561) * [-308.177] (-306.472) (-310.615) (-306.586) -- 0:00:21
629500 -- (-309.152) (-311.249) [-309.053] (-312.485) * (-306.579) [-306.035] (-308.852) (-309.354) -- 0:00:21
630000 -- (-310.920) (-306.761) [-308.867] (-306.252) * (-307.680) (-305.914) (-305.982) [-308.470] -- 0:00:21
Average standard deviation of split frequencies: 0.008362
630500 -- (-306.933) (-306.554) (-307.768) [-310.436] * [-306.656] (-309.613) (-307.996) (-306.639) -- 0:00:21
631000 -- (-308.521) (-306.966) (-307.831) [-312.331] * [-307.589] (-307.919) (-308.867) (-308.677) -- 0:00:21
631500 -- (-309.985) (-307.832) (-309.905) [-308.943] * [-307.045] (-308.099) (-310.127) (-306.777) -- 0:00:21
632000 -- (-308.806) (-309.443) (-308.708) [-308.285] * [-307.269] (-306.765) (-306.950) (-309.295) -- 0:00:21
632500 -- [-308.063] (-308.890) (-306.996) (-305.982) * (-309.527) (-307.077) (-307.659) [-311.787] -- 0:00:21
633000 -- (-309.813) (-310.396) [-309.235] (-307.599) * [-308.897] (-307.472) (-312.312) (-312.563) -- 0:00:21
633500 -- (-309.285) (-309.963) (-310.192) [-307.304] * (-306.471) (-306.897) [-306.794] (-310.036) -- 0:00:21
634000 -- (-306.934) (-310.777) (-309.840) [-306.103] * (-306.537) [-310.233] (-311.209) (-307.682) -- 0:00:21
634500 -- (-305.903) [-307.001] (-307.811) (-309.155) * [-307.212] (-308.735) (-306.093) (-306.692) -- 0:00:21
635000 -- (-306.693) (-309.297) (-307.081) [-306.532] * (-307.246) (-308.721) [-309.855] (-310.614) -- 0:00:21
Average standard deviation of split frequencies: 0.008246
635500 -- (-309.857) (-309.903) (-308.142) [-308.890] * (-309.978) (-308.383) [-308.318] (-310.061) -- 0:00:21
636000 -- (-306.741) (-306.516) [-305.786] (-309.482) * (-310.195) [-306.415] (-306.868) (-307.348) -- 0:00:21
636500 -- (-306.542) (-306.506) (-306.388) [-307.489] * [-310.511] (-312.891) (-306.606) (-307.977) -- 0:00:21
637000 -- (-305.854) (-307.358) (-305.581) [-307.560] * (-307.472) [-308.021] (-306.160) (-309.212) -- 0:00:21
637500 -- [-305.999] (-309.934) (-307.221) (-306.085) * (-310.904) (-306.036) (-306.160) [-305.804] -- 0:00:21
638000 -- (-306.414) (-307.140) (-309.237) [-306.758] * (-306.647) [-305.805] (-306.165) (-307.689) -- 0:00:21
638500 -- (-311.858) (-307.057) (-310.187) [-308.818] * (-307.592) (-308.852) [-309.137] (-307.332) -- 0:00:21
639000 -- (-310.099) (-306.034) (-307.222) [-309.171] * (-310.493) (-307.276) (-306.195) [-307.175] -- 0:00:21
639500 -- (-308.984) (-308.506) [-307.759] (-309.114) * (-307.156) [-305.650] (-307.453) (-306.478) -- 0:00:21
640000 -- [-309.139] (-309.015) (-306.396) (-308.328) * [-306.754] (-310.243) (-306.874) (-311.349) -- 0:00:21
Average standard deviation of split frequencies: 0.007652
640500 -- (-311.728) (-311.613) [-306.292] (-309.863) * (-307.228) (-306.257) [-308.745] (-307.242) -- 0:00:21
641000 -- (-308.670) (-309.702) [-306.127] (-307.779) * (-308.605) [-307.997] (-306.509) (-309.639) -- 0:00:21
641500 -- (-307.067) (-307.382) (-307.485) [-308.335] * [-307.745] (-307.154) (-311.270) (-313.468) -- 0:00:21
642000 -- (-311.475) (-308.191) [-306.243] (-306.721) * [-308.158] (-305.696) (-308.996) (-306.507) -- 0:00:21
642500 -- (-308.688) [-307.252] (-306.162) (-306.694) * (-309.252) [-306.644] (-306.427) (-306.267) -- 0:00:21
643000 -- [-309.464] (-307.910) (-306.971) (-306.114) * (-307.523) (-307.594) [-308.007] (-307.244) -- 0:00:21
643500 -- (-307.178) [-307.189] (-306.728) (-307.220) * (-307.728) [-306.561] (-307.700) (-309.030) -- 0:00:21
644000 -- (-312.396) [-307.138] (-310.914) (-309.199) * [-306.392] (-306.086) (-306.905) (-311.083) -- 0:00:21
644500 -- (-313.619) (-307.772) (-307.632) [-308.022] * (-309.826) (-307.038) [-307.104] (-310.738) -- 0:00:20
645000 -- (-305.775) (-309.416) (-309.816) [-313.638] * [-313.506] (-307.340) (-308.570) (-306.786) -- 0:00:20
Average standard deviation of split frequencies: 0.007589
645500 -- (-308.136) [-307.180] (-308.279) (-310.199) * (-307.873) [-307.161] (-308.899) (-307.675) -- 0:00:20
646000 -- [-307.435] (-305.994) (-306.646) (-312.181) * (-305.933) (-306.190) [-306.964] (-308.468) -- 0:00:20
646500 -- (-310.153) (-307.336) (-306.959) [-310.694] * (-307.589) (-310.546) [-306.625] (-308.441) -- 0:00:20
647000 -- (-307.418) (-308.435) [-306.160] (-308.852) * (-307.499) [-306.631] (-311.006) (-309.006) -- 0:00:20
647500 -- (-307.374) [-307.782] (-308.619) (-308.058) * (-308.476) [-311.064] (-306.538) (-308.518) -- 0:00:20
648000 -- (-308.044) (-307.329) (-308.039) [-309.115] * [-306.393] (-306.884) (-307.555) (-307.229) -- 0:00:20
648500 -- (-308.412) [-307.605] (-307.206) (-307.209) * (-307.022) [-308.659] (-309.049) (-306.617) -- 0:00:20
649000 -- [-307.656] (-307.012) (-306.603) (-308.333) * (-310.772) (-306.730) (-306.972) [-307.136] -- 0:00:20
649500 -- (-310.865) [-308.964] (-307.033) (-306.602) * (-307.989) [-306.971] (-306.637) (-309.141) -- 0:00:20
650000 -- (-309.127) (-307.833) (-305.524) [-307.397] * (-306.378) [-306.736] (-306.298) (-307.776) -- 0:00:20
Average standard deviation of split frequencies: 0.007200
650500 -- (-305.976) [-308.267] (-306.602) (-306.496) * (-307.635) (-308.552) [-306.028] (-306.509) -- 0:00:20
651000 -- (-305.947) (-308.947) [-308.912] (-309.252) * (-308.923) [-307.239] (-307.287) (-308.861) -- 0:00:20
651500 -- (-308.772) (-307.313) [-308.833] (-306.666) * (-308.470) (-306.969) (-307.088) [-310.179] -- 0:00:20
652000 -- (-305.779) (-309.340) (-306.813) [-308.839] * (-309.400) (-308.644) [-310.666] (-308.084) -- 0:00:20
652500 -- (-307.535) (-306.989) [-307.164] (-305.847) * (-313.221) (-310.178) [-308.378] (-311.160) -- 0:00:20
653000 -- (-306.429) (-309.924) [-306.723] (-306.125) * (-308.373) [-308.097] (-307.804) (-309.619) -- 0:00:20
653500 -- [-306.955] (-309.043) (-308.926) (-308.592) * (-306.767) (-309.280) (-307.534) [-307.350] -- 0:00:20
654000 -- (-309.291) [-307.281] (-309.013) (-309.388) * (-305.757) (-310.683) [-308.400] (-307.097) -- 0:00:20
654500 -- [-308.118] (-309.631) (-305.610) (-310.024) * (-308.129) (-306.569) (-306.913) [-309.281] -- 0:00:20
655000 -- (-307.885) (-310.675) [-309.413] (-313.897) * (-307.320) [-306.671] (-305.672) (-312.854) -- 0:00:20
Average standard deviation of split frequencies: 0.007411
655500 -- (-306.962) (-308.747) (-314.078) [-307.251] * (-307.621) (-309.347) (-305.983) [-308.225] -- 0:00:20
656000 -- (-310.852) (-308.823) (-309.697) [-307.346] * [-307.088] (-306.384) (-312.009) (-306.386) -- 0:00:20
656500 -- (-308.430) (-309.181) [-310.570] (-305.958) * (-306.056) (-306.156) (-307.282) [-306.745] -- 0:00:20
657000 -- (-305.868) (-307.324) (-310.307) [-307.366] * (-306.410) (-308.816) (-307.058) [-311.360] -- 0:00:20
657500 -- [-308.179] (-308.834) (-309.826) (-310.706) * (-307.439) [-306.490] (-307.402) (-306.670) -- 0:00:20
658000 -- [-309.815] (-315.286) (-311.563) (-307.961) * (-306.617) [-306.516] (-307.198) (-307.095) -- 0:00:20
658500 -- (-306.714) [-308.695] (-308.223) (-308.148) * (-310.848) (-307.677) [-306.892] (-308.497) -- 0:00:20
659000 -- (-306.955) [-306.153] (-308.325) (-306.554) * (-306.447) (-308.200) (-307.166) [-310.351] -- 0:00:20
659500 -- (-306.690) (-306.174) (-308.444) [-307.129] * (-306.576) (-307.267) (-307.467) [-309.534] -- 0:00:20
660000 -- (-310.523) [-308.247] (-306.880) (-309.188) * [-307.664] (-308.670) (-307.821) (-309.520) -- 0:00:20
Average standard deviation of split frequencies: 0.007447
660500 -- [-306.928] (-309.215) (-307.089) (-307.408) * (-307.256) (-306.363) [-309.485] (-308.089) -- 0:00:20
661000 -- (-308.755) (-312.235) (-307.986) [-308.271] * (-306.426) (-310.157) [-307.416] (-309.891) -- 0:00:20
661500 -- (-309.900) (-309.017) (-307.660) [-308.242] * (-306.420) (-309.159) [-310.451] (-307.457) -- 0:00:19
662000 -- (-307.155) (-306.652) [-307.688] (-306.553) * (-306.428) (-305.846) [-307.844] (-306.986) -- 0:00:19
662500 -- [-307.885] (-316.058) (-310.138) (-307.042) * [-306.619] (-306.420) (-308.628) (-309.105) -- 0:00:19
663000 -- (-309.328) (-305.692) (-307.968) [-306.790] * [-307.906] (-306.021) (-309.733) (-306.446) -- 0:00:19
663500 -- (-308.185) [-306.911] (-311.077) (-310.495) * (-307.154) (-306.285) (-307.755) [-307.169] -- 0:00:19
664000 -- (-308.462) [-305.880] (-310.280) (-307.215) * (-307.588) [-308.819] (-307.317) (-307.432) -- 0:00:19
664500 -- (-311.464) (-307.724) (-307.417) [-306.539] * (-307.831) (-308.319) (-310.003) [-306.912] -- 0:00:19
665000 -- (-308.862) (-307.214) (-306.826) [-306.700] * (-310.095) (-309.740) (-308.003) [-310.265] -- 0:00:19
Average standard deviation of split frequencies: 0.007653
665500 -- (-305.890) [-307.566] (-309.540) (-307.590) * [-306.300] (-310.551) (-308.214) (-308.874) -- 0:00:19
666000 -- [-305.520] (-307.738) (-307.501) (-307.980) * (-308.069) (-309.864) (-306.223) [-308.388] -- 0:00:19
666500 -- (-307.626) (-307.086) [-306.314] (-313.050) * (-307.973) (-314.627) (-306.374) [-306.776] -- 0:00:19
667000 -- (-309.042) [-307.876] (-307.923) (-310.222) * (-307.448) (-308.229) [-306.285] (-307.244) -- 0:00:19
667500 -- (-307.593) [-308.195] (-307.954) (-308.314) * (-306.803) (-311.347) (-306.592) [-306.864] -- 0:00:19
668000 -- [-306.065] (-306.731) (-312.246) (-312.543) * (-308.786) [-308.290] (-311.067) (-307.673) -- 0:00:19
668500 -- (-306.367) (-307.997) (-306.791) [-306.989] * [-307.944] (-307.623) (-311.067) (-307.302) -- 0:00:19
669000 -- (-307.406) (-307.448) [-308.846] (-310.728) * (-308.394) (-308.421) [-305.991] (-309.455) -- 0:00:19
669500 -- (-305.839) (-311.067) [-308.389] (-308.022) * (-307.817) (-311.213) [-308.714] (-306.764) -- 0:00:19
670000 -- [-307.711] (-306.858) (-308.067) (-309.654) * (-307.711) (-312.884) [-306.159] (-308.975) -- 0:00:19
Average standard deviation of split frequencies: 0.008523
670500 -- (-306.800) (-306.913) [-308.025] (-306.464) * (-306.946) (-310.800) [-305.913] (-310.563) -- 0:00:19
671000 -- (-306.084) (-305.917) (-309.208) [-306.198] * (-307.677) (-307.881) [-306.476] (-310.372) -- 0:00:19
671500 -- (-315.073) (-310.284) (-308.121) [-310.701] * (-307.873) (-308.075) (-308.407) [-306.717] -- 0:00:19
672000 -- [-308.005] (-308.520) (-308.247) (-309.200) * (-307.788) [-308.120] (-308.048) (-306.244) -- 0:00:19
672500 -- (-310.406) (-307.235) (-308.661) [-307.102] * (-309.325) (-308.204) (-307.589) [-306.755] -- 0:00:19
673000 -- [-307.650] (-307.480) (-311.953) (-307.842) * [-309.602] (-309.908) (-306.406) (-307.258) -- 0:00:19
673500 -- (-306.864) (-306.793) (-307.826) [-308.983] * (-308.638) (-306.144) (-308.334) [-307.951] -- 0:00:19
674000 -- [-307.707] (-309.825) (-308.171) (-308.500) * (-308.313) (-310.426) (-312.696) [-306.769] -- 0:00:19
674500 -- (-309.995) (-307.231) [-307.034] (-309.772) * (-309.379) (-311.025) (-308.646) [-307.951] -- 0:00:19
675000 -- [-310.555] (-308.522) (-307.990) (-307.574) * (-309.778) [-309.381] (-309.442) (-308.617) -- 0:00:19
Average standard deviation of split frequencies: 0.008412
675500 -- (-307.989) (-307.117) [-309.527] (-307.708) * [-307.247] (-311.597) (-306.914) (-307.328) -- 0:00:19
676000 -- (-307.083) (-308.805) (-308.562) [-307.879] * [-308.657] (-306.963) (-311.145) (-306.784) -- 0:00:19
676500 -- [-311.193] (-309.642) (-307.396) (-308.338) * (-307.193) (-306.206) (-312.647) [-308.843] -- 0:00:19
677000 -- (-308.947) [-308.282] (-307.540) (-311.049) * [-306.575] (-308.176) (-312.189) (-308.062) -- 0:00:19
677500 -- [-310.020] (-309.012) (-307.778) (-305.941) * (-311.387) (-305.884) [-309.021] (-308.064) -- 0:00:19
678000 -- (-311.666) (-308.055) (-307.711) [-305.754] * (-309.624) (-307.820) (-306.777) [-308.186] -- 0:00:18
678500 -- (-306.759) (-307.718) [-310.472] (-310.979) * (-309.498) (-309.245) [-306.201] (-307.288) -- 0:00:18
679000 -- (-308.888) (-306.619) (-309.845) [-310.339] * (-308.258) [-306.753] (-306.122) (-307.507) -- 0:00:18
679500 -- (-311.543) (-308.481) (-307.731) [-310.752] * [-309.689] (-310.601) (-306.637) (-306.715) -- 0:00:18
680000 -- (-309.555) (-305.965) [-309.199] (-307.019) * (-309.274) [-307.016] (-308.352) (-309.274) -- 0:00:18
Average standard deviation of split frequencies: 0.008181
680500 -- (-307.882) (-308.031) (-306.910) [-308.479] * (-306.611) (-309.558) (-307.948) [-309.584] -- 0:00:18
681000 -- (-308.612) [-306.822] (-306.977) (-315.067) * (-307.098) (-306.360) [-306.164] (-310.606) -- 0:00:18
681500 -- [-307.317] (-308.582) (-306.862) (-308.214) * [-308.879] (-311.358) (-308.751) (-309.672) -- 0:00:18
682000 -- (-307.154) (-311.865) [-309.478] (-306.632) * [-308.590] (-312.094) (-307.174) (-310.601) -- 0:00:18
682500 -- [-308.101] (-306.760) (-306.029) (-306.970) * [-309.003] (-309.023) (-308.212) (-306.764) -- 0:00:18
683000 -- (-306.164) (-307.926) [-307.051] (-306.848) * (-307.156) (-308.705) [-311.783] (-306.650) -- 0:00:18
683500 -- (-309.187) (-306.701) [-309.513] (-309.507) * [-308.033] (-308.106) (-311.627) (-310.310) -- 0:00:18
684000 -- (-314.244) (-308.384) [-308.936] (-309.336) * (-307.393) (-307.961) [-309.116] (-309.349) -- 0:00:18
684500 -- (-310.947) (-307.959) (-307.861) [-306.105] * (-305.814) [-310.281] (-307.984) (-311.159) -- 0:00:18
685000 -- (-310.508) (-310.063) [-306.500] (-309.139) * (-305.683) (-306.891) [-306.296] (-306.377) -- 0:00:18
Average standard deviation of split frequencies: 0.008461
685500 -- [-308.366] (-309.277) (-308.238) (-307.550) * (-306.505) [-307.546] (-306.438) (-311.042) -- 0:00:18
686000 -- (-310.907) [-307.031] (-307.321) (-306.227) * [-306.352] (-306.981) (-307.898) (-307.984) -- 0:00:18
686500 -- (-306.735) (-306.454) (-306.873) [-306.754] * (-307.275) (-307.394) [-306.975] (-306.194) -- 0:00:18
687000 -- (-306.885) [-306.574] (-306.069) (-306.445) * (-306.758) (-309.177) [-309.896] (-311.816) -- 0:00:18
687500 -- (-306.126) (-306.868) (-305.868) [-309.107] * (-306.911) (-306.757) [-306.264] (-314.333) -- 0:00:18
688000 -- (-306.346) [-306.784] (-306.164) (-306.612) * (-306.797) [-306.951] (-311.875) (-313.606) -- 0:00:18
688500 -- [-307.146] (-306.446) (-307.172) (-306.435) * (-307.418) (-309.217) [-307.148] (-308.451) -- 0:00:18
