--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 17:12:21 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0315/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1238.71 -1241.08 2 -1238.69 -1242.14 -------------------------------------- TOTAL -1238.70 -1241.74 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.894817 0.087918 0.362040 1.477361 0.866666 1501.00 1501.00 1.000 r(A<->C){all} 0.175453 0.021622 0.000023 0.472558 0.135992 209.80 271.58 1.001 r(A<->G){all} 0.167245 0.021206 0.000114 0.462683 0.124889 138.38 167.18 1.000 r(A<->T){all} 0.164169 0.019934 0.000084 0.456381 0.124230 206.09 235.89 1.000 r(C<->G){all} 0.168677 0.019672 0.000248 0.441496 0.133887 162.07 190.09 1.001 r(C<->T){all} 0.154638 0.017251 0.000009 0.423770 0.123429 165.08 218.94 1.003 r(G<->T){all} 0.169818 0.021015 0.000089 0.470421 0.132173 199.06 202.46 1.007 pi(A){all} 0.199853 0.000172 0.175039 0.226740 0.199793 1202.69 1265.72 1.000 pi(C){all} 0.328794 0.000235 0.296947 0.356225 0.328433 1011.24 1138.98 1.000 pi(G){all} 0.289173 0.000220 0.262174 0.319923 0.289134 1205.27 1277.88 1.000 pi(T){all} 0.182179 0.000162 0.158004 0.207276 0.181839 1056.03 1095.77 1.000 alpha{1,2} 0.423703 0.224410 0.000165 1.354298 0.254537 1300.23 1315.49 1.000 alpha{3} 0.460566 0.226767 0.000147 1.428153 0.300641 936.63 1218.82 1.000 pinvar{all} 0.998379 0.000004 0.994770 0.999999 0.998952 1339.08 1388.56 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1191.702327 Model 2: PositiveSelection -1191.702311 Model 0: one-ratio -1191.702325 Model 7: beta -1191.702393 Model 8: beta&w>1 -1191.702311 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 3.199999991920777E-5 Model 8 vs 7 1.6400000004068715E-4
>C1 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C2 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C3 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C4 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C5 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C6 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=304 C1 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C2 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C3 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C4 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C5 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C6 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK ************************************************** C1 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C2 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C3 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C4 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C5 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C6 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN ************************************************** C1 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C2 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C3 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C4 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C5 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C6 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS ************************************************** C1 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C2 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C3 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C4 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C5 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C6 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT ************************************************** C1 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C2 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C3 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C4 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C5 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C6 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD ************************************************** C1 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C2 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C3 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C4 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C5 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C6 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV ************************************************** C1 YPVG C2 YPVG C3 YPVG C4 YPVG C5 YPVG C6 YPVG **** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 304 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 304 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9120] Library Relaxation: Multi_proc [96] Relaxation Summary: [9120]--->[9120] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.508 Mb, Max= 30.867 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C2 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C3 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C4 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C5 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK C6 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK ************************************************** C1 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C2 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C3 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C4 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C5 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN C6 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN ************************************************** C1 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C2 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C3 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C4 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C5 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS C6 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS ************************************************** C1 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C2 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C3 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C4 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C5 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT C6 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT ************************************************** C1 