689000 -- [-308.118] (-306.852) (-306.549) (-306.879) * [-309.566] (-308.525) (-310.811) (-308.318) -- 0:00:18
689500 -- (-313.313) (-311.233) [-307.706] (-306.279) * (-311.111) (-306.427) (-305.838) [-308.468] -- 0:00:18
690000 -- (-307.968) [-308.627] (-309.411) (-306.750) * (-305.968) (-309.842) (-307.187) [-309.535] -- 0:00:18
Average standard deviation of split frequencies: 0.008702
690500 -- [-306.923] (-306.522) (-310.132) (-305.773) * (-306.819) (-306.979) [-308.322] (-309.754) -- 0:00:18
691000 -- (-307.407) (-306.344) (-313.099) [-308.486] * (-306.388) (-306.820) (-307.926) [-308.028] -- 0:00:18
691500 -- [-309.916] (-306.736) (-307.937) (-310.235) * (-309.429) (-306.934) (-309.873) [-308.074] -- 0:00:18
692000 -- [-307.524] (-309.462) (-310.172) (-310.275) * (-315.795) (-306.172) [-310.424] (-308.558) -- 0:00:18
692500 -- [-306.238] (-306.060) (-310.366) (-306.915) * (-308.180) [-307.154] (-309.499) (-308.284) -- 0:00:18
693000 -- [-309.287] (-308.163) (-308.487) (-306.150) * [-306.702] (-308.279) (-307.396) (-309.468) -- 0:00:18
693500 -- (-308.446) (-308.847) (-307.409) [-310.227] * (-309.788) [-307.433] (-306.173) (-308.260) -- 0:00:18
694000 -- (-307.543) (-309.355) (-308.570) [-309.563] * [-306.372] (-309.228) (-306.492) (-307.916) -- 0:00:18
694500 -- (-307.114) [-305.932] (-307.005) (-308.695) * (-306.782) (-312.516) [-309.432] (-307.980) -- 0:00:18
695000 -- (-309.434) [-305.940] (-306.988) (-307.519) * (-309.221) (-307.276) (-309.906) [-306.493] -- 0:00:17
Average standard deviation of split frequencies: 0.008678
695500 -- (-309.056) (-309.042) [-307.721] (-306.324) * (-307.763) (-309.435) (-307.856) [-308.105] -- 0:00:17
696000 -- (-306.284) [-309.683] (-307.206) (-307.978) * (-312.860) (-311.447) [-306.841] (-312.494) -- 0:00:17
696500 -- [-307.119] (-306.860) (-306.631) (-309.177) * (-307.158) (-308.621) (-308.126) [-310.899] -- 0:00:17
697000 -- [-307.660] (-311.327) (-306.880) (-308.676) * [-311.139] (-307.722) (-308.348) (-309.127) -- 0:00:17
697500 -- [-309.543] (-309.797) (-308.182) (-314.229) * (-306.524) [-307.313] (-309.454) (-311.349) -- 0:00:17
698000 -- [-307.927] (-309.528) (-309.054) (-312.755) * [-306.851] (-307.519) (-308.341) (-309.665) -- 0:00:17
698500 -- (-313.791) [-308.081] (-311.156) (-306.314) * [-305.612] (-306.027) (-308.498) (-307.051) -- 0:00:17
699000 -- (-312.958) [-309.249] (-307.269) (-306.188) * (-308.482) [-307.715] (-310.716) (-308.672) -- 0:00:17
699500 -- (-306.631) (-308.913) [-306.692] (-306.852) * (-307.616) (-318.098) [-308.704] (-309.416) -- 0:00:17
700000 -- (-307.375) (-306.297) [-308.255] (-308.258) * (-306.058) (-312.131) (-306.907) [-307.750] -- 0:00:17
Average standard deviation of split frequencies: 0.008578
700500 -- (-306.359) (-305.860) (-309.087) [-306.812] * (-307.482) [-308.275] (-308.210) (-307.095) -- 0:00:17
701000 -- (-306.425) (-306.985) (-306.579) [-306.676] * (-307.150) (-312.548) (-308.699) [-307.366] -- 0:00:17
701500 -- (-307.310) [-306.740] (-306.255) (-307.393) * (-307.247) (-307.518) [-306.163] (-311.102) -- 0:00:17
702000 -- (-308.716) (-307.152) [-306.535] (-307.051) * (-306.615) [-306.886] (-307.347) (-306.966) -- 0:00:17
702500 -- (-316.249) [-307.942] (-312.234) (-308.428) * (-307.117) [-305.535] (-309.385) (-307.547) -- 0:00:17
703000 -- (-310.601) (-308.702) [-308.281] (-310.958) * (-305.822) [-308.210] (-312.108) (-306.992) -- 0:00:17
703500 -- [-306.604] (-308.773) (-311.466) (-308.909) * (-306.685) (-307.421) (-307.257) [-306.117] -- 0:00:17
704000 -- (-307.575) [-308.838] (-307.332) (-310.314) * [-306.286] (-307.059) (-309.634) (-306.595) -- 0:00:17
704500 -- (-310.613) (-307.430) [-306.463] (-310.987) * (-307.565) (-306.529) (-306.693) [-307.218] -- 0:00:17
705000 -- (-305.840) (-309.267) [-306.264] (-306.913) * [-306.845] (-308.291) (-308.878) (-306.963) -- 0:00:17
Average standard deviation of split frequencies: 0.008388
705500 -- (-308.749) (-309.254) (-307.490) [-306.399] * (-306.146) (-307.850) (-308.937) [-309.666] -- 0:00:17
706000 -- (-309.835) (-309.766) [-308.467] (-306.861) * (-307.236) (-311.658) [-313.053] (-309.144) -- 0:00:17
706500 -- (-310.364) [-306.437] (-307.437) (-306.808) * (-306.818) (-310.894) (-307.126) [-307.229] -- 0:00:17
707000 -- [-311.051] (-305.767) (-306.007) (-307.814) * [-307.789] (-306.732) (-308.269) (-306.415) -- 0:00:17
707500 -- (-312.516) (-306.177) (-306.500) [-306.934] * (-310.924) [-307.967] (-305.820) (-308.589) -- 0:00:17
708000 -- (-309.187) (-309.036) [-306.077] (-307.060) * (-308.944) (-308.569) [-307.341] (-310.849) -- 0:00:17
708500 -- (-309.139) (-307.072) [-305.750] (-306.894) * [-305.674] (-309.992) (-310.440) (-305.935) -- 0:00:17
709000 -- (-308.186) (-309.649) [-305.947] (-306.681) * (-305.697) [-306.674] (-308.030) (-310.530) -- 0:00:17
709500 -- (-306.500) [-309.762] (-306.056) (-306.788) * (-306.822) (-306.463) (-310.112) [-308.290] -- 0:00:17
710000 -- (-309.693) (-308.156) (-305.969) [-311.078] * (-306.041) (-305.987) (-311.162) [-308.340] -- 0:00:17
Average standard deviation of split frequencies: 0.008209
710500 -- [-309.223] (-308.431) (-306.575) (-314.706) * [-308.584] (-306.841) (-307.022) (-307.417) -- 0:00:17
711000 -- [-309.076] (-307.144) (-308.136) (-307.559) * [-306.304] (-310.037) (-308.266) (-309.914) -- 0:00:17
711500 -- (-306.977) (-308.164) [-305.915] (-307.231) * (-306.177) (-307.903) [-307.338] (-306.768) -- 0:00:17
712000 -- (-309.047) [-310.346] (-306.503) (-312.348) * (-309.545) [-308.466] (-308.134) (-307.156) -- 0:00:16
712500 -- (-306.502) (-306.267) [-307.095] (-309.689) * (-307.559) (-309.013) (-307.505) [-308.585] -- 0:00:16
713000 -- (-309.238) (-307.272) [-306.861] (-309.302) * (-307.103) [-309.593] (-306.939) (-310.075) -- 0:00:16
713500 -- (-308.799) (-306.942) [-307.165] (-308.431) * [-307.129] (-308.649) (-309.361) (-308.087) -- 0:00:16
714000 -- (-309.096) [-308.078] (-309.776) (-312.215) * (-306.983) (-306.335) [-309.193] (-308.004) -- 0:00:16
714500 -- (-308.666) [-308.002] (-308.808) (-310.204) * [-310.292] (-305.898) (-312.206) (-308.002) -- 0:00:16
715000 -- [-307.364] (-306.853) (-306.390) (-309.790) * (-307.879) (-306.007) (-307.429) [-308.574] -- 0:00:16
Average standard deviation of split frequencies: 0.007725
715500 -- [-307.516] (-311.108) (-307.136) (-308.116) * (-306.703) [-306.765] (-306.624) (-307.030) -- 0:00:16
716000 -- (-308.346) (-310.319) (-310.827) [-310.603] * [-309.564] (-305.796) (-308.555) (-307.739) -- 0:00:16
716500 -- (-307.161) [-308.607] (-307.213) (-314.753) * (-307.547) (-309.931) (-307.183) [-308.454] -- 0:00:16
717000 -- (-309.386) [-311.778] (-307.321) (-309.743) * (-308.120) [-310.095] (-306.110) (-307.784) -- 0:00:16
717500 -- (-311.304) (-306.334) (-309.014) [-307.752] * (-310.214) (-308.565) (-310.227) [-309.982] -- 0:00:16
718000 -- [-310.278] (-306.400) (-307.104) (-308.381) * [-307.369] (-306.321) (-306.745) (-307.744) -- 0:00:16
718500 -- (-310.754) (-306.829) [-308.115] (-311.008) * (-309.859) [-307.318] (-311.489) (-306.489) -- 0:00:16
719000 -- (-309.906) (-309.391) [-307.343] (-309.834) * (-306.802) [-308.399] (-306.094) (-308.996) -- 0:00:16
719500 -- (-310.320) (-307.185) [-307.173] (-310.942) * (-306.794) [-305.905] (-309.129) (-309.015) -- 0:00:16
720000 -- (-309.084) (-309.367) (-308.960) [-306.366] * (-310.155) [-307.333] (-306.166) (-308.621) -- 0:00:16
Average standard deviation of split frequencies: 0.007631
720500 -- (-309.962) (-306.353) (-306.872) [-307.314] * (-308.485) (-307.505) (-306.594) [-308.321] -- 0:00:16
721000 -- [-308.235] (-309.835) (-307.221) (-310.914) * (-306.390) [-311.119] (-306.663) (-308.049) -- 0:00:16
721500 -- [-306.928] (-309.675) (-307.097) (-308.711) * (-309.819) [-307.879] (-306.817) (-308.244) -- 0:00:16
722000 -- (-309.729) [-305.942] (-308.821) (-308.030) * (-308.725) (-306.468) [-306.733] (-310.685) -- 0:00:16
722500 -- (-308.687) [-307.457] (-306.495) (-310.799) * (-310.995) [-306.916] (-307.691) (-313.075) -- 0:00:16
723000 -- [-305.717] (-306.842) (-306.424) (-314.382) * (-308.774) (-307.733) [-306.390] (-306.771) -- 0:00:16
723500 -- (-306.745) (-309.390) (-307.121) [-309.001] * (-310.410) [-308.478] (-308.549) (-307.819) -- 0:00:16
724000 -- (-308.011) (-311.455) (-306.795) [-308.535] * (-308.071) (-306.702) [-307.428] (-308.124) -- 0:00:16
724500 -- (-306.678) (-306.616) (-306.281) [-308.666] * (-312.043) [-310.934] (-306.106) (-309.164) -- 0:00:16
725000 -- [-306.335] (-312.864) (-308.873) (-307.861) * [-309.166] (-306.952) (-306.785) (-308.899) -- 0:00:16
Average standard deviation of split frequencies: 0.008008
725500 -- [-305.702] (-308.107) (-308.965) (-307.255) * [-307.358] (-306.870) (-308.097) (-305.710) -- 0:00:16
726000 -- [-308.768] (-306.614) (-307.312) (-306.715) * [-306.284] (-306.738) (-307.387) (-305.793) -- 0:00:16
726500 -- (-307.686) (-307.471) [-308.763] (-309.898) * (-307.243) (-307.265) (-306.888) [-307.202] -- 0:00:16
727000 -- [-309.582] (-306.488) (-321.649) (-308.474) * [-307.393] (-309.360) (-307.767) (-307.970) -- 0:00:16
727500 -- [-310.103] (-308.176) (-309.327) (-309.803) * (-306.851) (-308.523) [-309.182] (-310.466) -- 0:00:16
728000 -- (-308.024) [-308.207] (-312.108) (-307.806) * (-308.722) (-305.697) [-307.038] (-309.323) -- 0:00:16
728500 -- [-307.008] (-309.653) (-307.476) (-306.845) * (-307.855) (-308.543) [-306.109] (-310.910) -- 0:00:16
729000 -- (-306.185) [-307.983] (-308.537) (-312.849) * (-306.417) (-306.465) (-306.130) [-306.152] -- 0:00:15
729500 -- [-308.097] (-308.014) (-306.350) (-309.321) * (-308.154) (-308.719) (-310.199) [-311.370] -- 0:00:15
730000 -- (-306.669) (-309.213) (-307.858) [-313.780] * (-308.649) (-307.227) (-306.359) [-307.244] -- 0:00:15
Average standard deviation of split frequencies: 0.007742
730500 -- [-306.634] (-309.414) (-309.326) (-307.423) * [-307.426] (-306.952) (-310.714) (-306.067) -- 0:00:15
731000 -- (-307.380) (-310.351) [-308.640] (-310.330) * (-306.775) (-307.953) [-306.109] (-305.707) -- 0:00:15
731500 -- (-308.831) (-306.731) [-306.733] (-309.336) * (-306.075) (-311.272) [-307.182] (-306.061) -- 0:00:15
732000 -- [-306.401] (-308.740) (-307.378) (-306.761) * (-310.303) [-308.390] (-305.936) (-306.204) -- 0:00:15
732500 -- [-309.992] (-310.027) (-307.025) (-306.461) * (-308.265) [-309.239] (-308.189) (-305.983) -- 0:00:15
733000 -- (-306.044) (-306.922) [-307.390] (-307.967) * (-307.912) (-306.369) [-307.147] (-308.270) -- 0:00:15
733500 -- (-307.392) (-310.288) (-307.977) [-306.406] * (-307.325) [-305.957] (-306.963) (-308.184) -- 0:00:15
734000 -- (-308.623) (-308.832) [-305.973] (-313.474) * (-307.277) [-305.975] (-308.847) (-307.800) -- 0:00:15
734500 -- (-308.450) (-306.577) (-307.711) [-313.242] * (-310.074) (-307.973) [-309.090] (-308.415) -- 0:00:15
735000 -- (-308.243) (-314.720) [-307.776] (-305.737) * (-309.642) (-308.126) [-310.181] (-307.701) -- 0:00:15
Average standard deviation of split frequencies: 0.008070
735500 -- (-309.746) [-311.279] (-307.437) (-311.771) * (-310.813) (-307.605) [-308.462] (-310.945) -- 0:00:15
736000 -- [-307.718] (-312.195) (-312.071) (-316.826) * [-308.739] (-306.562) (-307.101) (-308.075) -- 0:00:15
736500 -- [-307.039] (-314.163) (-307.733) (-307.715) * (-310.360) [-309.047] (-310.567) (-307.369) -- 0:00:15
737000 -- [-308.842] (-311.921) (-307.499) (-306.436) * (-307.704) (-312.105) [-307.806] (-307.729) -- 0:00:15
737500 -- (-306.337) (-306.677) (-307.367) [-307.302] * (-305.911) (-307.880) (-308.846) [-306.310] -- 0:00:15
738000 -- (-308.133) [-309.754] (-306.960) (-309.502) * (-309.907) (-306.747) [-306.499] (-306.697) -- 0:00:15
738500 -- (-306.874) [-307.445] (-309.077) (-308.722) * (-313.781) (-306.345) [-308.781] (-308.784) -- 0:00:15
739000 -- (-307.547) (-309.184) [-309.804] (-308.619) * [-306.779] (-306.677) (-309.351) (-311.115) -- 0:00:15
739500 -- (-307.313) (-309.167) [-306.531] (-308.371) * (-306.058) [-307.252] (-313.393) (-314.311) -- 0:00:15
740000 -- [-308.804] (-308.041) (-306.506) (-310.815) * (-308.129) (-307.461) [-306.361] (-312.373) -- 0:00:15
Average standard deviation of split frequencies: 0.008062
740500 -- (-309.652) (-306.786) (-306.751) [-306.451] * (-309.504) (-306.375) [-308.882] (-310.967) -- 0:00:15
741000 -- [-306.616] (-305.967) (-306.828) (-306.071) * (-306.946) [-307.838] (-307.028) (-309.508) -- 0:00:15
741500 -- (-306.145) (-306.313) (-309.655) [-306.035] * (-307.556) [-307.724] (-308.228) (-309.830) -- 0:00:15
742000 -- [-306.987] (-306.179) (-308.639) (-308.452) * (-308.667) (-306.043) (-307.453) [-307.119] -- 0:00:15
742500 -- (-308.155) (-310.754) [-308.925] (-313.090) * (-308.151) (-307.295) [-305.875] (-310.474) -- 0:00:15
743000 -- (-307.834) (-306.435) (-309.159) [-307.571] * [-308.990] (-306.793) (-308.282) (-308.491) -- 0:00:15
743500 -- (-306.307) (-308.667) [-308.919] (-307.001) * (-308.607) (-306.682) [-306.292] (-308.576) -- 0:00:15
744000 -- (-306.156) (-307.435) [-307.162] (-307.663) * [-306.821] (-310.610) (-306.598) (-309.173) -- 0:00:15
744500 -- (-306.497) (-308.045) (-310.592) [-308.388] * (-307.324) (-307.774) [-307.314] (-307.781) -- 0:00:15
745000 -- (-306.178) (-308.125) [-307.141] (-308.337) * (-306.260) (-306.425) (-306.943) [-307.538] -- 0:00:15
Average standard deviation of split frequencies: 0.008257
745500 -- (-309.643) (-306.650) [-309.122] (-307.092) * (-307.333) (-307.784) (-309.059) [-306.747] -- 0:00:15
746000 -- [-306.674] (-306.403) (-308.743) (-310.455) * (-309.933) (-310.078) [-306.287] (-310.516) -- 0:00:14
746500 -- (-308.080) (-307.006) (-307.981) [-309.545] * [-309.168] (-307.267) (-307.060) (-314.443) -- 0:00:14
747000 -- (-309.774) (-308.466) [-308.192] (-309.609) * (-306.421) (-306.667) (-308.057) [-308.248] -- 0:00:14
747500 -- [-309.322] (-313.550) (-307.744) (-308.407) * (-308.311) (-308.708) (-312.142) [-309.838] -- 0:00:14
748000 -- (-312.349) (-310.808) (-308.429) [-308.555] * (-308.565) (-307.354) (-309.548) [-307.153] -- 0:00:14
748500 -- [-307.391] (-308.357) (-307.828) (-309.832) * [-309.089] (-311.864) (-312.145) (-307.659) -- 0:00:14
749000 -- [-307.424] (-306.855) (-307.947) (-313.824) * [-309.118] (-310.032) (-309.234) (-306.477) -- 0:00:14
749500 -- (-306.459) (-315.654) [-307.867] (-312.379) * (-308.658) (-310.739) (-311.820) [-308.945] -- 0:00:14
750000 -- [-306.299] (-308.682) (-307.044) (-310.411) * (-309.604) [-309.365] (-309.455) (-306.774) -- 0:00:14
Average standard deviation of split frequencies: 0.008164
750500 -- (-307.616) [-305.719] (-315.006) (-307.730) * (-310.577) [-309.231] (-307.268) (-309.764) -- 0:00:14
751000 -- (-312.879) [-305.853] (-310.635) (-307.749) * [-307.364] (-309.443) (-309.435) (-311.362) -- 0:00:14
751500 -- [-307.081] (-307.536) (-306.467) (-308.183) * (-309.412) [-314.438] (-308.122) (-307.093) -- 0:00:14
752000 -- [-311.072] (-309.513) (-306.692) (-310.082) * [-309.056] (-309.447) (-308.984) (-306.091) -- 0:00:14
752500 -- [-307.600] (-310.357) (-311.270) (-314.873) * [-307.903] (-310.493) (-308.771) (-309.080) -- 0:00:14
753000 -- (-306.749) (-307.997) (-308.769) [-307.564] * (-308.062) (-309.650) [-309.658] (-309.212) -- 0:00:14
753500 -- (-308.002) (-309.535) [-308.063] (-306.319) * (-307.078) (-309.633) [-307.382] (-308.381) -- 0:00:14
754000 -- (-306.049) (-312.843) [-308.007] (-307.396) * [-307.088] (-308.960) (-307.280) (-310.540) -- 0:00:14
754500 -- (-306.455) (-307.343) [-308.685] (-306.501) * (-307.049) [-310.183] (-308.763) (-312.115) -- 0:00:14
755000 -- (-307.755) [-308.394] (-310.465) (-309.039) * (-307.987) (-309.456) (-308.121) [-311.809] -- 0:00:14
Average standard deviation of split frequencies: 0.007981
755500 -- (-306.954) (-309.182) (-307.704) [-308.111] * (-306.478) [-306.638] (-305.968) (-308.666) -- 0:00:14
756000 -- (-309.882) (-307.576) (-308.271) [-306.027] * (-308.814) [-307.199] (-307.806) (-308.374) -- 0:00:14
756500 -- (-306.852) (-307.209) (-309.820) [-306.706] * (-309.350) (-307.842) (-306.570) [-307.757] -- 0:00:14
757000 -- (-307.778) (-308.517) (-308.075) [-306.596] * [-307.296] (-307.060) (-306.109) (-309.598) -- 0:00:14
757500 -- (-305.858) [-310.909] (-311.380) (-307.803) * (-307.459) (-308.044) (-306.563) [-307.156] -- 0:00:14
758000 -- (-308.160) (-306.519) (-307.488) [-307.088] * (-309.611) [-308.504] (-306.243) (-306.193) -- 0:00:14
758500 -- (-309.613) [-306.950] (-307.490) (-307.318) * (-306.548) (-306.195) [-306.220] (-307.737) -- 0:00:14
759000 -- (-306.615) [-308.341] (-307.223) (-306.959) * (-308.224) [-306.917] (-306.625) (-309.162) -- 0:00:14
759500 -- (-311.707) (-310.077) (-307.592) [-306.637] * [-307.855] (-307.617) (-308.133) (-307.582) -- 0:00:14
760000 -- (-306.365) (-308.991) [-309.009] (-308.991) * [-306.675] (-308.191) (-307.697) (-313.724) -- 0:00:14
Average standard deviation of split frequencies: 0.007685
760500 -- [-305.876] (-307.617) (-306.097) (-312.584) * (-311.269) (-314.742) [-307.292] (-307.861) -- 0:00:14
761000 -- (-306.780) [-306.577] (-306.349) (-312.642) * (-306.177) (-306.834) [-307.047] (-310.937) -- 0:00:14
761500 -- (-310.774) [-306.937] (-309.472) (-307.697) * (-309.181) [-307.249] (-307.528) (-310.780) -- 0:00:14
762000 -- (-308.411) [-308.132] (-307.581) (-308.069) * [-306.503] (-308.047) (-308.579) (-307.590) -- 0:00:14
762500 -- [-309.949] (-307.057) (-306.354) (-308.233) * (-308.574) (-305.791) [-307.060] (-307.636) -- 0:00:14
763000 -- (-309.436) [-307.369] (-309.869) (-308.559) * (-309.590) (-308.286) (-309.043) [-306.845] -- 0:00:13
763500 -- (-307.011) (-306.191) [-308.482] (-306.625) * [-307.085] (-310.202) (-308.525) (-307.179) -- 0:00:13
764000 -- (-306.359) (-309.354) [-309.785] (-308.061) * (-307.070) [-309.515] (-311.405) (-308.890) -- 0:00:13
764500 -- (-305.868) [-308.587] (-312.360) (-306.869) * (-306.836) (-312.854) (-306.238) [-306.488] -- 0:00:13
765000 -- [-308.048] (-306.556) (-315.608) (-310.256) * (-306.978) [-308.372] (-307.640) (-307.354) -- 0:00:13
Average standard deviation of split frequencies: 0.007877
765500 -- [-310.526] (-305.719) (-307.701) (-308.462) * (-308.303) [-306.538] (-307.184) (-308.134) -- 0:00:13
766000 -- (-308.262) (-306.197) [-307.140] (-306.535) * (-306.751) [-306.260] (-308.337) (-306.756) -- 0:00:13
766500 -- (-312.451) [-306.377] (-307.707) (-307.311) * [-307.803] (-307.349) (-307.268) (-307.787) -- 0:00:13
767000 -- (-308.673) [-308.486] (-306.339) (-306.373) * (-308.878) (-307.332) [-307.670] (-308.326) -- 0:00:13
767500 -- (-305.931) (-308.517) [-306.071] (-308.198) * (-306.082) [-307.807] (-307.461) (-307.335) -- 0:00:13
768000 -- (-310.039) (-308.378) (-306.069) [-307.713] * (-306.581) [-309.681] (-311.167) (-308.427) -- 0:00:13
768500 -- (-306.868) [-306.106] (-307.335) (-310.011) * (-306.761) [-311.619] (-307.364) (-306.383) -- 0:00:13
769000 -- (-307.529) (-306.705) [-307.887] (-310.013) * (-307.098) [-309.674] (-307.566) (-311.609) -- 0:00:13
769500 -- [-309.342] (-308.187) (-307.974) (-306.395) * (-306.539) [-308.882] (-309.126) (-309.204) -- 0:00:13
770000 -- (-307.102) [-314.894] (-308.320) (-306.340) * (-306.218) (-310.304) [-308.073] (-305.882) -- 0:00:13
Average standard deviation of split frequencies: 0.007952
770500 -- [-310.309] (-309.265) (-308.261) (-309.415) * (-307.971) (-308.515) [-306.925] (-308.764) -- 0:00:13
771000 -- (-311.723) [-309.768] (-313.749) (-306.600) * (-307.510) (-310.166) [-307.869] (-309.645) -- 0:00:13
771500 -- [-307.218] (-308.955) (-306.304) (-312.187) * (-309.171) [-310.338] (-308.513) (-310.487) -- 0:00:13
772000 -- (-308.606) (-312.215) [-307.522] (-310.909) * [-306.601] (-307.071) (-308.791) (-306.413) -- 0:00:13
772500 -- (-310.286) [-308.273] (-310.578) (-306.411) * (-306.643) (-306.410) [-307.229] (-306.860) -- 0:00:13
773000 -- (-307.105) (-308.580) (-306.771) [-305.576] * (-308.540) (-305.981) [-307.759] (-307.627) -- 0:00:13
773500 -- (-306.534) (-306.162) [-306.722] (-307.215) * (-308.055) [-305.869] (-307.875) (-307.007) -- 0:00:13
774000 -- [-306.413] (-308.516) (-310.889) (-309.033) * (-306.618) (-310.598) (-310.309) [-309.496] -- 0:00:13
774500 -- (-309.044) (-307.777) (-306.686) [-310.850] * (-308.458) (-307.788) (-309.120) [-305.838] -- 0:00:13
775000 -- (-305.901) [-307.595] (-311.388) (-308.912) * (-306.527) [-306.444] (-308.484) (-312.086) -- 0:00:13
Average standard deviation of split frequencies: 0.008424
775500 -- [-306.095] (-310.238) (-309.208) (-310.670) * (-305.673) (-305.861) (-306.115) [-308.304] -- 0:00:13
776000 -- (-307.503) (-310.553) [-307.234] (-306.999) * [-306.253] (-307.532) (-306.970) (-308.096) -- 0:00:13
776500 -- (-306.205) (-307.450) [-308.753] (-306.402) * (-306.281) (-307.358) [-308.851] (-308.349) -- 0:00:13
777000 -- (-306.208) [-306.824] (-308.388) (-307.929) * [-307.427] (-306.745) (-308.686) (-310.205) -- 0:00:13
777500 -- (-309.159) (-308.533) [-306.468] (-307.163) * (-311.214) [-306.136] (-310.462) (-310.122) -- 0:00:13
778000 -- (-314.102) [-309.869] (-307.783) (-306.931) * (-311.042) [-307.054] (-309.427) (-306.402) -- 0:00:13
778500 -- [-312.102] (-306.734) (-307.063) (-308.927) * (-310.125) (-308.677) (-307.379) [-305.855] -- 0:00:13
779000 -- (-308.240) [-306.859] (-306.416) (-312.122) * (-312.610) (-307.158) [-317.782] (-308.147) -- 0:00:13
779500 -- (-308.468) (-307.582) (-308.661) [-307.467] * (-308.558) (-308.467) [-306.232] (-316.545) -- 0:00:13
780000 -- (-307.915) (-314.715) (-307.280) [-307.741] * (-307.422) (-311.105) [-306.137] (-306.331) -- 0:00:12
Average standard deviation of split frequencies: 0.008414
780500 -- (-309.595) (-308.143) (-308.689) [-306.633] * (-308.513) (-308.300) [-308.713] (-306.365) -- 0:00:12
781000 -- (-310.520) [-308.112] (-306.364) (-306.918) * (-307.037) (-311.356) [-308.360] (-307.978) -- 0:00:12
781500 -- [-308.674] (-306.539) (-306.831) (-307.271) * (-311.589) [-307.118] (-305.651) (-309.659) -- 0:00:12
782000 -- [-312.199] (-311.479) (-306.636) (-307.154) * (-308.309) [-306.296] (-307.764) (-309.470) -- 0:00:12
782500 -- [-307.804] (-310.959) (-307.427) (-306.344) * (-308.677) [-308.387] (-309.017) (-309.461) -- 0:00:12
783000 -- (-305.870) (-311.612) [-308.672] (-306.284) * [-306.928] (-305.926) (-308.334) (-306.322) -- 0:00:12
783500 -- (-310.437) (-310.085) (-312.022) [-307.743] * (-307.853) [-310.490] (-306.100) (-307.956) -- 0:00:12
784000 -- [-306.407] (-307.999) (-309.869) (-309.169) * (-307.116) (-306.776) [-306.312] (-309.036) -- 0:00:12
784500 -- (-309.450) (-308.894) [-308.529] (-311.542) * [-306.780] (-307.748) (-308.078) (-308.523) -- 0:00:12
785000 -- (-307.799) [-307.597] (-307.448) (-308.278) * (-308.678) (-310.356) [-310.836] (-309.392) -- 0:00:12
Average standard deviation of split frequencies: 0.008237
785500 -- (-310.032) (-306.360) (-308.587) [-305.421] * (-306.219) (-307.388) (-307.242) [-308.734] -- 0:00:12
786000 -- (-309.478) [-307.398] (-308.847) (-306.488) * [-307.561] (-311.372) (-308.641) (-306.620) -- 0:00:12
786500 -- (-310.421) (-306.702) [-306.173] (-306.619) * [-307.658] (-309.032) (-307.762) (-305.759) -- 0:00:12
787000 -- [-308.483] (-306.725) (-306.900) (-312.947) * (-307.251) (-307.690) [-308.374] (-306.501) -- 0:00:12
787500 -- (-310.566) (-310.561) (-309.214) [-311.171] * (-307.347) (-309.770) [-306.970] (-307.759) -- 0:00:12
788000 -- [-306.101] (-307.622) (-306.999) (-307.625) * (-306.917) (-306.132) [-308.447] (-307.196) -- 0:00:12
788500 -- [-307.070] (-307.714) (-306.634) (-306.713) * (-307.790) (-307.182) (-307.191) [-306.282] -- 0:00:12
789000 -- (-307.840) (-306.244) [-307.812] (-307.396) * [-310.653] (-311.004) (-306.760) (-310.024) -- 0:00:12
789500 -- [-306.017] (-310.486) (-308.197) (-306.949) * [-306.343] (-306.874) (-305.860) (-310.379) -- 0:00:12
790000 -- [-307.668] (-306.484) (-307.794) (-308.375) * (-309.723) (-309.380) [-306.392] (-311.280) -- 0:00:12
Average standard deviation of split frequencies: 0.008585
790500 -- (-310.258) (-308.505) (-309.469) [-305.949] * (-305.614) [-307.574] (-305.986) (-306.060) -- 0:00:12
791000 -- [-306.884] (-308.153) (-308.969) (-309.426) * [-305.862] (-305.789) (-308.279) (-308.096) -- 0:00:12
791500 -- [-306.846] (-306.936) (-314.115) (-310.625) * (-305.784) (-308.373) [-306.315] (-308.503) -- 0:00:12
792000 -- [-309.310] (-307.695) (-312.520) (-312.148) * (-309.326) [-306.336] (-308.013) (-307.552) -- 0:00:12
792500 -- (-308.828) (-308.043) (-311.523) [-308.765] * (-309.291) [-306.397] (-310.177) (-309.369) -- 0:00:12
793000 -- (-317.724) (-311.468) [-305.589] (-309.360) * [-306.417] (-306.698) (-312.685) (-307.494) -- 0:00:12
793500 -- (-314.324) [-308.267] (-306.253) (-307.272) * (-310.044) (-307.474) (-308.251) [-309.154] -- 0:00:12
794000 -- (-307.196) (-306.525) (-306.923) [-306.430] * (-309.557) (-307.157) (-306.154) [-305.864] -- 0:00:12
794500 -- (-308.226) (-307.080) [-306.329] (-308.047) * (-310.001) (-310.191) [-306.328] (-307.533) -- 0:00:12
795000 -- [-308.343] (-306.477) (-309.180) (-308.379) * [-306.345] (-307.009) (-309.860) (-309.057) -- 0:00:12
Average standard deviation of split frequencies: 0.008528
795500 -- [-309.725] (-309.643) (-307.518) (-307.462) * [-308.009] (-307.635) (-310.100) (-309.317) -- 0:00:12
796000 -- (-313.809) (-308.955) [-308.004] (-308.531) * [-312.829] (-307.329) (-307.161) (-307.404) -- 0:00:12
796500 -- (-305.912) (-307.052) (-311.339) [-309.313] * [-307.933] (-309.451) (-307.029) (-306.559) -- 0:00:12
797000 -- (-307.495) (-307.601) [-312.536] (-308.624) * (-307.286) [-307.858] (-308.977) (-309.262) -- 0:00:11
797500 -- (-309.249) [-306.432] (-309.221) (-308.476) * (-307.402) (-310.196) [-308.917] (-309.561) -- 0:00:11
798000 -- [-308.457] (-310.239) (-308.401) (-309.620) * (-306.315) (-307.598) [-307.703] (-307.906) -- 0:00:11
798500 -- (-309.754) [-308.710] (-305.652) (-306.239) * (-310.930) (-310.489) [-308.344] (-308.006) -- 0:00:11
799000 -- (-307.341) (-306.162) [-305.789] (-312.740) * [-307.123] (-307.118) (-308.933) (-306.868) -- 0:00:11
799500 -- (-307.359) (-307.353) [-306.773] (-308.426) * [-306.860] (-306.035) (-309.021) (-315.329) -- 0:00:11
800000 -- (-307.391) (-308.653) (-307.344) [-310.984] * (-307.592) [-305.920] (-312.829) (-312.944) -- 0:00:11
Average standard deviation of split frequencies: 0.008753
800500 -- [-313.363] (-307.104) (-307.100) (-312.798) * (-307.842) (-306.870) (-309.048) [-309.386] -- 0:00:11
801000 -- [-308.767] (-310.509) (-308.220) (-306.744) * (-307.481) [-309.292] (-312.243) (-307.066) -- 0:00:11
801500 -- (-306.509) (-308.465) (-312.026) [-306.815] * (-308.716) (-306.543) (-309.393) [-306.169] -- 0:00:11
802000 -- (-306.303) (-306.563) (-312.270) [-306.498] * (-309.020) (-309.727) (-309.210) [-306.168] -- 0:00:11
802500 -- (-306.428) (-310.926) [-308.318] (-305.662) * [-309.259] (-309.544) (-313.039) (-309.518) -- 0:00:11
803000 -- [-306.838] (-310.128) (-308.894) (-308.091) * (-310.296) (-308.916) (-307.104) [-306.725] -- 0:00:11
803500 -- (-307.924) (-306.290) [-307.168] (-308.715) * [-307.098] (-309.299) (-307.866) (-307.560) -- 0:00:11
804000 -- (-309.881) [-311.052] (-312.152) (-308.791) * [-311.772] (-306.664) (-307.303) (-308.486) -- 0:00:11
804500 -- [-307.714] (-307.118) (-308.116) (-307.363) * (-308.717) (-308.650) [-306.730] (-308.137) -- 0:00:11
805000 -- [-308.411] (-308.770) (-305.814) (-309.377) * [-307.633] (-308.197) (-307.661) (-308.918) -- 0:00:11
Average standard deviation of split frequencies: 0.008734
805500 -- [-308.664] (-309.701) (-307.796) (-307.346) * (-307.822) (-306.221) (-307.285) [-308.601] -- 0:00:11
806000 -- (-307.528) [-307.756] (-307.207) (-306.774) * (-306.826) (-308.857) (-309.351) [-307.521] -- 0:00:11
806500 -- (-306.318) (-307.563) [-308.106] (-307.618) * [-309.368] (-307.592) (-308.384) (-308.432) -- 0:00:11
807000 -- (-307.417) (-308.067) (-308.571) [-308.514] * (-307.162) (-307.564) (-308.804) [-305.753] -- 0:00:11
807500 -- (-312.705) (-310.169) [-309.201] (-307.329) * (-307.237) (-307.801) (-308.436) [-308.413] -- 0:00:11
808000 -- (-307.049) (-310.214) (-309.321) [-308.390] * [-306.549] (-307.345) (-308.234) (-310.590) -- 0:00:11
808500 -- (-307.296) (-312.444) (-305.878) [-311.917] * (-306.488) (-309.933) (-308.586) [-309.040] -- 0:00:11