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C2 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C3 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C4 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C5 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD C6 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD ************************************************** C1 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C2 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C3 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C4 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C5 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV C6 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV ************************************************** C1 YPVG C2 YPVG C3 YPVG C4 YPVG C5 YPVG C6 YPVG **** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC C2 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC C3 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC C4 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC C5 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC C6 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC ************************************************** C1 CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC C2 CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC C3 CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC C4 CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC C5 CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC C6 CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC ************************************************** C1 TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG C2 TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG C3 TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG C4 TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG C5 TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG C6 TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG ************************************************** C1 GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT C2 GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT C3 GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT C4 GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT C5 GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT C6 GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT ************************************************** C1 TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG C2 TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG C3 TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG C4 TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG C5 TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG C6 TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG ************************************************** C1 CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC C2 CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC C3 CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC C4 CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC C5 CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC C6 CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC ************************************************** C1 GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT C2 GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT C3 GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT C4 GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT C5 GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT C6 GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT ************************************************** C1 GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC C2 GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC C3 GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC C4 GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC C5 GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC C6 GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC ************************************************** C1 TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC C2 TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC C3 TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC C4 TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC C5 TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC C6 TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC ************************************************** C1 CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA C2 CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA C3 CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA C4 CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA C5 CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA C6 CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ************************************************** C1 ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC C2 ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC C3 ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC C4 ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC C5 ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC C6 ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC ************************************************** C1 TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG C2 TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG C3 TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG C4 TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG C5 TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG C6 TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ************************************************** C1 ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC C2 ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC C3 ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC C4 ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC C5 ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC C6 ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC ************************************************** C1 TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA C2 TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA C3 TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA C4 TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA C5 TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA C6 TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA ************************************************** C1 CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT C2 CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT C3 CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT C4 CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT C5 CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT C6 CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT ************************************************** C1 GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT C2 GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT C3 GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT C4 GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT C5 GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT C6 GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ************************************************** C1 ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG C2 ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG C3 ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG C4 ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG C5 ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG C6 ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ************************************************** C1 ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC C2 ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC C3 ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC C4 ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC C5 ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC C6 ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC ************************************************** C1 TATCCGGTCGGC C2 TATCCGGTCGGC C3 TATCCGGTCGGC C4 TATCCGGTCGGC C5 TATCCGGTCGGC C6 TATCCGGTCGGC ************ >C1 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >C2 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >C3 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >C4 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >C5 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >C6 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >C1 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C2 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C3 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C4 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C5 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >C6 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 912 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579799463 Setting output file names to "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1560395813 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0021594110 Seed = 794241600 Swapseed = 1579799463 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2041.099727 -- -24.965149 Chain 2 -- -2041.099727 -- -24.965149 Chain 3 -- -2041.099415 -- -24.965149 Chain 4 -- -2041.099727 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2041.099727 -- -24.965149 Chain 2 -- -2041.099727 -- -24.965149 Chain 3 -- -2041.099610 -- -24.965149 Chain 4 -- -2041.099610 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2041.100] (-2041.100) (-2041.099) (-2041.100) * [-2041.100] (-2041.100) (-2041.100) (-2041.100) 500 -- [-1250.918] (-1253.780) (-1247.491) (-1246.362) * (-1246.696) (-1273.088) (-1265.019) [-1245.960] -- 0:00:00 1000 -- (-1251.299) (-1250.544) (-1250.794) [-1242.557] * [-1248.639] (-1263.929) (-1258.666) (-1254.023) -- 0:00:00 1500 -- (-1253.353) (-1258.911) [-1246.297] (-1247.151) * (-1248.217) (-1249.061) (-1248.399) [-1243.145] -- 0:00:00 2000 -- [-1244.933] (-1246.659) (-1245.905) (-1251.869) * (-1254.823) (-1243.810) [-1250.925] (-1250.117) -- 0:00:00 2500 -- (-1246.789) (-1249.120) (-1255.274) [-1248.781] * (-1245.779) (-1243.888) (-1248.175) [-1247.959] -- 0:00:00 3000 -- (-1244.513) (-1247.253) [-1253.588] (-1253.276) * (-1256.793) (-1243.356) [-1247.627] (-1246.204) -- 0:00:00 3500 -- (-1242.164) [-1247.768] (-1247.624) (-1248.495) * (-1247.253) (-1250.362) (-1247.068) [-1245.732] -- 0:04:44 4000 -- (-1247.244) (-1254.165) [-1249.383] (-1247.971) * (-1254.325) [-1246.558] (-1245.572) (-1242.998) -- 0:04:09 4500 -- [-1252.087] (-1244.692) (-1243.624) (-1247.718) * [-1244.812] (-1264.125) (-1246.645) (-1249.990) -- 0:03:41 5000 -- (-1245.780) (-1255.195) [-1245.144] (-1245.410) * (-1250.199) [-1247.691] (-1247.254) (-1248.387) -- 0:03:19 Average standard deviation of split frequencies: 0.095647 5500 -- [-1245.354] (-1253.197) (-1247.477) (-1251.506) * [-1248.599] (-1250.246) (-1256.685) (-1262.665) -- 0:03:00 6000 -- (-1249.524) [-1245.845] (-1252.304) (-1249.497) * (-1242.944) [-1244.156] (-1267.699) (-1247.049) -- 0:02:45 6500 -- (-1245.866) (-1243.621) (-1247.017) [-1244.974] * [-1247.017] (-1246.544) (-1241.825) (-1259.478) -- 0:02:32 7000 -- [-1247.418] (-1246.098) (-1249.069) (-1252.643) * (-1252.839) [-1248.869] (-1242.456) (-1250.396) -- 0:02:21 7500 -- (-1249.758) [-1244.226] (-1252.882) (-1244.779) * (-1253.207) (-1246.421) [-1239.127] (-1248.056) -- 0:02:12 8000 -- (-1246.444) (-1246.195) (-1250.613) [-1247.101] * (-1250.680) (-1247.572) [-1238.882] (-1247.984) -- 0:02:04 8500 -- (-1240.255) (-1253.374) (-1254.410) [-1250.140] * (-1247.694) [-1248.200] (-1243.272) (-1251.177) -- 0:01:56 9000 -- [-1238.711] (-1248.337) (-1245.732) (-1246.598) * (-1260.040) [-1241.421] (-1240.987) (-1247.019) -- 0:01:50 9500 -- [-1237.376] (-1245.238) (-1249.854) (-1248.707) * (-1249.222) (-1249.428) [-1240.293] (-1252.373) -- 0:01:44 10000 -- [-1237.803] (-1252.529) (-1252.610) (-1247.190) * [-1243.642] (-1252.842) (-1238.994) (-1247.938) -- 0:01:39 Average standard deviation of split frequencies: 0.063836 10500 -- (-1238.389) [-1239.259] (-1248.792) (-1249.034) * (-1248.328) (-1244.983) (-1243.150) [-1249.559] -- 0:01:34 11000 -- (-1239.343) (-1240.465) [-1243.618] (-1244.463) * (-1245.456) [-1248.772] (-1241.559) (-1244.381) -- 0:01:29 11500 -- (-1243.123) (-1241.995) (-1244.645) [-1250.921] * (-1248.102) (-1247.741) (-1239.559) [-1249.352] -- 0:01:25 12000 -- (-1238.047) [-1240.020] (-1247.448) (-1255.106) * (-1246.918) (-1246.452) [-1238.237] (-1251.596) -- 0:01:22 12500 -- (-1239.448) (-1239.143) (-1249.509) [-1250.061] * [-1243.639] (-1245.836) (-1238.389) (-1250.034) -- 0:01:19 