809000 -- (-307.332) (-308.953) (-306.791) [-308.060] * (-306.456) (-310.813) [-306.834] (-312.012) -- 0:00:11
809500 -- [-307.045] (-310.634) (-306.243) (-305.902) * [-306.962] (-311.743) (-307.277) (-311.500) -- 0:00:11
810000 -- (-309.213) (-309.467) [-307.348] (-308.724) * (-306.663) [-308.826] (-307.129) (-307.719) -- 0:00:11
Average standard deviation of split frequencies: 0.008567
810500 -- (-310.057) (-313.083) (-311.239) [-307.944] * [-309.021] (-310.943) (-309.905) (-307.703) -- 0:00:11
811000 -- (-314.953) (-308.474) [-309.073] (-309.283) * (-309.901) [-306.070] (-307.534) (-306.585) -- 0:00:11
811500 -- [-306.328] (-311.716) (-317.204) (-308.102) * (-309.142) (-309.497) (-310.437) [-307.527] -- 0:00:11
812000 -- (-309.046) (-307.152) (-317.967) [-308.733] * [-307.700] (-309.014) (-308.811) (-315.475) -- 0:00:11
812500 -- (-307.066) [-306.737] (-310.566) (-307.698) * (-306.587) (-309.681) [-305.910] (-310.582) -- 0:00:11
813000 -- [-308.813] (-308.259) (-309.016) (-307.568) * (-305.645) (-307.080) [-306.886] (-313.496) -- 0:00:11
813500 -- (-310.271) (-309.020) [-308.961] (-305.581) * (-308.002) [-308.491] (-308.611) (-308.403) -- 0:00:11
814000 -- [-306.813] (-308.217) (-306.091) (-307.839) * [-308.658] (-306.483) (-308.359) (-307.369) -- 0:00:10
814500 -- (-306.679) (-310.189) [-306.094] (-310.217) * [-318.145] (-305.959) (-311.729) (-306.667) -- 0:00:10
815000 -- (-305.657) (-306.062) (-309.988) [-307.846] * [-310.158] (-305.905) (-308.842) (-307.199) -- 0:00:10
Average standard deviation of split frequencies: 0.008820
815500 -- (-305.611) (-307.614) (-306.728) [-310.277] * (-308.360) [-306.426] (-309.144) (-308.687) -- 0:00:10
816000 -- (-309.355) (-309.995) [-308.145] (-309.623) * (-312.512) (-310.099) [-307.558] (-306.358) -- 0:00:10
816500 -- (-308.142) [-309.108] (-307.675) (-306.968) * (-309.080) (-307.372) (-307.966) [-306.935] -- 0:00:10
817000 -- [-307.312] (-307.495) (-307.869) (-307.987) * [-309.533] (-311.335) (-307.204) (-306.987) -- 0:00:10
817500 -- (-308.179) [-311.634] (-305.973) (-307.196) * (-310.249) (-307.086) [-310.082] (-306.311) -- 0:00:10
818000 -- (-306.986) (-307.922) [-309.164] (-308.449) * (-306.338) [-307.512] (-307.519) (-308.435) -- 0:00:10
818500 -- (-309.544) (-307.393) [-308.500] (-306.359) * [-307.369] (-307.514) (-307.269) (-307.637) -- 0:00:10
819000 -- (-307.054) [-308.343] (-306.379) (-307.372) * [-306.721] (-310.180) (-306.727) (-308.494) -- 0:00:10
819500 -- [-307.577] (-308.636) (-305.931) (-307.917) * [-307.915] (-306.819) (-310.430) (-308.052) -- 0:00:10
820000 -- (-312.570) (-306.124) (-307.310) [-309.514] * (-313.659) [-307.705] (-310.310) (-306.163) -- 0:00:10
Average standard deviation of split frequencies: 0.008540
820500 -- (-308.238) (-305.589) (-306.491) [-307.131] * (-312.387) (-306.789) (-309.643) [-306.012] -- 0:00:10
821000 -- [-307.072] (-306.239) (-309.872) (-312.389) * (-308.210) [-306.880] (-306.978) (-309.604) -- 0:00:10
821500 -- (-309.395) [-310.179] (-305.669) (-308.667) * [-309.219] (-309.135) (-308.953) (-309.824) -- 0:00:10
822000 -- [-307.599] (-310.332) (-308.851) (-306.128) * (-308.384) (-310.332) (-307.833) [-309.616] -- 0:00:10
822500 -- [-306.939] (-310.859) (-309.641) (-308.488) * [-307.917] (-309.658) (-308.263) (-308.759) -- 0:00:10
823000 -- [-309.619] (-305.906) (-310.336) (-309.040) * (-308.302) [-307.395] (-306.939) (-308.943) -- 0:00:10
823500 -- (-308.605) (-307.764) [-307.907] (-307.063) * (-307.238) (-306.957) [-306.318] (-310.695) -- 0:00:10
824000 -- [-309.811] (-306.202) (-307.066) (-308.636) * (-307.890) (-307.776) [-305.868] (-307.821) -- 0:00:10
824500 -- (-307.388) (-309.172) (-307.482) [-308.892] * (-308.458) [-307.808] (-307.868) (-306.541) -- 0:00:10
825000 -- [-306.153] (-308.293) (-308.816) (-311.077) * (-308.928) (-311.215) [-307.993] (-309.234) -- 0:00:10
Average standard deviation of split frequencies: 0.008218
825500 -- (-307.431) (-311.118) (-310.691) [-307.818] * (-310.612) [-307.451] (-307.326) (-308.170) -- 0:00:10
826000 -- (-311.497) [-308.547] (-310.189) (-310.218) * (-310.993) (-308.407) (-306.933) [-305.751] -- 0:00:10
826500 -- [-308.474] (-309.106) (-306.634) (-307.554) * (-307.343) (-308.708) [-309.600] (-310.166) -- 0:00:10
827000 -- (-305.940) (-306.712) (-307.518) [-309.988] * [-306.453] (-306.307) (-309.155) (-310.933) -- 0:00:10
827500 -- (-308.109) [-305.840] (-309.625) (-307.075) * [-308.303] (-306.289) (-308.204) (-311.938) -- 0:00:10
828000 -- (-306.424) (-306.805) (-308.400) [-308.544] * (-307.061) (-311.376) [-310.383] (-310.355) -- 0:00:10
828500 -- (-309.184) [-309.038] (-308.679) (-308.951) * [-308.991] (-307.622) (-307.199) (-309.852) -- 0:00:10
829000 -- (-309.685) (-306.207) [-307.369] (-310.683) * (-306.600) [-307.606] (-306.322) (-308.100) -- 0:00:10
829500 -- [-307.513] (-307.811) (-313.196) (-310.549) * (-308.292) (-308.547) [-308.033] (-307.781) -- 0:00:10
830000 -- (-306.563) [-308.041] (-307.969) (-306.221) * (-306.516) [-307.681] (-307.823) (-306.473) -- 0:00:10
Average standard deviation of split frequencies: 0.008021
830500 -- [-307.125] (-306.208) (-306.310) (-312.400) * (-308.435) [-305.932] (-312.364) (-306.489) -- 0:00:10
831000 -- (-308.078) (-308.437) (-306.361) [-308.306] * [-309.407] (-310.625) (-311.298) (-306.242) -- 0:00:09
831500 -- (-308.463) (-306.565) [-306.351] (-308.435) * (-308.807) (-310.073) [-313.325] (-306.857) -- 0:00:09
832000 -- (-308.598) (-309.989) [-306.367] (-313.851) * (-307.030) (-307.540) (-309.611) [-307.467] -- 0:00:09
832500 -- (-307.643) (-311.719) [-307.562] (-307.559) * (-308.096) (-307.320) (-309.251) [-307.951] -- 0:00:09
833000 -- (-307.834) [-309.615] (-308.210) (-311.264) * (-308.611) (-309.520) [-306.932] (-306.845) -- 0:00:09
833500 -- (-308.556) (-309.325) [-308.990] (-307.428) * (-305.864) (-310.786) [-306.978] (-308.249) -- 0:00:09
834000 -- (-308.118) (-311.468) (-308.699) [-308.930] * (-308.281) (-310.710) [-307.974] (-308.104) -- 0:00:09
834500 -- (-306.305) [-308.574] (-312.094) (-306.314) * (-307.758) (-309.947) [-310.018] (-311.174) -- 0:00:09
835000 -- [-306.994] (-308.472) (-310.098) (-307.344) * (-308.720) (-307.077) [-306.931] (-311.527) -- 0:00:09
Average standard deviation of split frequencies: 0.007894
835500 -- (-308.353) [-307.802] (-311.308) (-306.598) * (-309.565) [-305.478] (-310.811) (-307.981) -- 0:00:09
836000 -- (-310.038) (-306.979) [-309.796] (-312.098) * (-310.184) [-307.379] (-309.215) (-308.178) -- 0:00:09
836500 -- [-306.664] (-307.834) (-312.131) (-307.796) * [-307.197] (-307.378) (-307.744) (-305.684) -- 0:00:09
837000 -- (-309.100) (-308.087) (-311.127) [-307.530] * (-307.582) (-307.909) (-308.117) [-306.030] -- 0:00:09
837500 -- (-305.689) [-309.118] (-306.991) (-309.305) * (-312.339) [-308.042] (-308.809) (-305.975) -- 0:00:09
838000 -- (-305.614) (-306.810) [-305.891] (-307.341) * (-310.689) (-307.080) (-314.398) [-305.962] -- 0:00:09
838500 -- [-305.867] (-311.036) (-306.465) (-306.662) * (-308.825) (-308.021) (-310.457) [-308.448] -- 0:00:09
839000 -- (-306.905) (-315.179) [-306.694] (-308.100) * (-310.482) (-309.072) [-307.720] (-310.208) -- 0:00:09
839500 -- (-311.317) (-308.536) [-305.856] (-307.205) * (-310.927) [-306.921] (-308.950) (-307.447) -- 0:00:09
840000 -- (-307.762) (-309.057) [-307.563] (-307.488) * (-306.075) (-309.279) [-307.126] (-308.171) -- 0:00:09
Average standard deviation of split frequencies: 0.007888
840500 -- (-307.535) (-307.283) [-306.590] (-307.046) * [-309.436] (-309.031) (-307.988) (-308.219) -- 0:00:09
841000 -- (-306.311) (-307.965) [-308.962] (-308.308) * [-308.041] (-306.773) (-307.326) (-308.945) -- 0:00:09
841500 -- (-308.182) [-306.578] (-306.085) (-309.819) * [-307.801] (-306.970) (-310.787) (-310.770) -- 0:00:09
842000 -- (-306.521) (-306.971) (-306.922) [-306.640] * (-307.967) (-307.194) [-306.128] (-308.732) -- 0:00:09
842500 -- [-306.174] (-306.036) (-309.582) (-306.966) * (-308.864) (-308.873) (-306.299) [-310.758] -- 0:00:09
843000 -- (-308.552) (-307.195) (-308.663) [-305.644] * [-307.356] (-308.432) (-306.762) (-309.686) -- 0:00:09
843500 -- [-306.333] (-307.950) (-306.197) (-306.731) * (-308.055) (-313.389) [-307.102] (-307.594) -- 0:00:09
844000 -- (-306.337) [-306.614] (-307.530) (-309.021) * (-307.341) (-307.606) [-309.228] (-307.889) -- 0:00:09
844500 -- (-307.465) (-308.954) [-307.207] (-309.008) * [-307.842] (-307.636) (-309.590) (-306.321) -- 0:00:09
845000 -- (-311.500) (-308.481) (-306.636) [-306.594] * (-308.780) (-307.828) [-311.838] (-307.326) -- 0:00:09
Average standard deviation of split frequencies: 0.007764
845500 -- (-310.982) [-306.460] (-306.926) (-312.337) * (-307.909) (-307.724) (-309.817) [-309.038] -- 0:00:09
846000 -- [-308.946] (-309.193) (-310.263) (-314.867) * (-309.246) (-307.391) (-307.998) [-306.847] -- 0:00:09
846500 -- (-307.656) [-309.646] (-307.705) (-312.671) * (-309.279) (-307.404) (-307.726) [-306.500] -- 0:00:09
847000 -- (-309.653) (-310.192) [-308.914] (-312.433) * (-306.777) (-307.245) (-308.145) [-307.242] -- 0:00:09
847500 -- (-309.325) (-310.068) [-309.141] (-305.625) * (-305.484) [-307.232] (-307.951) (-307.060) -- 0:00:08
848000 -- (-306.663) (-307.205) [-308.843] (-309.177) * (-306.387) (-307.148) [-306.934] (-307.033) -- 0:00:08
848500 -- (-311.370) (-309.680) [-306.718] (-307.681) * [-305.646] (-308.172) (-308.747) (-307.797) -- 0:00:08
849000 -- [-308.281] (-313.653) (-307.487) (-307.601) * (-307.101) (-308.531) [-306.150] (-308.617) -- 0:00:08
849500 -- (-312.176) (-311.586) (-306.925) [-307.502] * (-306.878) (-308.064) (-307.423) [-306.481] -- 0:00:08
850000 -- [-307.288] (-309.112) (-306.498) (-308.355) * (-306.143) (-308.830) [-307.004] (-308.441) -- 0:00:08
Average standard deviation of split frequencies: 0.007795
850500 -- (-307.307) (-308.948) (-309.212) [-306.558] * (-305.588) (-308.795) (-309.780) [-308.578] -- 0:00:08
851000 -- (-311.607) (-308.933) [-308.196] (-308.563) * (-310.900) [-308.511] (-310.432) (-308.651) -- 0:00:08
851500 -- (-306.357) (-312.775) (-306.782) [-307.686] * (-309.902) (-312.245) (-309.938) [-306.118] -- 0:00:08
852000 -- [-306.080] (-308.518) (-310.832) (-309.854) * (-308.929) (-311.427) [-310.725] (-306.231) -- 0:00:08
852500 -- (-309.202) [-306.750] (-307.445) (-311.675) * (-306.024) (-307.736) (-310.419) [-305.955] -- 0:00:08
853000 -- (-310.093) [-305.856] (-306.797) (-310.869) * (-306.037) (-308.189) [-308.615] (-305.532) -- 0:00:08
853500 -- (-307.165) [-305.575] (-306.770) (-310.033) * (-306.722) (-306.357) [-306.110] (-310.914) -- 0:00:08
854000 -- (-309.796) [-307.358] (-310.174) (-305.739) * (-306.733) (-307.903) (-309.045) [-310.536] -- 0:00:08
854500 -- (-306.482) (-307.765) (-309.657) [-306.911] * [-309.589] (-314.570) (-306.869) (-307.708) -- 0:00:08
855000 -- [-314.242] (-306.683) (-309.521) (-309.356) * [-308.195] (-308.662) (-307.790) (-307.200) -- 0:00:08
Average standard deviation of split frequencies: 0.008077
855500 -- [-307.417] (-308.083) (-312.656) (-306.892) * (-307.908) (-310.453) [-307.123] (-307.787) -- 0:00:08
856000 -- [-313.649] (-307.771) (-309.222) (-307.383) * (-307.638) (-307.396) [-309.069] (-308.966) -- 0:00:08
856500 -- (-309.728) (-306.461) [-306.039] (-309.372) * (-311.442) [-307.743] (-307.549) (-309.979) -- 0:00:08
857000 -- (-308.045) (-306.617) [-308.959] (-307.509) * (-309.459) [-307.619] (-307.286) (-308.740) -- 0:00:08
857500 -- (-308.917) (-307.062) [-307.510] (-311.616) * [-308.203] (-306.297) (-306.325) (-308.928) -- 0:00:08
858000 -- (-308.196) (-312.390) (-306.198) [-307.381] * (-306.680) (-306.355) (-307.740) [-308.027] -- 0:00:08
858500 -- (-308.852) (-309.933) [-306.260] (-309.638) * [-309.759] (-306.867) (-309.761) (-308.742) -- 0:00:08
859000 -- (-308.223) (-307.370) [-306.595] (-308.716) * (-306.213) [-306.426] (-309.749) (-307.917) -- 0:00:08
859500 -- (-312.078) (-306.977) [-309.118] (-311.441) * (-306.528) [-307.323] (-310.624) (-306.598) -- 0:00:08
860000 -- (-308.147) [-308.522] (-306.705) (-312.880) * (-308.734) (-305.924) [-309.060] (-308.212) -- 0:00:08
Average standard deviation of split frequencies: 0.008654
860500 -- (-306.548) (-308.446) [-307.897] (-306.430) * (-307.163) [-309.991] (-307.317) (-306.760) -- 0:00:08
861000 -- (-310.343) (-309.492) (-306.906) [-308.533] * (-306.107) [-307.064] (-306.321) (-306.104) -- 0:00:08
861500 -- (-312.204) (-310.264) [-307.306] (-305.606) * [-307.484] (-307.779) (-306.645) (-307.577) -- 0:00:08
862000 -- (-308.597) (-309.276) (-306.994) [-305.626] * (-310.800) (-308.823) (-310.093) [-309.663] -- 0:00:08
862500 -- (-308.155) (-310.745) [-305.849] (-305.695) * (-309.475) [-310.578] (-307.737) (-307.785) -- 0:00:08
863000 -- (-306.869) (-306.502) (-307.074) [-307.434] * (-308.010) (-305.896) [-306.168] (-308.023) -- 0:00:08
863500 -- (-311.375) (-307.209) [-306.346] (-309.650) * (-308.674) (-306.432) (-306.745) [-306.136] -- 0:00:08
864000 -- [-308.241] (-306.535) (-306.282) (-305.841) * (-308.975) (-312.418) [-306.114] (-309.385) -- 0:00:08
864500 -- (-309.395) [-307.813] (-307.216) (-308.951) * (-307.335) (-307.995) [-306.288] (-308.901) -- 0:00:07
865000 -- [-307.219] (-307.559) (-313.538) (-308.401) * (-308.250) (-309.026) [-310.666] (-308.963) -- 0:00:07
Average standard deviation of split frequencies: 0.008673
865500 -- (-306.975) (-306.995) (-311.278) [-307.845] * (-308.866) (-307.220) [-306.475] (-308.741) -- 0:00:07
866000 -- (-308.574) (-308.012) (-307.644) [-305.948] * (-309.487) [-306.611] (-306.314) (-308.282) -- 0:00:07
866500 -- (-308.154) (-308.304) [-307.017] (-307.346) * [-306.766] (-310.209) (-307.378) (-305.990) -- 0:00:07
867000 -- (-307.287) [-307.748] (-311.873) (-306.557) * (-307.702) (-309.632) (-306.599) [-306.517] -- 0:00:07
867500 -- (-307.870) (-308.428) [-307.850] (-307.012) * (-306.637) (-310.996) [-307.621] (-309.006) -- 0:00:07
868000 -- (-307.565) (-306.131) (-307.800) [-306.441] * (-305.644) (-311.747) (-307.773) [-306.971] -- 0:00:07
868500 -- (-309.363) [-307.650] (-309.983) (-308.216) * (-309.007) (-308.019) [-308.521] (-309.714) -- 0:00:07
869000 -- [-308.442] (-307.319) (-309.067) (-308.266) * (-307.616) [-307.988] (-306.180) (-311.052) -- 0:00:07
869500 -- (-311.316) [-310.011] (-306.415) (-309.293) * (-307.751) (-306.225) [-305.923] (-310.403) -- 0:00:07
870000 -- (-308.950) (-309.603) [-305.850] (-309.010) * [-306.503] (-306.228) (-306.964) (-311.755) -- 0:00:07
Average standard deviation of split frequencies: 0.008699
870500 -- (-310.013) [-307.590] (-312.700) (-306.890) * [-308.246] (-310.100) (-310.558) (-306.463) -- 0:00:07
871000 -- (-309.009) (-310.303) (-310.845) [-307.434] * (-306.545) (-308.206) [-307.620] (-310.529) -- 0:00:07
871500 -- [-309.190] (-310.259) (-309.050) (-306.669) * (-308.218) (-307.213) (-312.364) [-310.104] -- 0:00:07
872000 -- [-307.971] (-306.763) (-307.351) (-307.476) * (-309.941) (-309.737) (-311.080) [-308.040] -- 0:00:07
872500 -- (-306.290) [-306.318] (-307.315) (-307.708) * (-309.604) (-308.260) (-307.905) [-309.366] -- 0:00:07
873000 -- (-306.808) [-308.512] (-311.431) (-308.012) * (-308.798) [-307.535] (-306.424) (-310.216) -- 0:00:07
873500 -- (-310.318) (-312.154) (-309.014) [-309.926] * (-307.870) (-313.241) [-305.812] (-307.299) -- 0:00:07
874000 -- (-310.396) (-307.705) (-307.693) [-308.429] * (-307.183) (-307.289) (-306.619) [-311.056] -- 0:00:07
874500 -- [-309.795] (-308.219) (-307.241) (-307.919) * [-307.297] (-309.424) (-312.580) (-307.787) -- 0:00:07
875000 -- (-309.082) (-307.609) (-309.969) [-307.558] * (-309.151) (-308.345) (-308.321) [-307.696] -- 0:00:07
Average standard deviation of split frequencies: 0.008467
875500 -- [-308.765] (-311.009) (-308.422) (-307.576) * [-311.590] (-307.538) (-311.079) (-307.508) -- 0:00:07
876000 -- (-309.274) [-306.445] (-307.441) (-306.654) * [-309.525] (-308.472) (-306.508) (-307.651) -- 0:00:07
876500 -- [-306.019] (-306.586) (-310.429) (-306.801) * (-308.063) (-310.390) [-306.276] (-307.706) -- 0:00:07
877000 -- (-306.351) (-308.899) (-307.190) [-309.968] * (-309.291) (-311.342) [-305.950] (-306.986) -- 0:00:07
877500 -- (-305.935) (-308.005) (-309.217) [-306.224] * (-309.840) (-308.470) [-312.663] (-316.978) -- 0:00:07
878000 -- (-306.200) (-306.818) [-308.047] (-309.101) * [-306.476] (-306.935) (-307.443) (-312.791) -- 0:00:07
878500 -- [-310.213] (-307.305) (-311.135) (-306.751) * [-308.746] (-309.247) (-316.575) (-310.438) -- 0:00:07
879000 -- (-314.116) (-307.091) (-308.561) [-308.650] * [-306.016] (-307.334) (-308.716) (-309.272) -- 0:00:07
879500 -- (-309.077) (-308.846) [-308.416] (-309.720) * (-305.541) (-308.273) (-305.927) [-308.743] -- 0:00:07
880000 -- (-308.722) (-307.384) [-310.464] (-308.185) * (-305.909) [-308.364] (-307.424) (-307.350) -- 0:00:07
Average standard deviation of split frequencies: 0.008350
880500 -- (-308.021) (-309.739) [-308.881] (-307.058) * (-307.297) (-307.695) (-306.218) [-306.060] -- 0:00:07
881000 -- [-307.813] (-306.470) (-308.988) (-306.000) * [-308.933] (-305.987) (-307.184) (-308.518) -- 0:00:07
881500 -- (-305.732) (-307.542) (-307.211) [-306.493] * (-307.044) [-307.624] (-308.117) (-306.667) -- 0:00:06
882000 -- (-308.257) (-309.051) [-306.875] (-306.701) * [-311.793] (-310.030) (-309.139) (-308.831) -- 0:00:06
882500 -- (-309.278) (-310.366) [-306.566] (-313.125) * [-308.408] (-308.828) (-309.135) (-306.922) -- 0:00:06
883000 -- [-307.232] (-311.142) (-311.278) (-307.452) * (-310.091) (-307.584) (-308.503) [-308.029] -- 0:00:06
883500 -- [-305.722] (-309.229) (-309.170) (-308.370) * (-307.988) [-308.047] (-306.523) (-309.199) -- 0:00:06
884000 -- (-306.803) (-308.689) [-306.704] (-305.955) * [-311.859] (-310.142) (-310.037) (-309.280) -- 0:00:06
884500 -- (-309.715) (-309.705) [-307.678] (-307.063) * (-311.722) (-305.853) (-311.484) [-308.374] -- 0:00:06
885000 -- (-313.870) (-309.010) (-308.010) [-308.729] * (-307.769) [-306.993] (-309.658) (-309.548) -- 0:00:06
Average standard deviation of split frequencies: 0.008513
885500 -- [-307.500] (-307.190) (-307.467) (-307.399) * (-307.953) (-306.992) [-306.160] (-306.466) -- 0:00:06
886000 -- (-308.215) [-306.147] (-305.782) (-310.756) * [-305.968] (-306.658) (-305.765) (-308.076) -- 0:00:06
886500 -- [-307.593] (-307.302) (-307.513) (-310.521) * (-307.505) [-307.646] (-306.259) (-307.726) -- 0:00:06
887000 -- (-307.092) [-306.017] (-307.338) (-311.659) * (-308.786) [-306.597] (-309.559) (-309.455) -- 0:00:06
887500 -- [-307.732] (-308.563) (-305.661) (-307.958) * (-307.240) [-307.140] (-308.957) (-307.548) -- 0:00:06
888000 -- (-307.240) (-311.305) [-306.033] (-308.615) * (-310.532) (-307.269) [-307.240] (-307.516) -- 0:00:06
888500 -- (-309.611) (-308.118) [-309.220] (-310.149) * (-311.496) (-306.769) (-308.123) [-308.440] -- 0:00:06
889000 -- (-306.432) (-306.134) (-306.940) [-308.641] * (-311.729) (-307.537) [-307.170] (-308.953) -- 0:00:06
889500 -- (-307.055) (-308.223) (-308.386) [-306.743] * (-312.582) [-307.842] (-308.039) (-307.603) -- 0:00:06
890000 -- (-307.691) (-307.063) (-307.858) [-307.991] * (-308.608) (-312.024) [-306.110] (-309.733) -- 0:00:06
Average standard deviation of split frequencies: 0.008468
890500 -- (-311.177) (-307.263) (-306.566) [-308.678] * [-308.755] (-312.722) (-309.716) (-308.191) -- 0:00:06
891000 -- (-306.949) (-307.388) [-306.463] (-310.092) * (-306.107) (-311.142) [-308.412] (-309.468) -- 0:00:06
891500 -- (-308.565) (-308.690) [-311.129] (-307.550) * (-306.608) (-306.929) (-311.576) [-308.725] -- 0:00:06
892000 -- (-307.637) [-306.220] (-308.732) (-308.992) * (-306.353) (-309.606) (-310.589) [-307.432] -- 0:00:06
892500 -- (-309.959) (-305.891) (-308.289) [-306.739] * (-306.864) (-307.729) (-307.292) [-306.803] -- 0:00:06
893000 -- (-307.397) [-307.659] (-310.726) (-306.729) * (-309.149) (-308.163) (-311.959) [-307.152] -- 0:00:06
893500 -- (-308.654) [-307.645] (-306.109) (-308.429) * (-306.766) (-307.325) (-308.062) [-312.100] -- 0:00:06
894000 -- (-306.709) (-306.928) [-306.069] (-310.580) * (-307.054) (-306.099) [-307.646] (-313.299) -- 0:00:06
894500 -- (-306.238) (-307.323) [-307.205] (-310.285) * [-308.107] (-308.735) (-311.433) (-309.074) -- 0:00:06
895000 -- [-307.396] (-308.130) (-309.824) (-308.462) * [-306.542] (-305.988) (-310.943) (-308.966) -- 0:00:06
Average standard deviation of split frequencies: 0.008172
895500 -- (-306.491) (-310.124) [-308.147] (-306.579) * [-310.232] (-305.866) (-308.567) (-310.314) -- 0:00:06
896000 -- [-308.193] (-310.295) (-308.034) (-310.763) * [-308.155] (-305.785) (-306.524) (-308.100) -- 0:00:06
896500 -- (-308.124) (-311.146) (-307.150) [-308.598] * (-308.988) [-307.741] (-307.438) (-309.436) -- 0:00:06
897000 -- (-311.303) (-308.036) [-306.767] (-311.101) * (-310.733) (-306.272) (-307.183) [-306.291] -- 0:00:06
897500 -- (-308.542) [-309.647] (-308.604) (-309.318) * [-306.302] (-308.303) (-308.468) (-307.939) -- 0:00:06
898000 -- (-307.414) [-307.869] (-307.267) (-309.342) * (-307.766) [-309.187] (-309.890) (-308.932) -- 0:00:06
898500 -- (-311.858) [-307.636] (-308.449) (-306.572) * (-306.473) [-309.172] (-308.287) (-306.303) -- 0:00:05
899000 -- (-307.072) [-307.038] (-308.656) (-308.747) * [-308.238] (-305.925) (-309.753) (-306.685) -- 0:00:05
899500 -- [-307.403] (-306.608) (-309.526) (-309.883) * (-310.550) (-306.306) [-307.891] (-308.169) -- 0:00:05
900000 -- (-306.702) (-309.459) (-306.183) [-307.875] * (-307.686) [-306.247] (-306.259) (-306.729) -- 0:00:05
Average standard deviation of split frequencies: 0.008165
900500 -- (-308.770) [-307.720] (-306.447) (-309.187) * (-307.512) (-309.896) [-309.075] (-307.631) -- 0:00:05
901000 -- (-309.724) [-306.836] (-306.554) (-308.816) * [-309.767] (-313.322) (-307.958) (-307.054) -- 0:00:05
901500 -- (-306.702) (-310.239) (-307.004) [-306.009] * [-307.351] (-308.709) (-309.344) (-309.955) -- 0:00:05
902000 -- (-308.265) [-306.954] (-308.577) (-306.010) * (-309.796) [-307.999] (-307.641) (-307.292) -- 0:00:05
902500 -- (-308.687) (-307.127) [-306.179] (-307.766) * (-307.077) (-309.964) (-307.979) [-306.442] -- 0:00:05
903000 -- (-307.776) (-306.051) [-308.909] (-306.514) * (-307.534) (-308.430) (-307.849) [-308.423] -- 0:00:05
903500 -- (-307.011) (-307.215) (-306.992) [-307.581] * (-309.185) [-308.277] (-308.044) (-312.567) -- 0:00:05
904000 -- (-307.558) (-306.790) [-307.107] (-309.240) * (-310.426) [-308.330] (-306.549) (-307.101) -- 0:00:05
904500 -- (-308.832) [-305.751] (-309.614) (-307.260) * [-307.461] (-305.901) (-307.168) (-308.638) -- 0:00:05
905000 -- (-309.936) (-313.332) (-307.601) [-306.574] * (-309.912) (-307.120) (-307.986) [-307.395] -- 0:00:05
Average standard deviation of split frequencies: 0.008186
905500 -- (-308.700) (-305.798) (-306.720) [-307.759] * [-310.533] (-311.435) (-306.497) (-307.399) -- 0:00:05
906000 -- [-308.701] (-306.240) (-308.602) (-309.891) * (-309.438) (-308.093) [-306.570] (-313.495) -- 0:00:05
906500 -- [-307.816] (-306.952) (-307.877) (-308.532) * (-309.275) (-307.702) [-306.984] (-308.593) -- 0:00:05
907000 -- (-309.588) [-306.008] (-307.042) (-306.454) * (-307.143) (-309.445) [-308.025] (-308.296) -- 0:00:05
907500 -- (-311.253) [-308.950] (-309.303) (-311.487) * [-311.474] (-307.115) (-306.169) (-306.076) -- 0:00:05
908000 -- (-307.806) (-308.871) (-309.040) [-308.273] * [-308.517] (-307.448) (-310.268) (-307.512) -- 0:00:05
908500 -- (-308.964) (-308.315) (-305.903) [-309.703] * (-309.957) (-310.065) (-308.878) [-309.477] -- 0:00:05
909000 -- (-313.940) (-306.266) (-308.510) [-310.856] * [-307.345] (-309.788) (-307.459) (-310.042) -- 0:00:05
909500 -- (-313.656) (-306.990) [-308.333] (-314.776) * (-307.190) (-306.876) [-312.639] (-307.677) -- 0:00:05
910000 -- (-306.759) (-306.807) [-308.549] (-308.563) * (-307.197) (-310.341) [-305.871] (-308.651) -- 0:00:05
Average standard deviation of split frequencies: 0.008213
910500 -- (-307.364) [-309.605] (-309.128) (-309.337) * [-306.079] (-311.316) (-312.578) (-305.638) -- 0:00:05
911000 -- (-309.104) (-314.663) (-308.817) [-308.456] * (-306.667) (-307.284) (-308.272) [-306.915] -- 0:00:05
911500 -- (-307.232) (-312.006) [-307.041] (-310.909) * (-307.553) (-308.416) (-306.533) [-308.015] -- 0:00:05
912000 -- [-308.217] (-310.150) (-306.704) (-310.392) * (-307.968) (-306.792) [-306.937] (-306.740) -- 0:00:05
912500 -- (-308.318) (-307.594) [-308.262] (-307.623) * [-306.727] (-309.116) (-309.008) (-306.682) -- 0:00:05
913000 -- (-307.051) (-308.685) [-308.648] (-307.576) * (-306.737) [-308.288] (-307.755) (-307.077) -- 0:00:05
913500 -- [-307.108] (-311.387) (-308.544) (-307.477) * [-306.588] (-308.493) (-309.727) (-307.573) -- 0:00:05
914000 -- (-307.358) [-311.927] (-309.122) (-310.894) * (-306.361) [-306.817] (-309.570) (-308.143) -- 0:00:05
914500 -- [-310.632] (-309.411) (-308.225) (-307.131) * (-309.655) (-308.107) (-307.365) [-308.598] -- 0:00:05
915000 -- (-307.051) (-307.584) [-306.576] (-307.259) * [-306.562] (-306.140) (-307.971) (-310.780) -- 0:00:05
Average standard deviation of split frequencies: 0.008371
915500 -- (-310.634) (-307.535) [-306.635] (-308.217) * [-306.922] (-307.303) (-309.155) (-309.577) -- 0:00:04
916000 -- (-308.583) (-308.860) [-306.437] (-308.264) * [-309.435] (-309.715) (-306.448) (-311.383) -- 0:00:04
916500 -- (-310.385) (-308.904) (-308.004) [-307.551] * (-306.895) [-309.393] (-308.837) (-306.830) -- 0:00:04
917000 -- [-307.742] (-306.459) (-307.394) (-307.479) * (-306.739) [-306.563] (-309.545) (-307.148) -- 0:00:04
917500 -- (-307.636) [-306.111] (-305.844) (-308.337) * (-310.753) (-307.582) (-312.959) [-306.280] -- 0:00:04
918000 -- [-306.601] (-306.652) (-306.842) (-309.213) * (-308.325) (-307.139) (-308.654) [-308.233] -- 0:00:04
918500 -- [-307.922] (-307.120) (-307.239) (-307.321) * [-306.668] (-306.229) (-306.931) (-306.101) -- 0:00:04
919000 -- (-310.262) (-308.142) [-307.681] (-308.987) * (-307.404) [-308.457] (-307.945) (-306.828) -- 0:00:04
919500 -- [-308.198] (-308.329) (-310.069) (-319.498) * (-307.386) (-306.939) [-311.763] (-307.607) -- 0:00:04
920000 -- (-308.982) (-308.944) (-311.195) [-307.489] * (-308.121) (-306.560) (-310.799) [-307.540] -- 0:00:04
Average standard deviation of split frequencies: 0.008500
920500 -- (-310.070) (-311.498) (-307.073) [-305.984] * (-309.349) (-307.429) [-307.181] (-308.870) -- 0:00:04
921000 -- [-307.613] (-311.822) (-308.845) (-309.629) * (-311.723) [-306.794] (-307.521) (-309.152) -- 0:00:04
921500 -- (-308.397) [-306.091] (-307.843) (-306.652) * [-306.624] (-307.185) (-309.833) (-307.870) -- 0:00:04
922000 -- [-309.910] (-305.863) (-308.598) (-307.157) * [-307.415] (-305.909) (-307.924) (-306.411) -- 0:00:04
922500 -- [-310.872] (-305.572) (-307.310) (-309.836) * (-306.587) (-308.091) [-308.858] (-306.213) -- 0:00:04
923000 -- [-307.418] (-307.941) (-307.660) (-307.975) * (-312.627) (-306.512) [-308.350] (-306.803) -- 0:00:04
923500 -- (-305.865) (-307.631) [-308.397] (-306.928) * (-307.952) (-309.256) [-306.605] (-307.999) -- 0:00:04
924000 -- (-306.274) (-309.087) (-306.764) [-307.105] * (-308.152) (-309.328) (-310.511) [-306.727] -- 0:00:04
924500 -- (-308.191) (-307.905) (-306.556) [-308.718] * [-306.151] (-308.783) (-309.595) (-306.841) -- 0:00:04
925000 -- [-307.458] (-309.487) (-309.791) (-308.443) * (-310.834) (-307.444) [-309.973] (-307.488) -- 0:00:04
Average standard deviation of split frequencies: 0.008960
925500 -- (-306.627) (-308.977) [-309.343] (-309.029) * (-308.567) [-305.842] (-309.196) (-308.029) -- 0:00:04
926000 -- [-306.126] (-310.643) (-308.719) (-305.918) * (-309.389) (-308.459) (-307.843) [-308.264] -- 0:00:04
926500 -- (-306.463) [-307.734] (-308.635) (-307.464) * (-306.231) (-305.977) [-310.466] (-306.680) -- 0:00:04
927000 -- (-309.500) (-308.399) [-306.036] (-307.140) * (-307.649) (-308.506) [-307.186] (-308.124) -- 0:00:04
927500 -- (-310.293) (-309.058) [-307.413] (-307.801) * (-311.359) (-307.796) (-309.574) [-306.841] -- 0:00:04
928000 -- (-307.275) (-306.283) [-307.714] (-306.628) * (-307.455) (-308.999) (-311.255) [-307.199] -- 0:00:04
928500 -- (-310.378) (-310.688) (-308.284) [-306.996] * (-306.660) (-309.110) [-308.110] (-311.762) -- 0:00:04