13000 -- (-1239.110) [-1238.860] (-1249.153) (-1250.546) * (-1248.756) (-1249.172) (-1237.707) [-1255.258] -- 0:01:15 13500 -- (-1239.598) (-1239.287) (-1239.025) [-1244.334] * [-1249.426] (-1249.479) (-1239.094) (-1247.063) -- 0:01:13 14000 -- [-1238.531] (-1240.441) (-1239.843) (-1253.799) * (-1247.360) (-1245.936) (-1237.951) [-1247.610] -- 0:01:10 14500 -- (-1240.710) (-1239.821) [-1239.073] (-1247.110) * (-1254.354) (-1248.545) (-1238.456) [-1243.759] -- 0:01:07 15000 -- [-1239.880] (-1239.420) (-1240.007) (-1255.721) * [-1249.201] (-1250.513) (-1240.621) (-1240.094) -- 0:01:05 Average standard deviation of split frequencies: 0.032929 15500 -- (-1241.576) [-1238.165] (-1239.863) (-1252.323) * (-1256.792) (-1247.935) [-1238.106] (-1245.005) -- 0:01:03 16000 -- (-1241.872) (-1237.301) (-1240.298) [-1243.503] * (-1244.829) [-1246.495] (-1239.330) (-1246.412) -- 0:01:01 16500 -- [-1238.470] (-1239.845) (-1239.418) (-1246.971) * (-1254.295) [-1247.876] (-1240.925) (-1240.679) -- 0:00:59 17000 -- [-1240.520] (-1241.543) (-1240.589) (-1244.490) * (-1250.092) (-1250.666) [-1240.273] (-1240.234) -- 0:00:57 17500 -- (-1237.884) (-1242.770) [-1238.273] (-1246.572) * [-1243.128] (-1245.450) (-1238.869) (-1240.156) -- 0:00:56 18000 -- (-1241.374) (-1241.530) (-1243.520) [-1242.181] * (-1252.028) (-1244.624) [-1237.233] (-1248.334) -- 0:01:49 18500 -- (-1241.688) (-1239.792) (-1242.038) [-1245.389] * (-1253.202) (-1248.467) (-1237.488) [-1238.640] -- 0:01:46 19000 -- (-1240.470) (-1238.584) (-1238.267) [-1247.939] * (-1252.987) [-1244.186] (-1241.821) (-1237.920) -- 0:01:43 19500 -- [-1240.475] (-1239.882) (-1240.038) (-1247.701) * (-1249.448) [-1249.834] (-1238.304) (-1240.130) -- 0:01:40 20000 -- [-1239.660] (-1237.484) (-1242.013) (-1256.456) * (-1252.168) (-1248.817) [-1240.906] (-1238.054) -- 0:01:38 Average standard deviation of split frequencies: 0.040551 20500 -- [-1242.334] (-1238.071) (-1245.743) (-1249.992) * (-1249.696) (-1247.869) [-1238.847] (-1237.802) -- 0:01:35 21000 -- (-1237.629) [-1238.223] (-1239.491) (-1248.548) * [-1250.668] (-1246.916) (-1241.427) (-1239.772) -- 0:01:33 21500 -- (-1239.618) (-1239.101) (-1238.376) [-1250.593] * (-1249.064) [-1245.276] (-1241.496) (-1239.564) -- 0:01:31 22000 -- [-1239.747] (-1238.202) (-1241.024) (-1244.298) * (-1254.750) (-1247.976) [-1241.139] (-1240.326) -- 0:01:28 22500 -- (-1238.970) (-1238.963) (-1246.717) [-1251.306] * (-1248.705) (-1254.394) [-1240.421] (-1241.433) -- 0:01:26 23000 -- [-1238.561] (-1242.119) (-1237.666) (-1244.175) * (-1251.427) (-1248.495) [-1241.588] (-1239.443) -- 0:01:24 23500 -- (-1242.670) (-1242.246) [-1241.412] (-1253.319) * (-1257.397) [-1245.447] (-1238.683) (-1237.916) -- 0:01:23 24000 -- (-1243.799) (-1241.877) (-1242.357) [-1253.355] * (-1250.207) (-1244.437) [-1239.615] (-1237.434) -- 0:01:21 24500 -- (-1239.677) [-1240.595] (-1239.265) (-1249.297) * (-1249.109) (-1246.240) (-1238.372) [-1240.442] -- 0:01:19 25000 -- (-1241.834) [-1239.833] (-1241.534) (-1254.223) * (-1244.297) [-1244.620] (-1239.640) (-1238.801) -- 0:01:18 Average standard deviation of split frequencies: 0.026765 25500 -- (-1241.224) (-1238.623) (-1242.809) [-1248.111] * [-1241.867] (-1247.672) (-1238.945) (-1239.514) -- 0:01:16 26000 -- (-1243.295) (-1240.417) [-1238.556] (-1244.238) * [-1249.729] (-1250.197) (-1240.136) (-1239.566) -- 0:01:14 26500 -- (-1238.259) (-1242.091) [-1239.131] (-1250.125) * (-1252.228) (-1254.053) [-1238.304] (-1241.729) -- 0:01:13 27000 -- (-1238.987) (-1240.391) (-1241.443) [-1246.138] * (-1258.015) (-1249.937) [-1238.607] (-1239.703) -- 0:01:12 27500 -- (-1238.773) (-1237.751) [-1238.649] (-1247.272) * (-1254.524) (-1247.853) [-1238.840] (-1241.557) -- 0:01:10 28000 -- [-1238.688] (-1238.652) (-1239.008) (-1254.616) * (-1249.686) (-1250.762) (-1239.640) [-1240.455] -- 0:01:09 28500 -- [-1238.708] (-1239.763) (-1238.107) (-1251.917) * (-1247.374) (-1256.474) (-1238.434) [-1240.542] -- 0:01:08 29000 -- (-1238.934) (-1242.897) [-1237.377] (-1257.262) * (-1248.198) (-1245.113) (-1239.545) [-1239.753] -- 0:01:06 29500 -- (-1239.437) (-1241.300) (-1238.156) [-1244.663] * (-1255.411) (-1257.480) (-1238.487) [-1239.459] -- 0:01:05 30000 -- (-1239.283) [-1237.644] (-1237.363) (-1257.979) * (-1248.236) (-1243.535) (-1240.490) [-1242.811] -- 0:01:04 Average standard deviation of split frequencies: 0.027127 30500 -- (-1238.579) (-1241.803) (-1237.859) [-1250.485] * [-1247.906] (-1250.469) (-1239.825) (-1237.193) -- 0:01:03 31000 -- (-1238.783) [-1238.524] (-1237.876) (-1248.615) * (-1248.361) (-1252.292) [-1239.559] (-1238.030) -- 0:01:02 31500 -- (-1240.841) (-1238.548) (-1239.011) [-1246.361] * (-1245.748) (-1246.911) [-1241.279] (-1237.582) -- 0:01:01 32000 -- (-1241.449) (-1238.940) [-1241.189] (-1249.364) * (-1245.670) (-1252.423) [-1240.416] (-1238.462) -- 0:01:00 32500 -- [-1239.548] (-1237.366) (-1242.631) (-1245.687) * (-1253.896) (-1246.969) (-1242.934) [-1238.938] -- 0:00:59 33000 -- (-1240.504) (-1239.393) (-1244.043) [-1252.841] * (-1250.148) (-1249.659) [-1238.772] (-1243.194) -- 0:00:58 33500 -- (-1240.633) (-1237.609) (-1239.154) [-1247.315] * (-1246.972) (-1244.885) (-1238.766) [-1238.788] -- 0:00:57 34000 -- (-1239.371) (-1237.439) (-1240.305) [-1247.850] * (-1250.399) (-1255.998) [-1238.477] (-1240.299) -- 0:01:25 34500 -- (-1241.353) (-1238.617) (-1239.433) [-1246.569] * [-1243.195] (-1248.639) (-1237.896) (-1240.414) -- 0:01:23 35000 -- (-1239.485) [-1237.132] (-1239.251) (-1247.580) * [-1241.397] (-1243.353) (-1237.959) (-1244.490) -- 0:01:22 Average standard deviation of split frequencies: 0.034191 35500 -- (-1239.160) (-1237.132) (-1240.056) [-1249.747] * (-1249.659) (-1242.112) [-1239.690] (-1242.528) -- 0:01:21 36000 -- (-1239.740) (-1237.976) [-1240.840] (-1248.577) * (-1249.404) (-1249.198) [-1240.089] (-1241.575) -- 0:01:20 36500 -- (-1238.816) (-1238.592) [-1241.937] (-1246.413) * (-1254.617) (-1250.153) (-1241.340) [-1240.417] -- 0:01:19 37000 -- (-1238.932) (-1238.990) [-1237.479] (-1253.524) * (-1244.931) [-1249.477] (-1242.876) (-1239.834) -- 0:01:18 37500 -- [-1238.684] (-1238.922) (-1238.816) (-1247.200) * (-1249.447) (-1253.233) (-1242.420) [-1243.272] -- 0:01:17 38000 -- (-1240.719) (-1238.668) (-1240.323) [-1241.788] * (-1257.428) [-1250.981] (-1240.897) (-1240.128) -- 0:01:15 38500 -- (-1244.464) (-1238.383) (-1240.738) [-1239.130] * [-1257.200] (-1254.520) (-1239.384) (-1241.289) -- 0:01:14 39000 -- (-1238.413) (-1238.601) (-1242.714) [-1240.480] * (-1249.937) [-1246.930] (-1241.737) (-1244.115) -- 0:01:13 39500 -- (-1241.090) (-1241.105) [-1239.310] (-1238.299) * (-1248.705) [-1248.018] (-1241.423) (-1242.041) -- 0:01:12 40000 -- (-1239.364) [-1238.680] (-1238.835) (-1239.652) * (-1240.444) [-1249.384] (-1241.415) (-1241.523) -- 0:01:12 Average standard deviation of split frequencies: 0.030429 40500 -- (-1238.369) (-1239.088) [-1238.567] (-1242.389) * (-1240.657) [-1245.228] (-1241.239) (-1240.889) -- 0:01:11 41000 -- (-1239.312) (-1241.575) (-1241.104) [-1239.439] * (-1240.123) [-1246.079] (-1239.925) (-1242.564) -- 0:01:10 41500 -- (-1238.092) [-1240.271] (-1242.145) (-1238.956) * (-1238.605) [-1249.564] (-1238.861) (-1240.464) -- 0:01:09 42000 -- (-1237.911) (-1240.550) (-1244.229) [-1238.779] * (-1238.821) (-1250.593) (-1242.178) [-1241.802] -- 0:01:08 42500 -- [-1238.540] (-1239.531) (-1238.080) (-1239.096) * [-1237.684] (-1250.725) (-1240.336) (-1238.998) -- 0:01:07 43000 -- (-1241.820) [-1239.108] (-1240.464) (-1241.041) * (-1237.530) (-1247.003) (-1239.784) [-1239.813] -- 0:01:06 43500 -- (-1242.613) [-1239.016] (-1239.336) (-1243.555) * (-1240.231) (-1244.560) (-1242.354) [-1238.621] -- 0:01:05 44000 -- (-1241.086) [-1239.536] (-1238.883) (-1246.247) * (-1238.038) (-1248.142) [-1238.007] (-1238.093) -- 0:01:05 44500 -- [-1239.418] (-1238.992) (-1240.254) (-1240.572) * (-1240.391) (-1250.937) [-1238.061] (-1240.059) -- 0:01:04 45000 -- (-1239.208) (-1238.744) (-1239.110) [-1241.777] * (-1241.133) (-1249.317) (-1238.398) [-1238.548] -- 0:01:03 Average standard deviation of split frequencies: 0.028304 45500 -- (-1237.907) (-1241.212) (-1238.666) [-1241.082] * [-1240.953] (-1250.394) (-1238.950) (-1237.532) -- 0:01:02 46000 -- (-1239.849) (-1238.553) (-1237.833) [-1242.231] * (-1238.252) [-1245.955] (-1238.424) (-1237.532) -- 0:01:02 46500 -- (-1238.645) [-1240.348] (-1237.977) (-1240.767) * (-1241.329) (-1246.516) [-1243.505] (-1238.163) -- 0:01:01 47000 -- [-1240.491] (-1240.954) (-1239.851) (-1240.466) * [-1239.542] (-1245.236) (-1239.536) (-1238.578) -- 0:01:00 47500 -- (-1239.350) (-1244.953) [-1240.213] (-1237.467) * (-1238.074) [-1246.262] (-1240.145) (-1239.941) -- 0:01:00 48000 -- [-1240.133] (-1239.519) (-1238.833) (-1238.112) * (-1238.091) (-1246.383) [-1237.839] (-1238.218) -- 0:00:59 48500 -- (-1240.600) (-1241.699) [-1239.162] (-1239.258) * (-1237.977) [-1244.783] (-1239.599) (-1240.370) -- 0:00:58 49000 -- (-1239.743) (-1241.976) [-1239.246] (-1237.616) * [-1240.160] (-1250.601) (-1238.274) (-1239.548) -- 0:00:58 49500 -- (-1240.818) (-1241.666) (-1239.047) [-1237.600] * (-1237.964) [-1245.936] (-1238.750) (-1237.139) -- 0:00:57 50000 -- [-1239.481] (-1242.079) (-1238.978) (-1237.464) * (-1239.125) (-1260.181) (-1239.476) [-1237.153] -- 0:01:16 Average standard deviation of split frequencies: 0.029871 50500 -- [-1239.304] (-1238.676) (-1238.887) (-1240.015) * [-1238.004] (-1254.883) (-1246.960) (-1238.129) -- 0:01:15 51000 -- (-1240.587) (-1238.638) (-1238.964) [-1240.736] * (-1238.579) (-1246.348) (-1246.971) [-1237.726] -- 0:01:14 51500 -- (-1239.797) (-1239.701) (-1240.149) [-1238.599] * (-1239.100) (-1246.602) (-1243.288) [-1237.723] -- 0:01:13 52000 -- (-1238.630) (-1239.329) (-1241.735) [-1241.717] * [-1238.930] (-1247.086) (-1242.775) (-1237.693) -- 0:01:12 52500 -- (-1238.342) (-1239.733) [-1237.908] (-1243.008) * (-1244.929) (-1252.129) (-1243.824) [-1238.870] -- 0:01:12 53000 -- [-1240.494] (-1239.731) (-1237.635) (-1243.050) * (-1246.064) (-1253.139) (-1239.236) [-1240.870] -- 0:01:11 53500 -- (-1237.882) (-1239.252) [-1237.687] (-1238.587) * (-1243.331) (-1244.210) [-1239.451] (-1243.984) -- 0:01:10 54000 -- [-1239.238] (-1240.520) (-1238.519) (-1240.272) * (-1238.960) (-1250.161) [-1238.277] (-1244.335) -- 0:01:10 54500 -- (-1237.875) (-1240.309) (-1238.518) [-1241.822] * (-1239.477) [-1248.941] (-1240.312) (-1242.937) -- 0:01:09 55000 -- (-1241.094) (-1238.706) [-1239.142] (-1237.338) * [-1240.132] (-1253.382) (-1237.892) (-1242.192) -- 0:01:08 Average standard deviation of split frequencies: 0.028798 55500 -- (-1239.961) (-1243.357) (-1240.031) [-1237.200] * (-1237.468) [-1246.569] (-1238.129) (-1238.902) -- 0:01:08 56000 -- (-1238.245) (-1239.576) (-1238.344) [-1237.421] * (-1237.475) [-1248.517] (-1239.147) (-1243.544) -- 0:01:07 56500 -- (-1237.370) [-1238.125] (-1239.458) (-1237.548) * (-1238.501) (-1245.107) [-1240.386] (-1243.676) -- 0:01:06 57000 -- (-1237.891) (-1238.194) (-1238.782) [-1237.548] * [-1238.700] (-1255.362) (-1240.252) (-1240.059) -- 0:01:06 57500 -- (-1239.114) (-1238.315) (-1242.874) [-1238.844] * [-1238.824] (-1248.995) (-1241.275) (-1238.904) -- 0:01:05 58000 -- (-1239.710) (-1242.144) (-1241.980) [-1240.032] * (-1237.360) (-1240.717) (-1239.885) [-1239.169] -- 0:01:04 58500 -- (-1237.352) [-1238.371] (-1242.982) (-1237.852) * (-1238.373) (-1244.590) [-1241.124] (-1239.787) -- 0:01:04 59000 -- (-1237.342) [-1240.605] (-1240.413) (-1237.879) * (-1238.676) [-1247.113] (-1242.912) (-1240.437) -- 0:01:03 59500 -- [-1237.419] (-1238.832) (-1239.418) (-1238.149) * [-1239.112] (-1255.509) (-1240.688) (-1240.419) -- 0:01:03 60000 -- (-1237.418) [-1237.708] (-1243.508) (-1239.809) * [-1238.773] (-1242.804) (-1239.790) (-1241.372) -- 0:01:02 Average standard deviation of split frequencies: 0.025765 60500 -- (-1240.104) (-1237.608) (-1238.205) [-1241.756] * (-1239.277) [-1252.370] (-1238.795) (-1238.431) -- 0:01:02 61000 -- (-1238.598) (-1241.095) (-1240.421) [-1238.839] * (-1238.114) (-1251.581) (-1238.960) [-1240.646] -- 0:01:01 61500 -- (-1238.459) [-1238.030] (-1238.199) (-1239.879) * (-1241.307) (-1249.130) (-1242.200) [-1239.946] -- 0:01:01 62000 -- (-1240.973) [-1238.148] (-1239.439) (-1240.767) * (-1242.459) (-1249.061) [-1239.960] (-1241.851) -- 0:01:00 62500 -- (-1241.342) [-1238.847] (-1240.108) (-1239.310) * (-1240.230) [-1244.496] (-1239.661) (-1239.696) -- 0:01:00 63000 -- (-1239.169) (-1238.680) (-1238.699) [-1242.214] * (-1238.505) [-1244.963] (-1237.755) (-1240.481) -- 0:00:59 63500 -- (-1238.007) (-1237.713) [-1238.140] (-1240.879) * (-1238.981) (-1247.190) [-1237.054] (-1240.567) -- 0:00:58 64000 -- (-1239.623) (-1239.085) (-1238.130) [-1240.961] * (-1240.032) (-1247.038) [-1237.327] (-1243.089) -- 0:00:58 64500 -- (-1239.181) (-1239.392) [-1238.141] (-1238.774) * [-1238.067] (-1249.172) (-1237.164) (-1240.888) -- 0:00:58 65000 -- [-1238.344] (-1239.193) (-1239.987) (-1238.248) * (-1239.239) (-1246.168) [-1240.265] (-1240.694) -- 0:00:57 Average standard deviation of split frequencies: 0.029930 65500 -- [-1237.719] (-1239.533) (-1238.525) (-1239.932) * (-1240.351) [-1248.321] (-1239.339) (-1239.335) -- 0:00:57 66000 -- (-1241.364) [-1239.051] (-1238.492) (-1239.967) * (-1238.596) [-1243.845] (-1239.573) (-1238.347) -- 0:01:10 66500 -- (-1239.409) [-1240.688] (-1241.193) (-1239.974) * (-1238.616) (-1242.392) [-1239.292] (-1239.525) -- 0:01:10 67000 -- (-1240.218) [-1243.435] (-1241.779) (-1240.754) * (-1240.428) [-1244.896] (-1237.526) (-1239.280) -- 0:01:09 67500 -- (-1238.168) (-1239.076) (-1240.902) [-1242.176] * (-1241.027) (-1244.320) [-1237.784] (-1241.861) -- 0:01:09 68000 -- (-1238.168) [-1239.301] (-1238.984) (-1242.291) * (-1239.580) (-1252.380) (-1237.575) [-1239.985] -- 0:01:08 68500 -- [-1238.615] (-1239.907) (-1241.612) (-1239.755) * [-1243.119] (-1249.352) (-1237.408) (-1239.775) -- 0:01:07 69000 -- (-1239.830) [-1242.642] (-1240.346) (-1238.648) * (-1243.525) (-1245.027) [-1237.540] (-1240.772) -- 0:01:07 69500 -- [-1238.709] (-1242.000) (-1242.550) (-1237.629) * (-1244.293) (-1250.388) [-1237.538] (-1239.491) -- 0:01:06 70000 -- (-1237.670) [-1239.561] (-1239.118) (-1237.816) * (-1243.221) (-1253.092) (-1237.521) [-1238.994] -- 0:01:06 Average standard deviation of split frequencies: 0.034355 70500 -- (-1237.485) (-1240.349) (-1239.098) [-1239.658] * [-1243.997] (-1248.069) (-1238.365) (-1239.065) -- 0:01:05 71000 -- (-1238.036) (-1238.470) [-1237.802] (-1238.608) * (-1245.182) (-1240.346) [-1238.422] (-1239.577) -- 0:01:05 71500 -- (-1238.122) (-1240.292) (-1241.180) [-1238.087] * (-1242.224) [-1249.375] (-1238.196) (-1242.867) -- 0:01:04 72000 -- [-1237.781] (-1238.599) (-1239.655) (-1238.690) * (-1241.213) (-1254.712) (-1243.518) [-1240.679] -- 0:01:04 72500 -- (-1237.491) (-1242.058) [-1237.602] (-1239.025) * [-1240.381] (-1248.704) (-1239.312) (-1238.585) -- 0:01:03 73000 -- (-1243.069) (-1239.465) (-1237.640) [-1239.347] * [-1242.501] (-1247.112) (-1238.579) (-1238.928) -- 0:01:03 73500 -- (-1243.925) (-1242.372) (-1237.849) [-1241.062] * (-1245.426) (-1246.810) [-1244.994] (-1241.814) -- 0:01:03 74000 -- (-1239.392) (-1242.909) [-1238.415] (-1238.298) * (-1238.545) (-1255.306) [-1243.763] (-1242.407) -- 0:01:02 74500 -- (-1242.103) [-1238.337] (-1237.858) (-1239.277) * (-1238.834) [-1248.826] (-1242.028) (-1242.600) -- 0:01:02 75000 -- [-1238.735] (-1238.107) (-1238.623) (-1240.407) * [-1238.811] (-1248.627) (-1239.315) (-1239.560) -- 0:01:01 Average standard deviation of split frequencies: 0.034604 75500 -- (-1244.120) (-1238.812) (-1239.294) [-1240.993] * (-1240.384) [-1247.103] (-1239.076) (-1237.444) -- 0:01:01 76000 -- (-1242.392) (-1241.969) (-1238.515) [-1239.862] * (-1238.943) (-1255.667) (-1241.036) [-1238.209] -- 0:01:00 76500 -- (-1250.160) (-1239.855) (-1238.409) [-1242.030] * (-1239.599) [-1247.585] (-1239.869) (-1239.403) -- 0:01:00 77000 -- (-1239.978) (-1239.010) [-1237.899] (-1239.185) * (-1238.158) (-1245.322) (-1240.609) [-1238.632] -- 0:00:59 77500 -- [-1239.303] (-1240.832) (-1239.028) (-1240.628) * (-1237.943) [-1249.285] (-1244.091) (-1238.708) -- 0:00:59 78000 -- (-1239.800) (-1241.305) [-1239.773] (-1240.215) * [-1237.702] (-1245.735) (-1247.178) (-1238.368) -- 0:00:59 78500 -- (-1237.901) (-1239.957) [-1237.722] (-1243.968) * [-1237.967] (-1253.415) (-1246.327) (-1241.871) -- 0:00:58 79000 -- (-1240.330) (-1240.774) [-1239.694] (-1240.916) * [-1244.896] (-1242.040) (-1248.602) (-1241.732) -- 0:00:58 79500 -- (-1239.208) [-1238.572] (-1238.855) (-1242.335) * (-1245.911) (-1248.548) [-1239.628] (-1238.594) -- 0:00:57 80000 -- [-1241.056] (-1239.608) (-1241.693) (-1239.591) * (-1242.789) (-1246.505) [-1239.035] (-1237.761) -- 0:00:57 Average standard deviation of split frequencies: 0.033833 80500 -- [-1238.048] (-1240.116) (-1241.131) (-1241.004) * (-1239.762) [-1241.153] (-1237.532) (-1237.529) -- 0:00:57 81000 -- (-1243.765) (-1238.603) [-1241.612] (-1241.389) * (-1238.158) (-1247.413) [-1237.668] (-1239.223) -- 0:00:56 81500 -- (-1240.482) (-1237.508) (-1239.241) [-1238.783] * (-1239.302) (-1250.619) [-1238.636] (-1239.791) -- 0:00:56 82000 -- (-1242.900) (-1238.065) [-1238.727] (-1239.258) * (-1241.993) [-1246.132] (-1238.269) (-1237.475) -- 0:01:07 82500 -- (-1241.913) (-1238.329) (-1239.034) [-1239.832] * (-1242.398) [-1256.210] (-1241.312) (-1238.933) -- 0:01:06 83000 -- [-1238.378] (-1244.517) (-1238.544) (-1244.460) * (-1239.966) (-1249.777) [-1238.526] (-1238.063) -- 0:01:06 83500 -- (-1241.444) (-1240.774) [-1239.039] (-1237.880) * (-1239.880) (-1254.060) [-1239.146] (-1241.204) -- 0:01:05 84000 -- (-1238.547) (-1240.928) (-1240.900) [-1239.597] * (-1240.601) (-1244.463) (-1239.208) [-1240.387] -- 0:01:05 84500 -- [-1238.806] (-1240.248) (-1238.276) (-1238.119) * (-1237.735) [-1247.380] (-1237.980) (-1238.492) -- 0:01:05 85000 -- (-1238.393) (-1241.298) [-1238.277] (-1239.045) * (-1240.943) (-1254.708) [-1237.979] (-1242.631) -- 0:01:04 Average standard deviation of split frequencies: 0.031145 85500 -- (-1238.719) (-1240.451) [-1238.454] (-1239.761) * (-1240.913) (-1251.976) (-1241.178) [-1238.946] -- 0:01:04 86000 -- (-1238.549) [-1243.557] (-1240.311) (-1239.461) * (-1242.142) (-1254.355) (-1238.516) [-1238.734] -- 0:01:03 86500 -- (-1240.829) (-1240.874) (-1242.263) [-1237.942] * (-1239.081) [-1248.620] (-1238.719) (-1239.329) -- 0:01:03 87000 -- (-1241.440) (-1239.282) [-1240.113] (-1239.193) * (-1238.673) (-1266.797) [-1240.021] (-1240.471) -- 0:01:02 87500 -- (-1238.651) (-1238.718) (-1238.322) [-1238.607] * (-1241.090) [-1250.976] (-1240.148) (-1241.806) -- 0:01:02 88000 -- (-1240.986) [-1239.073] (-1241.765) (-1238.759) * (-1238.818) (-1250.911) (-1239.829) [-1241.722] -- 0:01:02 88500 -- (-1240.318) (-1238.516) (-1245.004) [-1238.891] * [-1238.120] (-1253.141) (-1240.446) (-1241.092) -- 0:01:01 89000 -- (-1238.166) [-1239.183] (-1241.362) (-1238.239) * (-1240.889) [-1243.212] (-1238.814) (-1243.030) -- 0:01:01 89500 -- (-1238.104) (-1239.682) [-1241.866] (-1238.991) * (-1237.956) (-1259.977) [-1238.687] (-1242.209) -- 