929000 -- (-310.094) [-306.098] (-308.722) (-309.938) * [-312.495] (-308.228) (-307.202) (-307.661) -- 0:00:04
929500 -- (-310.770) (-306.144) [-306.739] (-308.132) * (-314.494) (-308.816) [-309.114] (-309.253) -- 0:00:04
930000 -- (-312.031) [-307.552] (-306.489) (-307.942) * [-306.211] (-309.141) (-310.369) (-307.819) -- 0:00:04
Average standard deviation of split frequencies: 0.009286
930500 -- (-307.226) [-309.305] (-308.396) (-309.900) * (-306.600) (-308.592) [-309.482] (-306.145) -- 0:00:04
931000 -- (-310.242) (-307.257) (-307.103) [-309.874] * (-310.790) (-306.538) (-308.021) [-306.126] -- 0:00:04
931500 -- (-311.946) [-307.049] (-306.978) (-307.268) * (-312.844) (-306.270) [-308.006] (-307.830) -- 0:00:04
932000 -- (-310.568) [-305.895] (-306.972) (-308.692) * (-307.989) [-305.884] (-307.703) (-306.892) -- 0:00:04
932500 -- (-315.383) (-305.911) [-310.205] (-312.902) * (-307.885) [-306.512] (-308.822) (-306.399) -- 0:00:03
933000 -- (-308.400) (-306.835) (-307.493) [-312.823] * (-309.535) [-306.337] (-308.423) (-310.162) -- 0:00:03
933500 -- (-309.758) (-306.643) (-306.766) [-306.879] * [-309.266] (-306.863) (-306.700) (-310.470) -- 0:00:03
934000 -- (-310.633) (-307.844) (-306.783) [-307.637] * (-308.186) (-306.767) (-306.098) [-307.398] -- 0:00:03
934500 -- (-313.072) (-306.217) (-307.169) [-307.821] * (-309.852) (-306.838) (-307.879) [-308.833] -- 0:00:03
935000 -- (-311.790) (-307.637) (-308.790) [-307.902] * (-310.513) (-307.867) [-307.864] (-306.405) -- 0:00:03
Average standard deviation of split frequencies: 0.009099
935500 -- (-312.948) (-307.279) (-307.381) [-308.035] * [-307.657] (-308.291) (-309.291) (-315.245) -- 0:00:03
936000 -- (-309.675) [-309.848] (-308.233) (-307.737) * (-307.107) (-309.452) [-306.360] (-311.038) -- 0:00:03
936500 -- (-305.927) (-308.748) [-306.868] (-309.140) * (-306.336) (-307.863) [-309.374] (-308.258) -- 0:00:03
937000 -- [-309.424] (-307.226) (-310.816) (-306.774) * (-306.281) [-306.834] (-308.361) (-311.928) -- 0:00:03
937500 -- [-307.080] (-307.390) (-308.187) (-307.142) * (-307.167) (-309.243) [-308.179] (-309.624) -- 0:00:03
938000 -- [-306.763] (-306.753) (-307.431) (-307.184) * (-307.275) [-306.661] (-307.676) (-309.080) -- 0:00:03
938500 -- [-307.112] (-307.152) (-307.968) (-307.859) * [-307.085] (-306.232) (-306.932) (-309.107) -- 0:00:03
939000 -- [-306.517] (-307.081) (-307.241) (-308.312) * [-307.291] (-307.168) (-307.263) (-307.472) -- 0:00:03
939500 -- (-310.725) (-309.526) (-307.832) [-306.417] * (-310.310) (-306.112) (-308.097) [-310.031] -- 0:00:03
940000 -- (-307.102) (-308.795) [-309.687] (-308.480) * [-312.474] (-306.603) (-308.742) (-306.338) -- 0:00:03
Average standard deviation of split frequencies: 0.008920
940500 -- (-308.337) [-308.156] (-309.288) (-309.785) * (-305.983) [-307.009] (-307.733) (-307.540) -- 0:00:03
941000 -- [-308.237] (-306.696) (-309.092) (-308.463) * (-306.421) (-306.033) (-309.586) [-312.490] -- 0:00:03
941500 -- (-307.139) (-306.983) (-306.661) [-307.842] * (-306.851) [-306.195] (-310.740) (-309.295) -- 0:00:03
942000 -- (-306.889) (-313.226) [-307.163] (-309.746) * (-308.048) [-307.531] (-306.555) (-306.603) -- 0:00:03
942500 -- (-307.966) (-306.077) (-307.641) [-307.911] * (-306.388) (-310.766) (-309.773) [-308.720] -- 0:00:03
943000 -- (-313.378) [-308.413] (-309.957) (-308.244) * (-307.423) [-308.344] (-309.875) (-308.154) -- 0:00:03
943500 -- (-308.705) (-307.958) [-306.537] (-307.989) * (-309.103) [-306.835] (-307.872) (-306.446) -- 0:00:03
944000 -- (-308.572) [-307.757] (-308.180) (-308.218) * (-307.556) (-307.189) [-307.824] (-306.413) -- 0:00:03
944500 -- (-307.139) (-307.035) [-306.643] (-312.279) * [-307.146] (-306.384) (-308.592) (-307.383) -- 0:00:03
945000 -- (-305.907) [-307.830] (-308.266) (-308.583) * (-309.160) [-309.517] (-307.745) (-308.933) -- 0:00:03
Average standard deviation of split frequencies: 0.009534
945500 -- [-306.480] (-309.821) (-308.590) (-306.464) * [-308.108] (-307.210) (-308.410) (-307.333) -- 0:00:03
946000 -- [-309.197] (-307.644) (-308.379) (-309.795) * (-309.060) (-306.078) [-306.653] (-308.309) -- 0:00:03
946500 -- (-309.848) [-310.332] (-307.604) (-307.078) * [-306.798] (-306.046) (-306.412) (-309.245) -- 0:00:03
947000 -- [-306.069] (-308.952) (-306.157) (-308.363) * (-315.174) [-307.108] (-306.981) (-309.751) -- 0:00:03
947500 -- (-308.556) (-307.913) [-307.697] (-308.601) * (-307.514) [-307.365] (-307.251) (-309.868) -- 0:00:03
948000 -- (-308.828) (-307.254) (-309.541) [-312.057] * (-307.935) (-308.596) (-307.834) [-307.762] -- 0:00:03
948500 -- (-306.503) (-306.674) (-310.285) [-308.457] * (-311.071) [-306.983] (-310.126) (-306.827) -- 0:00:03
949000 -- (-307.581) (-310.819) (-306.645) [-306.395] * (-311.085) (-306.892) [-308.090] (-309.048) -- 0:00:03
949500 -- (-307.975) [-308.457] (-307.420) (-307.258) * (-309.364) (-306.681) (-307.512) [-306.040] -- 0:00:02
950000 -- (-308.030) (-308.877) [-307.522] (-307.720) * (-308.929) (-310.747) (-308.039) [-306.392] -- 0:00:02
Average standard deviation of split frequencies: 0.009091
950500 -- (-306.946) (-307.074) (-312.621) [-311.333] * [-311.082] (-307.707) (-308.609) (-307.068) -- 0:00:02
951000 -- (-309.125) [-307.321] (-310.370) (-312.651) * (-310.160) (-307.502) [-308.392] (-307.663) -- 0:00:02
951500 -- (-311.032) (-307.651) [-307.716] (-307.577) * (-311.501) (-311.671) (-306.829) [-307.008] -- 0:00:02
952000 -- (-309.114) (-308.078) (-307.277) [-307.155] * (-315.588) (-308.574) [-307.582] (-307.326) -- 0:00:02
952500 -- (-309.990) [-311.482] (-306.668) (-307.571) * (-306.831) (-312.820) (-306.592) [-305.879] -- 0:00:02
953000 -- (-307.999) [-308.922] (-309.407) (-309.447) * (-308.208) (-308.069) (-307.360) [-312.308] -- 0:00:02
953500 -- (-307.662) [-310.392] (-309.545) (-309.076) * (-306.740) (-306.421) (-306.097) [-306.816] -- 0:00:02
954000 -- (-306.757) (-308.231) [-308.102] (-310.740) * (-308.184) (-307.231) (-309.935) [-307.300] -- 0:00:02
954500 -- (-306.555) [-308.968] (-308.302) (-307.592) * (-306.738) (-308.960) [-307.660] (-307.640) -- 0:00:02
955000 -- [-306.825] (-307.810) (-311.904) (-307.668) * (-307.761) (-305.821) [-306.137] (-308.218) -- 0:00:02
Average standard deviation of split frequencies: 0.008974
955500 -- (-307.546) (-308.290) [-308.508] (-307.795) * (-309.040) (-311.315) (-305.914) [-308.208] -- 0:00:02
956000 -- (-306.885) (-310.215) [-308.125] (-307.776) * (-308.880) [-308.398] (-311.640) (-306.712) -- 0:00:02
956500 -- (-307.560) (-307.579) [-308.470] (-308.927) * (-308.211) [-306.932] (-307.854) (-312.253) -- 0:00:02
957000 -- (-312.463) (-307.931) (-308.784) [-307.459] * (-306.509) (-306.777) [-309.098] (-311.175) -- 0:00:02
957500 -- [-306.281] (-307.627) (-307.632) (-306.704) * (-306.091) [-308.750] (-307.520) (-309.276) -- 0:00:02
958000 -- (-305.756) (-306.766) (-307.401) [-306.237] * [-309.912] (-310.203) (-309.906) (-308.320) -- 0:00:02
958500 -- (-306.700) [-308.996] (-310.039) (-307.941) * (-308.944) (-307.669) (-306.512) [-310.319] -- 0:00:02
959000 -- [-305.815] (-305.585) (-309.671) (-307.696) * [-308.840] (-306.639) (-308.899) (-313.890) -- 0:00:02
959500 -- (-307.614) (-309.476) (-310.980) [-306.602] * (-307.130) (-307.128) (-306.263) [-309.849] -- 0:00:02
960000 -- (-309.230) [-308.412] (-308.944) (-305.983) * [-306.747] (-308.646) (-307.472) (-307.985) -- 0:00:02
Average standard deviation of split frequencies: 0.009356
960500 -- (-309.360) [-311.924] (-308.551) (-307.492) * (-308.231) (-306.450) (-310.286) [-306.703] -- 0:00:02
961000 -- (-313.016) [-305.940] (-306.968) (-307.253) * (-316.054) (-308.637) [-307.124] (-307.446) -- 0:00:02
961500 -- (-309.529) (-308.405) (-307.524) [-308.169] * [-308.588] (-307.464) (-307.258) (-310.443) -- 0:00:02
962000 -- [-307.411] (-307.533) (-308.458) (-307.250) * [-305.931] (-307.260) (-306.466) (-307.000) -- 0:00:02
962500 -- (-305.743) [-307.216] (-307.981) (-306.150) * [-307.939] (-306.701) (-306.219) (-307.918) -- 0:00:02
963000 -- (-311.394) (-306.354) [-306.122] (-307.854) * (-308.598) [-308.492] (-306.413) (-306.620) -- 0:00:02
963500 -- [-309.386] (-308.389) (-306.536) (-311.301) * (-306.489) [-307.630] (-305.853) (-306.468) -- 0:00:02
964000 -- (-309.603) (-307.894) (-307.037) [-306.250] * (-308.462) (-307.517) [-306.017] (-309.784) -- 0:00:02
964500 -- (-310.377) (-310.094) (-314.215) [-306.134] * (-308.160) (-306.308) [-306.476] (-306.528) -- 0:00:02
965000 -- (-309.353) (-307.209) (-314.679) [-307.276] * (-309.285) (-309.015) [-306.189] (-307.890) -- 0:00:02
Average standard deviation of split frequencies: 0.009142
965500 -- (-309.491) (-309.587) (-311.169) [-305.920] * (-310.385) (-306.765) [-307.920] (-309.452) -- 0:00:02
966000 -- (-309.864) (-309.417) (-307.974) [-306.257] * (-307.354) (-308.337) (-307.686) [-308.044] -- 0:00:02
966500 -- (-305.849) (-309.949) [-307.986] (-312.143) * (-308.022) [-307.875] (-307.635) (-306.346) -- 0:00:01
967000 -- (-306.672) [-312.461] (-306.137) (-308.437) * [-308.680] (-309.222) (-308.384) (-306.200) -- 0:00:01
967500 -- (-311.112) [-307.239] (-315.103) (-308.265) * (-311.824) [-309.858] (-309.356) (-306.787) -- 0:00:01
968000 -- (-309.109) [-307.944] (-310.456) (-309.077) * (-309.718) [-308.425] (-307.180) (-305.861) -- 0:00:01
968500 -- (-306.813) [-308.918] (-306.867) (-308.168) * (-307.422) [-306.370] (-307.321) (-307.657) -- 0:00:01
969000 -- (-308.133) [-309.207] (-307.783) (-308.022) * (-306.779) (-313.880) [-306.609] (-308.676) -- 0:00:01
969500 -- (-306.731) (-307.910) [-307.778] (-307.521) * (-308.547) [-307.745] (-306.861) (-309.578) -- 0:00:01
970000 -- [-306.110] (-309.107) (-308.858) (-306.875) * (-308.912) [-306.215] (-307.623) (-309.562) -- 0:00:01
Average standard deviation of split frequencies: 0.009324
970500 -- [-305.939] (-309.541) (-308.298) (-310.963) * (-307.084) [-306.748] (-306.499) (-309.207) -- 0:00:01
971000 -- (-306.711) [-306.053] (-306.656) (-308.574) * (-307.205) (-308.474) (-307.274) [-308.329] -- 0:00:01
971500 -- (-308.073) (-309.964) [-306.258] (-312.218) * (-306.582) [-306.327] (-310.871) (-307.180) -- 0:00:01
972000 -- (-306.543) (-309.436) [-305.935] (-314.764) * (-306.156) (-308.955) (-306.738) [-306.288] -- 0:00:01
972500 -- (-307.375) (-305.589) (-309.226) [-309.423] * [-306.248] (-309.512) (-309.368) (-305.884) -- 0:00:01
973000 -- [-308.263] (-307.620) (-306.870) (-309.688) * (-307.409) (-307.013) (-306.952) [-305.662] -- 0:00:01
973500 -- (-307.843) (-307.359) [-308.215] (-311.903) * (-308.980) (-307.333) [-307.806] (-308.272) -- 0:00:01
974000 -- (-307.548) [-307.414] (-307.328) (-307.319) * (-308.281) (-310.109) [-310.165] (-316.697) -- 0:00:01
974500 -- [-310.569] (-307.348) (-306.704) (-309.705) * (-307.208) (-307.391) [-307.180] (-308.266) -- 0:00:01
975000 -- (-308.974) (-308.673) [-307.355] (-312.145) * [-307.774] (-308.294) (-305.879) (-307.669) -- 0:00:01
Average standard deviation of split frequencies: 0.008984
975500 -- [-311.363] (-308.033) (-310.791) (-307.519) * (-308.074) (-306.565) (-307.653) [-307.441] -- 0:00:01
976000 -- [-307.987] (-308.165) (-307.044) (-307.845) * (-308.388) [-306.679] (-307.802) (-307.594) -- 0:00:01
976500 -- (-308.384) (-310.990) [-306.269] (-307.513) * (-309.872) (-307.724) (-306.592) [-307.639] -- 0:00:01
977000 -- (-307.391) [-307.989] (-307.153) (-313.935) * (-310.819) (-307.491) [-309.640] (-307.575) -- 0:00:01
977500 -- (-306.502) [-306.390] (-306.319) (-309.048) * (-309.799) [-308.069] (-308.412) (-308.316) -- 0:00:01
978000 -- (-310.178) (-312.461) (-311.022) [-310.137] * [-309.917] (-308.480) (-305.869) (-310.092) -- 0:00:01
978500 -- (-306.950) (-307.648) [-307.538] (-310.560) * (-306.453) (-311.193) [-306.805] (-308.369) -- 0:00:01
979000 -- [-308.881] (-306.541) (-308.012) (-308.829) * (-307.719) [-307.071] (-307.529) (-306.529) -- 0:00:01
979500 -- [-308.177] (-307.130) (-309.618) (-308.271) * [-306.940] (-307.417) (-308.331) (-306.238) -- 0:00:01
980000 -- [-308.108] (-309.276) (-309.641) (-306.529) * (-308.441) [-306.930] (-310.657) (-311.773) -- 0:00:01
Average standard deviation of split frequencies: 0.009358
980500 -- [-307.960] (-306.753) (-307.738) (-307.314) * (-306.762) [-306.863] (-307.195) (-306.966) -- 0:00:01
981000 -- (-307.068) (-306.068) (-306.017) [-307.552] * (-309.414) [-308.957] (-306.993) (-308.507) -- 0:00:01
981500 -- [-308.061] (-306.278) (-308.198) (-306.745) * (-307.140) (-307.133) (-306.606) [-306.499] -- 0:00:01
982000 -- [-307.209] (-305.579) (-305.966) (-307.704) * (-306.324) [-306.831] (-307.669) (-310.977) -- 0:00:01
982500 -- (-309.368) [-306.101] (-305.720) (-308.408) * [-308.757] (-305.784) (-307.215) (-309.646) -- 0:00:01
983000 -- (-306.955) (-307.559) (-308.784) [-306.185] * (-305.850) [-310.923] (-307.496) (-309.579) -- 0:00:01
983500 -- (-307.239) (-308.995) (-311.509) [-306.490] * [-306.350] (-306.886) (-306.689) (-307.818) -- 0:00:00
984000 -- [-309.129] (-308.408) (-307.859) (-306.885) * (-307.997) (-309.774) [-308.240] (-307.332) -- 0:00:00
984500 -- (-309.240) [-307.140] (-309.811) (-307.590) * (-311.072) (-307.384) [-309.371] (-306.172) -- 0:00:00
985000 -- (-311.482) [-307.532] (-309.565) (-308.768) * (-306.562) (-308.016) [-311.462] (-307.493) -- 0:00:00
Average standard deviation of split frequencies: 0.009052
985500 -- [-307.134] (-306.344) (-309.426) (-306.786) * (-306.077) (-309.564) [-307.469] (-306.768) -- 0:00:00
986000 -- (-307.066) (-306.856) (-308.712) [-311.890] * (-306.467) (-306.492) [-308.146] (-306.854) -- 0:00:00
986500 -- (-307.912) [-309.158] (-307.566) (-308.748) * (-307.085) [-309.382] (-310.583) (-306.863) -- 0:00:00
987000 -- [-309.539] (-309.840) (-306.672) (-308.323) * [-307.244] (-307.727) (-310.566) (-310.645) -- 0:00:00
987500 -- (-308.044) [-308.014] (-311.611) (-308.631) * (-309.843) [-307.992] (-309.093) (-307.241) -- 0:00:00
988000 -- [-307.794] (-307.452) (-310.984) (-307.810) * (-305.778) (-309.950) (-308.611) [-309.459] -- 0:00:00
988500 -- (-307.607) (-306.907) [-314.730] (-305.772) * (-309.400) [-306.270] (-308.407) (-306.779) -- 0:00:00
989000 -- [-307.086] (-306.283) (-316.296) (-306.112) * (-306.106) [-307.033] (-307.474) (-308.398) -- 0:00:00
989500 -- (-309.588) (-308.673) (-314.766) [-305.510] * (-307.047) (-306.550) (-310.485) [-308.405] -- 0:00:00
990000 -- (-306.533) (-307.007) (-306.628) [-305.963] * (-305.895) [-307.592] (-307.524) (-308.123) -- 0:00:00
Average standard deviation of split frequencies: 0.009041
990500 -- (-308.114) [-306.431] (-308.399) (-308.359) * (-307.940) (-309.431) (-309.881) [-309.896] -- 0:00:00
991000 -- (-306.595) (-308.463) [-309.215] (-307.357) * (-307.664) (-309.526) (-306.419) [-308.269] -- 0:00:00
991500 -- (-306.414) (-307.310) (-308.203) [-309.157] * (-308.074) (-309.206) (-306.645) [-308.932] -- 0:00:00
992000 -- (-309.094) (-308.335) (-311.379) [-307.263] * [-309.624] (-312.041) (-307.528) (-308.015) -- 0:00:00
992500 -- [-307.690] (-306.867) (-309.914) (-307.323) * (-309.106) [-306.412] (-307.590) (-307.227) -- 0:00:00
993000 -- [-306.599] (-307.781) (-313.453) (-310.666) * (-310.313) (-306.116) (-308.324) [-306.144] -- 0:00:00
993500 -- (-308.252) [-309.239] (-309.320) (-310.541) * (-312.438) (-306.798) (-307.927) [-305.940] -- 0:00:00
994000 -- (-307.471) (-306.275) (-308.507) [-306.762] * (-309.627) [-306.306] (-308.909) (-306.597) -- 0:00:00
994500 -- (-307.713) (-306.955) [-308.488] (-307.128) * (-310.697) (-307.563) (-308.465) [-306.432] -- 0:00:00
995000 -- (-307.013) [-310.776] (-307.082) (-309.057) * (-307.636) (-308.401) [-307.450] (-308.074) -- 0:00:00
Average standard deviation of split frequencies: 0.009056
995500 -- [-306.716] (-307.236) (-308.512) (-307.719) * (-311.710) (-311.281) [-306.941] (-312.009) -- 0:00:00
996000 -- (-309.898) (-308.469) [-307.227] (-311.223) * (-312.997) (-308.000) [-308.520] (-307.051) -- 0:00:00
996500 -- (-308.178) (-307.242) (-306.691) [-305.996] * [-308.431] (-307.474) (-307.269) (-307.696) -- 0:00:00
997000 -- [-308.096] (-307.435) (-307.678) (-309.414) * (-307.109) (-306.669) [-315.013] (-306.562) -- 0:00:00
997500 -- [-308.242] (-306.550) (-306.054) (-308.700) * [-305.811] (-307.118) (-308.744) (-305.887) -- 0:00:00
998000 -- (-305.954) (-307.901) (-306.964) [-308.586] * (-306.862) [-307.775] (-307.084) (-309.016) -- 0:00:00
998500 -- (-311.170) (-309.738) [-306.583] (-309.550) * [-307.924] (-306.406) (-306.961) (-306.838) -- 0:00:00
999000 -- (-313.620) (-307.083) (-306.202) [-308.508] * [-306.676] (-309.753) (-308.901) (-309.271) -- 0:00:00
999500 -- (-307.010) [-308.127] (-308.048) (-312.866) * [-318.844] (-306.939) (-307.180) (-310.045) -- 0:00:00
1000000 -- (-307.621) [-307.176] (-307.113) (-317.779) * (-308.649) (-307.248) [-311.013] (-309.189) -- 0:00:00
Average standard deviation of split frequencies: 0.009139
Analysis completed in 59 seconds
Analysis used 58.32 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -305.42
Likelihood of best state for "cold" chain of run 2 was -305.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 74 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
45.5 % ( 26 %) Dirichlet(Pi{all})
43.1 % ( 31 %) Slider(Pi{all})
78.7 % ( 57 %) Multiplier(Alpha{1,2})
77.6 % ( 53 %) Multiplier(Alpha{3})
27.0 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
45.3 % ( 29 %) Dirichlet(Pi{all})
43.4 % ( 34 %) Slider(Pi{all})
78.9 % ( 51 %) Multiplier(Alpha{1,2})
77.7 % ( 57 %) Multiplier(Alpha{3})
26.8 % ( 25 %) Slider(Pinvar{all})
98.7 % ( 97 %) ExtSPR(Tau{all},V{all})
70.1 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.8 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166863 0.82 0.67
3 | 166792 166788 0.84
4 | 166750 167027 165780
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167028 0.83 0.67
3 | 166736 166506 0.84
4 | 166411 166117 167202
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -307.22
| 2 1 2 1 1 |
| 2 |
| 1 2 2 1 * 2 |
| 1 2 2 1 2 1 |
| 1 1 1 1 2 2 21 |
| 2 1 1 * 2 2 2 2 12 11 1 1 |
| 1 2 211 21 2 112 |
| 2 2 2 2 11 2 1 1 2 1 2 12 1|
| 2 211 1 1 22 1 2 2 * |
|* 12 1 1 2 2 2 2 2 2 2 2 1 |
| 2 2 1 2 |
| 11 2 1 1 21 1 1 |
| 1 2 1 2 1 1 2|
| 2 1 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -308.70
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -307.16 -310.27
2 -307.16 -312.45
--------------------------------------
TOTAL -307.16 -311.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903120 0.096292 0.380725 1.548777 0.864778 1393.30 1447.15 1.000
r(A<->C){all} 0.159460 0.018889 0.000097 0.432540 0.122683 151.52 271.19 1.001
r(A<->G){all} 0.173682 0.020744 0.000260 0.467426 0.136729 157.72 203.58 1.000
r(A<->T){all} 0.161654 0.019530 0.000011 0.450906 0.123403 268.51 273.33 1.000
r(C<->G){all} 0.162676 0.018708 0.000192 0.434680 0.129530 214.55 248.02 1.001
r(C<->T){all} 0.162589 0.021193 0.000068 0.475185 0.119939 194.41 234.49 1.002
r(G<->T){all} 0.179939 0.023771 0.000079 0.485820 0.137356 90.20 212.26 1.009
pi(A){all} 0.203435 0.000721 0.150266 0.254224 0.203168 910.25 1150.95 1.000
pi(C){all} 0.235081 0.000818 0.180177 0.292458 0.234603 1202.82 1204.81 1.000
pi(G){all} 0.301610 0.000898 0.242635 0.357061 0.301042 1097.53 1154.98 1.000
pi(T){all} 0.259874 0.000860 0.201200 0.313430 0.259568 1199.88 1227.07 1.000
alpha{1,2} 0.412489 0.224919 0.000165 1.359574 0.241668 1015.77 1124.18 1.000
alpha{3} 0.466392 0.243742 0.000346 1.439055 0.305297 1280.70 1346.69 1.000
pinvar{all} 0.992503 0.000090 0.975829 0.999994 0.995489 1277.37 1312.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .**...
9 -- ..*.*.
10 -- .****.
11 -- .*..*.
12 -- .***.*
13 -- ...**.
14 -- .**.**
15 -- .*.*..
16 -- ..****
17 -- ...*.*
18 -- .*...*
19 -- .*.***
20 -- ....**
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 463 0.154231 0.007066 0.149234 0.159227 2
8 460 0.153231 0.014133 0.143238 0.163225 2
9 447 0.148901 0.007066 0.143904 0.153897 2
10 435 0.144903 0.010835 0.137242 0.152565 2
11 434 0.144570 0.007537 0.139241 0.149900 2
12 433 0.144237 0.007066 0.139241 0.149234 2
13 430 0.143238 0.012248 0.134577 0.151899 2
14 426 0.141905 0.009422 0.135243 0.148568 2
15 424 0.141239 0.008480 0.135243 0.147235 2
16 423 0.140906 0.009893 0.133911 0.147901 2
17 419 0.139574 0.008009 0.133911 0.145237 2
18 418 0.139241 0.019786 0.125250 0.153231 2
19 418 0.139241 0.000942 0.138574 0.139907 2
20 409 0.136243 0.010835 0.128581 0.143904 2
21 406 0.135243 0.003769 0.132578 0.137908 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.102418 0.010620 0.000001 0.310922 0.072589 1.000 2
length{all}[2] 0.101549 0.011044 0.000001 0.304088 0.069896 1.000 2
length{all}[3] 0.098230 0.009641 0.000008 0.302414 0.068461 1.001 2
length{all}[4] 0.102306 0.010466 0.000052 0.304193 0.069935 1.000 2
length{all}[5] 0.099980 0.010524 0.000004 0.306040 0.066809 1.000 2
length{all}[6] 0.097337 0.009822 0.000012 0.291041 0.067191 1.000 2
length{all}[7] 0.096010 0.010500 0.000026 0.304365 0.062799 0.998 2
length{all}[8] 0.097348 0.009388 0.000271 0.286912 0.064679 0.999 2
length{all}[9] 0.098931 0.010601 0.000102 0.291837 0.065449 1.006 2
length{all}[10] 0.100655 0.010464 0.000225 0.292692 0.065295 0.998 2
length{all}[11] 0.098752 0.009762 0.000002 0.295224 0.069368 1.000 2
length{all}[12] 0.103955 0.009026 0.000265 0.282644 0.084891 1.003 2
length{all}[13] 0.105373 0.011586 0.000468 0.339052 0.066750 0.999 2
length{all}[14] 0.092753 0.008730 0.000112 0.288407 0.064867 0.999 2
length{all}[15] 0.111793 0.011047 0.000238 0.339887 0.081202 0.998 2
length{all}[16] 0.089777 0.007363 0.000179 0.280338 0.066897 1.002 2
length{all}[17] 0.104555 0.010275 0.000208 0.289489 0.075240 1.001 2
length{all}[18] 0.094414 0.008503 0.000112 0.284785 0.065520 0.998 2
length{all}[19] 0.112513 0.014162 0.000070 0.358802 0.073257 0.998 2
length{all}[20] 0.101600 0.010464 0.000211 0.299577 0.072611 0.998 2
length{all}[21] 0.098823 0.009884 0.000169 0.286656 0.070170 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009139
Maximum standard deviation of split frequencies = 0.019786
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 222
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 39 patterns at 74 / 74 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 39 patterns at 74 / 74 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
38064 bytes for conP
3432 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067055 0.011709 0.033476 0.094592 0.062971 0.094193 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -319.748198
Iterating by ming2
Initial: fx= 319.748198
x= 0.06705 0.01171 0.03348 0.09459 0.06297 0.09419 0.30000 1.30000
1 h-m-p 0.0000 0.0002 178.8055 ++ 314.661265 m 0.0002 13 | 1/8
2 h-m-p 0.0010 0.0726 26.1696 -----------.. | 1/8
3 h-m-p 0.0000 0.0003 163.2795 +++ 306.734694 m 0.0003 45 | 2/8
4 h-m-p 0.0019 0.0870 23.0345 ------------.. | 2/8
5 h-m-p 0.0000 0.0004 146.3685 +++ 298.051639 m 0.0004 78 | 3/8
6 h-m-p 0.0025 0.1080 20.6628 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 127.3045 ++ 297.143714 m 0.0001 110 | 4/8
8 h-m-p 0.0003 0.1436 16.8118 ----------.. | 4/8
9 h-m-p 0.0000 0.0004 103.8489 +++ 293.099813 m 0.0004 141 | 5/8
10 h-m-p 0.0023 0.2144 11.8036 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 73.7895 ++ 293.069885 m 0.0000 173 | 6/8
12 h-m-p 0.0219 8.0000 0.0000 C 293.069885 0 0.0219 184 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 Y 293.069885 0 1.6000 197
Out..
lnL = -293.069885
198 lfun, 198 eigenQcodon, 1188 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.023400 0.106802 0.045804 0.087634 0.027960 0.066176 0.300171 0.843465 0.568352
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.177725
np = 9
lnL0 = -318.962843
Iterating by ming2
Initial: fx= 318.962843
x= 0.02340 0.10680 0.04580 0.08763 0.02796 0.06618 0.30017 0.84346 0.56835
1 h-m-p 0.0000 0.0003 175.8307 +++ 308.923991 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0003 89.1560 ++ 307.304786 m 0.0003 27 | 2/9
3 h-m-p 0.0001 0.0005 88.9208 ++ 303.555029 m 0.0005 39 | 3/9
4 h-m-p 0.0000 0.0001 1400.9931 ++ 298.922445 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0000 3988.4613 ++ 295.106388 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 134860.0355 ++ 293.069863 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 ++ 293.069863 m 8.0000 87 | 6/9
8 h-m-p 0.0160 8.0000 0.0522 ---------C 293.069863 0 0.0000 111 | 6/9
9 h-m-p 0.0160 8.0000 0.0001 +++++ 293.069863 m 8.0000 129 | 6/9
10 h-m-p 0.0024 1.0971 0.2429 +++++ 293.069862 m 1.0971 147 | 7/9
11 h-m-p 0.1639 0.8193 0.5274 ++ 293.069822 m 0.8193 162 | 8/9
12 h-m-p 0.6601 3.3004 0.0999 ++ 293.069809 m 3.3004 176 | 9/9
13 h-m-p 0.0160 8.0000 0.0000 C 293.069809 0 0.0160 189
Out..
lnL = -293.069809
190 lfun, 570 eigenQcodon, 2280 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.035786 0.057135 0.094069 0.046227 0.063401 0.078570 0.000100 1.709939 0.397591 0.361016 1.371439
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.250803
np = 11
lnL0 = -319.601591
Iterating by ming2
Initial: fx= 319.601591
x= 0.03579 0.05714 0.09407 0.04623 0.06340 0.07857 0.00011 1.70994 0.39759 0.36102 1.37144
1 h-m-p 0.0000 0.0000 167.6119 ++ 319.033627 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0018 103.5628 +++ 304.409614 m 0.0018 31 | 2/11
3 h-m-p 0.0000 0.0002 138.2753 ++ 301.205117 m 0.0002 45 | 3/11
4 h-m-p 0.0006 0.0032 42.3839 ++ 296.452710 m 0.0032 59 | 4/11
5 h-m-p 0.0000 0.0000 4563.0148 ++ 295.094081 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 256.6506 ++ 295.038481 m 0.0000 87 | 6/11
7 h-m-p 0.0001 0.0037 6.0821 ----------.. | 6/11
8 h-m-p 0.0000 0.0001 100.6687 ++ 293.752242 m 0.0001 123 | 7/11
9 h-m-p 0.0160 8.0000 1.6790 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 72.0113 ++ 293.069858 m 0.0001 162 | 8/11
11 h-m-p 0.3955 8.0000 0.0000 +++ 293.069858 m 8.0000 177 | 8/11
12 h-m-p 0.0160 8.0000 0.0018 ----Y 293.069858 0 0.0000 198 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 293.069858 m 8.0000 218 | 8/11
14 h-m-p 0.0001 0.0581 7.9112 +++++ 293.069857 m 0.0581 238 | 9/11
15 h-m-p 0.1181 8.0000 1.5038 ++++ 293.069811 m 8.0000 254 | 9/11
16 h-m-p 1.6000 8.0000 0.2777 ++ 293.069810 m 8.0000 268 | 9/11
17 h-m-p 0.9352 8.0000 2.3758 ++ 293.069809 m 8.0000 284 | 9/11
18 h-m-p 1.6000 8.0000 0.3045 ++ 293.069809 m 8.0000 298 | 9/11
19 h-m-p 1.6000 8.0000 0.2658 ++ 293.069809 m 8.0000 314 | 9/11
20 h-m-p 0.2609 8.0000 8.1488 ++Y 293.069809 0 4.1748 332 | 9/11
21 h-m-p 1.6000 8.0000 0.0000 N 293.069809 0 1.6000 346 | 9/11
22 h-m-p 0.0160 8.0000 0.0000 Y 293.069809 0 0.0160 362
Out..
lnL = -293.069809
363 lfun, 1452 eigenQcodon, 6534 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -293.079579 S = -293.070005 -0.003663
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:03
did 20 / 39 patterns 0:03
did 30 / 39 patterns 0:03
did 39 / 39 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.081571 0.060172 0.023586 0.081883 0.092546 0.066908 0.000100 0.228033 1.228802
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.247939
np = 9
lnL0 = -320.838205
Iterating by ming2
Initial: fx= 320.838205
x= 0.08157 0.06017 0.02359 0.08188 0.09255 0.06691 0.00011 0.22803 1.22880
1 h-m-p 0.0000 0.0000 159.8967 ++ 320.736055 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0297 10.7029 ---------.. | 1/9
3 h-m-p 0.0000 0.0003 159.9474 +++ 311.700499 m 0.0003 46 | 2/9
4 h-m-p 0.0048 0.0256 10.5723 ------------.. | 2/9
5 h-m-p 0.0000 0.0005 149.7856 +++ 299.105233 m 0.0005 81 | 3/9
6 h-m-p 0.0038 0.0189 11.9014 ------------.. | 3/9
7 h-m-p 0.0000 0.0001 140.1048 ++ 297.157631 m 0.0001 115 | 4/9
8 h-m-p 0.0010 0.0188 11.8438 -----------.. | 4/9
9 h-m-p 0.0000 0.0002 121.9845 +++ 293.917031 m 0.0002 149 | 5/9
10 h-m-p 0.0020 0.0212 10.5643 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 101.0586 ++ 293.870421 m 0.0000 183 | 6/9
12 h-m-p 0.0001 0.0274 8.2214 ---------.. | 6/9
13 h-m-p 0.0000 0.0002 71.2512 ++ 293.069837 m 0.0002 214 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 293.069837 m 8.0000 226 | 7/9
15 h-m-p 0.0298 8.0000 0.0002 ---C 293.069837 0 0.0001 243 | 7/9
16 h-m-p 0.0160 8.0000 0.0001 ---Y 293.069837 0 0.0001 260
Out..