0:01:01 90000 -- (-1238.067) (-1238.305) [-1238.806] (-1238.867) * (-1238.735) [-1249.588] (-1238.057) (-1242.395) -- 0:01:00 Average standard deviation of split frequencies: 0.031939 90500 -- (-1238.427) (-1238.165) [-1238.644] (-1245.445) * (-1238.737) (-1244.172) [-1239.207] (-1242.043) -- 0:01:00 91000 -- (-1239.685) [-1240.055] (-1238.530) (-1238.815) * (-1240.869) [-1238.092] (-1237.680) (-1244.660) -- 0:00:59 91500 -- [-1240.422] (-1239.056) (-1237.724) (-1239.088) * [-1238.221] (-1241.762) (-1237.682) (-1244.322) -- 0:00:59 92000 -- (-1238.376) (-1239.491) [-1238.001] (-1238.801) * (-1238.206) (-1238.694) (-1242.090) [-1245.406] -- 0:00:59 92500 -- (-1237.641) (-1238.705) [-1237.924] (-1238.998) * (-1237.837) (-1238.873) [-1242.551] (-1239.645) -- 0:00:58 93000 -- [-1238.168] (-1241.536) (-1238.762) (-1239.449) * (-1238.179) (-1238.312) (-1240.222) [-1238.414] -- 0:00:58 93500 -- (-1238.722) (-1238.691) [-1239.001] (-1239.204) * (-1241.925) (-1242.093) [-1238.835] (-1238.299) -- 0:00:58 94000 -- [-1239.005] (-1238.731) (-1241.883) (-1240.507) * (-1238.643) (-1241.648) (-1246.459) [-1238.205] -- 0:00:57 94500 -- [-1238.165] (-1238.725) (-1240.391) (-1238.687) * (-1239.935) (-1240.690) [-1240.172] (-1238.111) -- 0:00:57 95000 -- (-1239.764) (-1238.680) [-1239.897] (-1243.092) * (-1243.102) (-1241.430) (-1240.283) [-1239.590] -- 0:00:57 Average standard deviation of split frequencies: 0.032655 95500 -- (-1238.681) (-1240.264) [-1238.895] (-1243.841) * (-1242.893) (-1239.487) [-1238.182] (-1241.555) -- 0:01:06 96000 -- [-1238.681] (-1238.233) (-1238.447) (-1243.153) * [-1238.066] (-1239.265) (-1238.837) (-1238.615) -- 0:01:05 96500 -- (-1237.332) [-1244.975] (-1238.149) (-1243.326) * (-1240.040) (-1238.033) [-1238.327] (-1238.982) -- 0:01:05 97000 -- (-1239.166) (-1241.490) (-1238.933) [-1237.710] * (-1240.808) (-1239.108) [-1239.148] (-1240.398) -- 0:01:05 97500 -- (-1238.391) (-1241.370) [-1239.730] (-1237.646) * (-1238.276) [-1238.847] (-1240.510) (-1240.134) -- 0:01:04 98000 -- (-1239.286) [-1238.961] (-1238.633) (-1237.739) * (-1242.938) (-1240.616) (-1241.175) [-1238.911] -- 0:01:04 98500 -- [-1239.853] (-1239.696) (-1237.724) (-1237.684) * (-1240.585) (-1242.644) [-1240.904] (-1238.795) -- 0:01:04 99000 -- (-1239.226) [-1238.861] (-1237.939) (-1239.554) * [-1239.559] (-1242.836) (-1237.770) (-1238.994) -- 0:01:03 99500 -- (-1238.530) [-1240.955] (-1240.080) (-1238.878) * (-1243.932) (-1239.304) [-1238.432] (-1238.881) -- 0:01:03 100000 -- (-1238.557) (-1237.862) (-1239.994) [-1238.057] * [-1239.867] (-1238.307) (-1239.051) (-1241.698) -- 0:01:02 Average standard deviation of split frequencies: 0.025879 100500 -- (-1238.484) (-1237.935) (-1238.625) [-1238.935] * (-1239.252) [-1238.949] (-1239.104) (-1238.389) -- 0:01:02 101000 -- (-1241.774) [-1238.196] (-1240.413) (-1239.391) * (-1241.388) (-1241.786) [-1237.616] (-1238.444) -- 0:01:02 101500 -- (-1239.730) (-1238.167) (-1238.124) [-1238.255] * [-1241.445] (-1240.609) (-1238.689) (-1237.995) -- 0:01:01 102000 -- (-1238.791) [-1237.659] (-1238.836) (-1238.941) * (-1242.298) [-1240.856] (-1239.886) (-1237.943) -- 0:01:01 102500 -- (-1238.005) [-1237.448] (-1238.439) (-1241.946) * (-1240.462) (-1241.217) [-1239.616] (-1240.571) -- 0:01:01 103000 -- [-1237.960] (-1237.507) (-1238.094) (-1240.344) * (-1238.559) [-1237.829] (-1239.106) (-1241.342) -- 0:01:00 103500 -- (-1238.410) [-1237.507] (-1238.070) (-1239.893) * (-1237.810) [-1238.524] (-1239.943) (-1238.410) -- 0:01:00 104000 -- (-1238.132) [-1239.978] (-1238.665) (-1243.063) * (-1237.935) (-1238.607) (-1242.492) [-1239.293] -- 0:01:00 104500 -- (-1238.335) [-1241.929] (-1240.198) (-1244.023) * [-1238.271] (-1239.934) (-1242.066) (-1238.569) -- 0:00:59 105000 -- [-1238.006] (-1239.056) (-1240.349) (-1244.965) * [-1239.048] (-1242.578) (-1241.362) (-1238.466) -- 0:00:59 Average standard deviation of split frequencies: 0.026461 105500 -- [-1237.961] (-1239.437) (-1239.307) (-1238.713) * (-1240.165) (-1243.272) (-1244.966) [-1241.785] -- 0:00:59 106000 -- (-1239.409) (-1239.485) [-1238.139] (-1239.345) * [-1241.447] (-1238.920) (-1242.985) (-1244.556) -- 0:00:59 106500 -- (-1239.265) (-1237.682) [-1237.826] (-1239.298) * (-1239.176) [-1240.167] (-1238.324) (-1246.918) -- 0:00:58 107000 -- [-1240.188] (-1239.783) (-1240.958) (-1240.694) * (-1239.876) (-1239.372) (-1239.514) [-1239.498] -- 0:00:58 107500 -- (-1241.169) (-1239.823) (-1241.241) [-1239.735] * (-1241.481) [-1238.850] (-1239.198) (-1238.663) -- 0:00:58 108000 -- (-1240.748) (-1238.326) (-1241.214) [-1239.648] * (-1242.532) (-1239.268) [-1239.106] (-1239.918) -- 0:00:57 108500 -- (-1242.927) (-1238.755) [-1237.783] (-1240.984) * (-1239.342) (-1240.798) (-1239.402) [-1239.905] -- 0:00:57 109000 -- (-1237.400) [-1238.282] (-1239.863) (-1238.178) * (-1239.961) (-1240.283) [-1239.983] (-1243.089) -- 0:01:05 109500 -- [-1238.142] (-1238.652) (-1238.350) (-1239.124) * (-1240.904) [-1238.881] (-1239.429) (-1239.503) -- 0:01:05 110000 -- [-1237.247] (-1238.699) (-1238.601) (-1241.108) * [-1240.331] (-1240.078) (-1238.951) (-1239.626) -- 0:01:04 Average standard deviation of split frequencies: 0.024493 110500 -- (-1241.034) [-1239.770] (-1239.396) (-1244.817) * (-1241.056) (-1240.298) [-1240.152] (-1240.130) -- 0:01:04 111000 -- (-1243.338) (-1238.947) (-1240.101) [-1238.844] * (-1243.889) (-1238.321) (-1238.761) [-1239.422] -- 0:01:04 111500 -- (-1242.573) (-1238.598) [-1237.915] (-1239.229) * [-1238.384] (-1239.542) (-1241.058) (-1239.913) -- 0:01:03 112000 -- (-1244.163) [-1239.590] (-1237.871) (-1238.937) * (-1238.218) (-1238.325) (-1238.121) [-1238.804] -- 0:01:03 112500 -- (-1247.394) (-1241.254) [-1238.124] (-1239.507) * (-1238.623) (-1237.967) (-1241.370) [-1239.998] -- 0:01:03 113000 -- (-1242.077) (-1238.801) (-1239.113) [-1239.717] * (-1240.330) (-1240.104) (-1240.433) [-1239.716] -- 0:01:02 113500 -- (-1239.351) [-1238.711] (-1242.855) (-1237.578) * (-1240.735) (-1241.138) (-1239.295) [-1240.553] -- 0:01:02 114000 -- (-1238.279) (-1241.098) (-1244.250) [-1238.097] * (-1238.653) (-1241.614) (-1240.870) [-1237.553] -- 0:01:02 114500 -- (-1237.589) [-1239.404] (-1240.943) (-1239.215) * (-1237.731) (-1237.280) (-1242.287) [-1239.633] -- 0:01:01 115000 -- (-1240.832) (-1239.389) [-1242.429] (-1239.385) * (-1239.350) (-1237.447) (-1242.450) [-1240.990] -- 