lnL = -293.069837
261 lfun, 2871 eigenQcodon, 15660 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.024930 0.076220 0.068050 0.053557 0.068618 0.107482 0.000100 0.900000 0.726670 1.539132 1.299868
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.878353
np = 11
lnL0 = -320.587685
Iterating by ming2
Initial: fx= 320.587685
x= 0.02493 0.07622 0.06805 0.05356 0.06862 0.10748 0.00011 0.90000 0.72667 1.53913 1.29987
1 h-m-p 0.0000 0.0000 160.8167 ++ 320.384896 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0036 58.1953 ++++ 310.591668 m 0.0036 32 | 2/11
3 h-m-p 0.0002 0.0010 130.6611 ++ 300.354339 m 0.0010 46 | 3/11
4 h-m-p 0.0029 0.0144 20.5330 ++ 298.147412 m 0.0144 60 | 4/11
5 h-m-p 0.0000 0.0000 9881.6454 ++ 298.083954 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0002 160.7565 ++ 297.344686 m 0.0002 88 | 6/11
7 h-m-p 0.0024 0.0227 13.6506 ++ 293.069867 m 0.0227 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 293.069867 m 8.0000 116 | 7/11
9 h-m-p 0.0117 5.8650 0.1634 ----------N 293.069867 0 0.0000 144 | 7/11
10 h-m-p 0.0001 0.0354 4.7815 +++++ 293.069845 m 0.0354 165 | 8/11
11 h-m-p 0.4448 2.9590 0.3503 --------------Y 293.069845 0 0.0000 193 | 8/11
12 h-m-p 0.0160 8.0000 0.0006 +++++ 293.069845 m 8.0000 213 | 8/11
13 h-m-p 0.0098 3.4273 0.4587 ----------N 293.069845 0 0.0000 240 | 8/11
14 h-m-p 0.0160 8.0000 0.0007 +++++ 293.069844 m 8.0000 260 | 8/11
15 h-m-p 0.0152 3.6585 0.3824 -------------.. | 8/11
16 h-m-p 0.0160 8.0000 0.0002 +++++ 293.069844 m 8.0000 308 | 8/11
17 h-m-p 0.0087 4.3266 0.2035 ----------Y 293.069844 0 0.0000 335 | 8/11
18 h-m-p 0.0160 8.0000 0.0002 +++++ 293.069844 m 8.0000 355 | 8/11
19 h-m-p 0.0092 4.6165 0.2146 -------------.. | 8/11
20 h-m-p 0.0160 8.0000 0.0002 +++++ 293.069843 m 8.0000 403 | 8/11
21 h-m-p 0.0088 4.3760 0.2018 -----------Y 293.069843 0 0.0000 431 | 8/11
22 h-m-p 0.0160 8.0000 0.0002 +++++ 293.069843 m 8.0000 451 | 8/11
23 h-m-p 0.0063 3.1422 0.6757 ------------.. | 8/11
24 h-m-p 0.0160 8.0000 0.0002 +++++ 293.069843 m 8.0000 498 | 8/11
25 h-m-p 0.0088 4.4102 0.2008 -------------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0002 +++++ 293.069843 m 8.0000 546 | 8/11
27 h-m-p 0.0089 4.4350 0.2000 ------------N 293.069843 0 0.0000 575 | 8/11
28 h-m-p 0.0160 8.0000 0.0002 +++++ 293.069842 m 8.0000 595 | 8/11
29 h-m-p 0.0088 4.3761 0.3602 -------------.. | 8/11
30 h-m-p 0.0160 8.0000 0.0002 +++++ 293.069842 m 8.0000 643 | 8/11
31 h-m-p 0.0090 4.4801 0.1985 -------------.. | 8/11
32 h-m-p 0.0160 8.0000 0.0002 +++++ 293.069842 m 8.0000 691 | 8/11
33 h-m-p 0.0090 4.5041 0.1978 ------------Y 293.069842 0 0.0000 720 | 8/11
34 h-m-p 0.0160 8.0000 0.0003 +++++ 293.069841 m 8.0000 740 | 8/11
35 h-m-p 0.0076 3.7994 0.3557 -----------Y 293.069841 0 0.0000 768 | 8/11
36 h-m-p 0.0160 8.0000 0.0001 +++++ 293.069841 m 8.0000 788 | 8/11
37 h-m-p 0.0076 3.8009 0.4637 ------------Y 293.069841 0 0.0000 817 | 8/11
38 h-m-p 0.0001 0.0337 6.4086 +++++ 293.069809 m 0.0337 837 | 9/11
39 h-m-p 1.6000 8.0000 0.0014 ++ 293.069809 m 8.0000 851 | 9/11
40 h-m-p 1.6000 8.0000 0.0003 ++ 293.069809 m 8.0000 867 | 9/11
41 h-m-p 0.5963 8.0000 0.0046 ++ 293.069809 m 8.0000 883 | 9/11
42 h-m-p 0.1748 3.5463 0.2095 +++ 293.069809 m 3.5463 900 | 10/11
43 h-m-p 0.6600 8.0000 0.8243
QuantileBeta(0.15, 0.00500, 3.15704) = 7.704510e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
+ 293.069809 m 8.0000 916
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57514) = 3.010956e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57538) = 2.909294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57490) = 2.909487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57514) = 2.909390e-161 2000 rounds
| 10/11
44 h-m-p 1.6000 8.0000 0.5341
QuantileBeta(0.15, 0.00500, 8.42974) = 2.596379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.99352) = 1.962736e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
+ 293.069809 m 8.0000 931
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.878423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84842) = 1.815010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84781) = 1.815109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
| 10/11
45 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
Y 293.069809 0 1.6000 946
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
Out..
lnL = -293.069809
947 lfun, 11364 eigenQcodon, 62502 P(t)
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -293.082499 S = -293.070005 -0.005484
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:22
did 20 / 39 patterns 0:22
did 30 / 39 patterns 0:22
did 39 / 39 patterns 0:23
QuantileBeta(0.15, 0.00500, 11.84812) = 1.815059e-161 2000 rounds
Time used: 0:23
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=74
NC_011896_1_WP_010907658_1_307_MLBR_RS01500 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
NC_002677_1_NP_301334_1_206_ML0298 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
NZ_CP029543_1_WP_010907658_1_306_thiS MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
NZ_AP014567_1_WP_010907658_1_318_thiS MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI
**************************************************
NC_011896_1_WP_010907658_1_307_MLBR_RS01500 SELPAVTGRSEPIRLEVVTAVQGG
NC_002677_1_NP_301334_1_206_ML0298 SELPAVTGRSEPIRLEVVTAVQGG
NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125 SELPAVTGRSEPIRLEVVTAVQGG
NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830 SELPAVTGRSEPIRLEVVTAVQGG
NZ_CP029543_1_WP_010907658_1_306_thiS SELPAVTGRSEPIRLEVVTAVQGG
NZ_AP014567_1_WP_010907658_1_318_thiS SELPAVTGRSEPIRLEVVTAVQGG
************************
>NC_011896_1_WP_010907658_1_307_MLBR_RS01500 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT GGTTACGGCAGTGCAAGGTGGT >NC_002677_1_NP_301334_1_206_ML0298 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT GGTTACGGCAGTGCAAGGTGGT >NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT GGTTACGGCAGTGCAAGGTGGT >NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830 ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT GGTTACGGCAGTGCAAGGTGGT >NZ_CP029543_1_WP_010907658_1_306_thiS ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT GGTTACGGCAGTGCAAGGTGGT >NZ_AP014567_1_WP_010907658_1_318_thiS ATGATTGTCGTAGTCAACGAACGACCGGTCGAGGTTAACGAGCAGACCAC CGTTGCTGCGCTGTTGGAGTCTCTGGGCTTCCCGGCTAGTGGTATTGCTG TCGCGGTAGAATTCTCAGTGTTGCCTCGATCTTACTGGGCAACAAAAATT TCTGAGCTCCCCGCTGTTACTGGGAGGTCTGAGCCAATCAGACTCGAAGT GGTTACGGCAGTGCAAGGTGGT
>NC_011896_1_WP_010907658_1_307_MLBR_RS01500 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI SELPAVTGRSEPIRLEVVTAVQGG >NC_002677_1_NP_301334_1_206_ML0298 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI SELPAVTGRSEPIRLEVVTAVQGG >NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI SELPAVTGRSEPIRLEVVTAVQGG >NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830 MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI SELPAVTGRSEPIRLEVVTAVQGG >NZ_CP029543_1_WP_010907658_1_306_thiS MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI SELPAVTGRSEPIRLEVVTAVQGG >NZ_AP014567_1_WP_010907658_1_318_thiS MIVVVNERPVEVNEQTTVAALLESLGFPASGIAVAVEFSVLPRSYWATKI SELPAVTGRSEPIRLEVVTAVQGG
#NEXUS
[ID: 0982559540]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907658_1_307_MLBR_RS01500
NC_002677_1_NP_301334_1_206_ML0298
NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125
NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830
NZ_CP029543_1_WP_010907658_1_306_thiS
NZ_AP014567_1_WP_010907658_1_318_thiS
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907658_1_307_MLBR_RS01500,
2 NC_002677_1_NP_301334_1_206_ML0298,
3 NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125,
4 NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830,
5 NZ_CP029543_1_WP_010907658_1_306_thiS,
6 NZ_AP014567_1_WP_010907658_1_318_thiS
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07258914,2:0.06989575,3:0.06846102,4:0.06993516,5:0.06680869,6:0.06719114);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07258914,2:0.06989575,3:0.06846102,4:0.06993516,5:0.06680869,6:0.06719114);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -307.16 -310.27
2 -307.16 -312.45
--------------------------------------
TOTAL -307.16 -311.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0298/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903120 0.096292 0.380725 1.548777 0.864778 1393.30 1447.15 1.000
r(A<->C){all} 0.159460 0.018889 0.000097 0.432540 0.122683 151.52 271.19 1.001
r(A<->G){all} 0.173682 0.020744 0.000260 0.467426 0.136729 157.72 203.58 1.000
r(A<->T){all} 0.161654 0.019530 0.000011 0.450906 0.123403 268.51 273.33 1.000
r(C<->G){all} 0.162676 0.018708 0.000192 0.434680 0.129530 214.55 248.02 1.001
r(C<->T){all} 0.162589 0.021193 0.000068 0.475185 0.119939 194.41 234.49 1.002
r(G<->T){all} 0.179939 0.023771 0.000079 0.485820 0.137356 90.20 212.26 1.009
pi(A){all} 0.203435 0.000721 0.150266 0.254224 0.203168 910.25 1150.95 1.000
pi(C){all} 0.235081 0.000818 0.180177 0.292458 0.234603 1202.82 1204.81 1.000
pi(G){all} 0.301610 0.000898 0.242635 0.357061 0.301042 1097.53 1154.98 1.000
pi(T){all} 0.259874 0.000860 0.201200 0.313430 0.259568 1199.88 1227.07 1.000
alpha{1,2} 0.412489 0.224919 0.000165 1.359574 0.241668 1015.77 1124.18 1.000
alpha{3} 0.466392 0.243742 0.000346 1.439055 0.305297 1280.70 1346.69 1.000
pinvar{all} 0.992503 0.000090 0.975829 0.999994 0.995489 1277.37 1312.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0298/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 74
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 4 4 4 4 4 4 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 2 2 2 2 2 2 | CCG 2 2 2 2 2 2 | CAG 1 1 1 1 1 1 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 1 1 1 1 1 1 | ACC 2 2 2 2 2 2 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 0 0 0 0 0 0 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 4 4 4 4 4 4 | Asp GAT 0 0 0 0 0 0 | Gly GGT 3 3 3 3 3 3
GTC 4 4 4 4 4 4 | GCC 0 0 0 0 0 0 | GAC 0 0 0 0 0 0 | GGC 1 1 1 1 1 1
GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 3 3 3 3 3 3 | GGA 0 0 0 0 0 0
GTG 3 3 3 3 3 3 | GCG 2 2 2 2 2 2 | GAG 5 5 5 5 5 5 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907658_1_307_MLBR_RS01500
position 1: T:0.14865 C:0.17568 A:0.21622 G:0.45946
position 2: T:0.35135 C:0.31081 A:0.18919 G:0.14865
position 3: T:0.28378 C:0.21622 A:0.20270 G:0.29730
Average T:0.26126 C:0.23423 A:0.20270 G:0.30180
#2: NC_002677_1_NP_301334_1_206_ML0298
position 1: T:0.14865 C:0.17568 A:0.21622 G:0.45946
position 2: T:0.35135 C:0.31081 A:0.18919 G:0.14865
position 3: T:0.28378 C:0.21622 A:0.20270 G:0.29730
Average T:0.26126 C:0.23423 A:0.20270 G:0.30180
#3: NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125
position 1: T:0.14865 C:0.17568 A:0.21622 G:0.45946
position 2: T:0.35135 C:0.31081 A:0.18919 G:0.14865
position 3: T:0.28378 C:0.21622 A:0.20270 G:0.29730
Average T:0.26126 C:0.23423 A:0.20270 G:0.30180
#4: NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830
position 1: T:0.14865 C:0.17568 A:0.21622 G:0.45946
position 2: T:0.35135 C:0.31081 A:0.18919 G:0.14865
position 3: T:0.28378 C:0.21622 A:0.20270 G:0.29730
Average T:0.26126 C:0.23423 A:0.20270 G:0.30180
#5: NZ_CP029543_1_WP_010907658_1_306_thiS
position 1: T:0.14865 C:0.17568 A:0.21622 G:0.45946
position 2: T:0.35135 C:0.31081 A:0.18919 G:0.14865
position 3: T:0.28378 C:0.21622 A:0.20270 G:0.29730
Average T:0.26126 C:0.23423 A:0.20270 G:0.30180
#6: NZ_AP014567_1_WP_010907658_1_318_thiS
position 1: T:0.14865 C:0.17568 A:0.21622 G:0.45946
position 2: T:0.35135 C:0.31081 A:0.18919 G:0.14865
position 3: T:0.28378 C:0.21622 A:0.20270 G:0.29730
Average T:0.26126 C:0.23423 A:0.20270 G:0.30180
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 24 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 0 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 0
CTC 12 | CCC 6 | CAC 0 | CGC 0
CTA 0 | CCA 6 | Gln Q CAA 6 | CGA 12
CTG 12 | CCG 12 | CAG 6 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 6
ATC 6 | ACC 12 | AAC 12 | AGC 0
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 6 | ACG 6 | AAG 0 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 24 | Asp D GAT 0 | Gly G GGT 18
GTC 24 | GCC 0 | GAC 0 | GGC 6
GTA 12 | GCA 12 | Glu E GAA 18 | GGA 0
GTG 18 | GCG 12 | GAG 30 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14865 C:0.17568 A:0.21622 G:0.45946
position 2: T:0.35135 C:0.31081 A:0.18919 G:0.14865
position 3: T:0.28378 C:0.21622 A:0.20270 G:0.29730
Average T:0.26126 C:0.23423 A:0.20270 G:0.30180
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -293.069885 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300171 1.299868
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907658_1_307_MLBR_RS01500: 0.000004, NC_002677_1_NP_301334_1_206_ML0298: 0.000004, NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125: 0.000004, NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830: 0.000004, NZ_CP029543_1_WP_010907658_1_306_thiS: 0.000004, NZ_AP014567_1_WP_010907658_1_318_thiS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30017
omega (dN/dS) = 1.29987
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 150.8 71.2 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 150.8 71.2 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 150.8 71.2 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 150.8 71.2 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 150.8 71.2 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 150.8 71.2 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -293.069809 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907658_1_307_MLBR_RS01500: 0.000004, NC_002677_1_NP_301334_1_206_ML0298: 0.000004, NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125: 0.000004, NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830: 0.000004, NZ_CP029543_1_WP_010907658_1_306_thiS: 0.000004, NZ_AP014567_1_WP_010907658_1_318_thiS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -293.069809 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907658_1_307_MLBR_RS01500: 0.000004, NC_002677_1_NP_301334_1_206_ML0298: 0.000004, NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125: 0.000004, NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830: 0.000004, NZ_CP029543_1_WP_010907658_1_306_thiS: 0.000004, NZ_AP014567_1_WP_010907658_1_318_thiS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907658_1_307_MLBR_RS01500)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -293.069837 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.227124 1.228715
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907658_1_307_MLBR_RS01500: 0.000004, NC_002677_1_NP_301334_1_206_ML0298: 0.000004, NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125: 0.000004, NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830: 0.000004, NZ_CP029543_1_WP_010907658_1_306_thiS: 0.000004, NZ_AP014567_1_WP_010907658_1_318_thiS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.22712 q = 1.22871
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00018 0.00168 0.00741 0.02248 0.05472 0.11553 0.22165 0.40001 0.70829
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 151.9 70.1 0.1532 0.0000 0.0000 0.0 0.0
7..2 0.000 151.9 70.1 0.1532 0.0000 0.0000 0.0 0.0
7..3 0.000 151.9 70.1 0.1532 0.0000 0.0000 0.0 0.0
7..4 0.000 151.9 70.1 0.1532 0.0000 0.0000 0.0 0.0
7..5 0.000 151.9 70.1 0.1532 0.0000 0.0000 0.0 0.0
7..6 0.000 151.9 70.1 0.1532 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -293.069809 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 11.848115 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907658_1_307_MLBR_RS01500: 0.000004, NC_002677_1_NP_301334_1_206_ML0298: 0.000004, NZ_LVXE01000058_1_WP_010907658_1_2251_A3216_RS12125: 0.000004, NZ_LYPH01000063_1_WP_010907658_1_2264_A8144_RS10830: 0.000004, NZ_CP029543_1_WP_010907658_1_306_thiS: 0.000004, NZ_AP014567_1_WP_010907658_1_318_thiS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 11.84812
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 151.9 70.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907658_1_307_MLBR_RS01500)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:23
Model 1: NearlyNeutral -293.069809 Model 2: PositiveSelection -293.069809 Model 0: one-ratio -293.069885 Model 7: beta -293.069837 Model 8: beta&w>1 -293.069809 Model 0 vs 1 1.519999999572974E-4 Model 2 vs 1 0.0 Model 8 vs 7 5.599999997230043E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