0:01:01 Average standard deviation of split frequencies: 0.026618 115500 -- (-1239.849) (-1238.069) (-1243.070) [-1238.628] * (-1240.890) [-1237.223] (-1246.024) (-1243.770) -- 0:01:01 116000 -- (-1244.941) (-1239.022) [-1238.507] (-1240.028) * (-1239.625) (-1238.243) (-1245.469) [-1240.830] -- 0:01:00 116500 -- (-1239.057) (-1239.152) [-1238.508] (-1239.212) * (-1239.597) (-1237.604) (-1243.099) [-1237.788] -- 0:01:00 117000 -- (-1239.916) (-1239.982) [-1238.122] (-1240.813) * (-1238.272) (-1237.470) [-1240.426] (-1237.847) -- 0:01:00 117500 -- (-1239.177) [-1237.166] (-1238.012) (-1242.164) * (-1238.981) (-1237.733) [-1240.434] (-1238.302) -- 0:01:00 118000 -- (-1238.877) (-1237.166) (-1238.295) [-1239.938] * (-1238.840) [-1237.653] (-1241.567) (-1241.633) -- 0:00:59 118500 -- [-1238.922] (-1239.459) (-1241.913) (-1239.941) * (-1238.143) (-1238.935) (-1240.623) [-1238.704] -- 0:00:59 119000 -- (-1240.565) (-1242.163) [-1242.193] (-1239.083) * (-1238.604) (-1239.632) [-1238.784] (-1239.459) -- 0:00:59 119500 -- (-1238.278) (-1240.055) (-1241.438) [-1238.966] * [-1239.161] (-1240.090) (-1240.025) (-1239.284) -- 0:00:58 120000 -- (-1239.976) (-1238.683) [-1239.848] (-1238.260) * (-1239.071) (-1239.630) [-1243.948] (-1242.546) -- 0:00:58 Average standard deviation of split frequencies: 0.023635 120500 -- (-1238.945) (-1239.565) (-1239.551) [-1239.094] * (-1239.440) (-1241.066) (-1240.307) [-1241.846] -- 0:00:58 121000 -- [-1237.473] (-1238.140) (-1238.645) (-1238.932) * (-1240.283) [-1238.927] (-1237.827) (-1241.166) -- 0:00:58 121500 -- (-1238.121) (-1239.126) (-1238.000) [-1238.350] * [-1241.577] (-1239.797) (-1239.332) (-1240.675) -- 0:00:57 122000 -- (-1238.382) [-1239.965] (-1238.564) (-1240.867) * (-1240.125) (-1238.207) [-1239.487] (-1242.186) -- 0:00:57 122500 -- [-1238.757] (-1240.413) (-1239.957) (-1239.063) * [-1239.700] (-1240.363) (-1239.798) (-1238.991) -- 0:00:57 123000 -- (-1237.835) (-1246.898) [-1237.860] (-1237.615) * (-1239.959) (-1241.119) [-1238.567] (-1238.340) -- 0:00:57 123500 -- (-1241.467) (-1245.481) (-1237.732) [-1238.362] * (-1238.092) [-1240.645] (-1241.763) (-1238.192) -- 0:01:03 124000 -- [-1240.789] (-1241.599) (-1237.975) (-1237.910) * (-1240.695) (-1241.362) (-1240.241) [-1239.012] -- 0:01:03 124500 -- (-1238.521) (-1240.938) (-1238.650) [-1239.541] * (-1240.555) [-1240.002] (-1239.788) (-1239.344) -- 0:01:03 125000 -- [-1238.687] (-1238.345) (-1240.832) (-1239.961) * [-1239.807] (-1239.600) (-1242.231) (-1239.642) -- 0:01:03 Average standard deviation of split frequencies: 0.023517 125500 -- (-1241.269) [-1241.485] (-1247.926) (-1238.548) * (-1239.065) [-1240.119] (-1243.800) (-1239.125) -- 0:01:02 126000 -- [-1240.729] (-1243.753) (-1244.012) (-1238.140) * (-1240.970) (-1238.986) [-1240.957] (-1241.044) -- 0:01:02 126500 -- (-1240.285) [-1240.555] (-1241.572) (-1237.563) * (-1238.607) (-1239.093) (-1239.067) [-1239.110] -- 0:01:02 127000 -- (-1240.387) [-1238.969] (-1240.236) (-1238.628) * (-1238.238) (-1240.018) [-1242.255] (-1238.896) -- 0:01:01 127500 -- (-1238.335) (-1243.094) [-1243.303] (-1240.066) * (-1244.125) (-1241.195) [-1239.377] (-1247.696) -- 0:01:01 128000 -- (-1239.321) (-1238.608) (-1243.258) [-1238.783] * (-1243.595) (-1244.179) (-1237.803) [-1239.420] -- 0:01:01 128500 -- [-1240.907] (-1237.501) (-1238.125) (-1237.653) * [-1240.230] (-1239.609) (-1240.088) (-1239.011) -- 0:01:01 129000 -- (-1240.288) (-1241.739) (-1239.532) [-1239.003] * (-1238.522) (-1240.985) [-1239.141] (-1238.540) -- 0:01:00 129500 -- (-1238.583) [-1239.756] (-1238.748) (-1238.652) * [-1238.934] (-1240.250) (-1238.190) (-1239.786) -- 0:01:00 130000 -- (-1238.407) (-1239.032) (-1238.200) [-1239.043] * (-1241.102) [-1238.545] (-1238.107) (-1239.166) -- 0:01:00 Average standard deviation of split frequencies: 0.024223 130500 -- [-1237.437] (-1240.309) (-1242.703) (-1237.857) * (-1242.436) [-1238.627] (-1238.363) (-1240.236) -- 0:00:59 131000 -- (-1238.261) [-1238.841] (-1238.883) (-1240.752) * (-1239.493) [-1241.154] (-1242.026) (-1238.887) -- 0:00:59 131500 -- (-1239.516) (-1238.892) (-1238.632) [-1240.236] * [-1238.907] (-1238.251) (-1239.367) (-1239.551) -- 0:00:59 132000 -- [-1239.618] (-1238.048) (-1239.373) (-1238.655) * (-1237.936) (-1242.463) [-1241.928] (-1238.082) -- 0:00:59 132500 -- (-1237.483) [-1241.244] (-1237.834) (-1238.326) * (-1239.615) (-1239.654) (-1239.632) [-1237.872] -- 0:00:58 133000 -- (-1237.423) (-1238.936) [-1237.564] (-1238.835) * (-1237.836) (-1239.700) (-1241.503) [-1239.915] -- 0:00:58 133500 -- [-1242.593] (-1237.996) (-1237.516) (-1239.427) * [-1237.260] (-1240.629) (-1240.447) (-1237.309) -- 0:00:58 134000 -- (-1241.733) (-1239.959) (-1237.753) [-1238.224] * (-1237.396) (-1239.534) (-1238.191) [-1238.825] -- 0:00:58 134500 -- [-1237.298] (-1239.686) (-1239.019) (-1238.950) * (-1240.532) (-1239.690) [-1238.189] (-1237.713) -- 0:00:57 135000 -- (-1239.972) [-1242.433] (-1239.983) (-1237.463) * (-1241.389) [-1239.373] (-1239.581) (-1237.652) -- 0:00:57 Average standard deviation of split frequencies: 0.025176 135500 -- (-1242.223) [-1239.141] (-1241.727) (-1240.886) * [-1242.287] (-1239.371) (-1238.228) (-1239.721) -- 0:00:57 136000 -- (-1239.930) [-1239.490] (-1239.024) (-1241.112) * (-1238.988) (-1240.182) [-1239.360] (-1240.114) -- 0:00:57 136500 -- [-1242.236] (-1237.875) (-1237.900) (-1238.070) * [-1239.417] (-1238.135) (-1239.305) (-1239.986) -- 0:00:56 137000 -- (-1240.389) [-1238.287] (-1238.602) (-1237.595) * (-1240.300) (-1239.336) (-1239.690) [-1242.522] -- 0:00:56 137500 -- (-1242.193) [-1237.875] (-1239.833) (-1239.868) * (-1238.496) [-1238.042] (-1243.541) (-1242.614) -- 0:00:56 138000 -- (-1241.126) (-1238.453) [-1239.504] (-1239.688) * [-1239.567] (-1238.667) (-1243.454) (-1241.533) -- 0:00:56 138500 -- (-1243.810) (-1241.007) (-1242.327) [-1241.068] * [-1237.245] (-1238.257) (-1238.986) (-1239.730) -- 0:00:55 139000 -- [-1241.594] (-1241.344) (-1241.499) (-1243.353) * (-1238.934) (-1244.414) (-1239.849) [-1240.120] -- 0:01:01 139500 -- (-1240.331) (-1239.624) (-1244.159) [-1240.375] * (-1242.585) (-1240.840) (-1238.347) [-1239.752] -- 0:01:01 140000 -- (-1239.667) (-1241.594) (-1241.375) [-1239.537] * [-1238.525] (-1237.965) (-1240.073) (-1239.317) -- 0:01:01 Average standard deviation of split frequencies: 0.025399 140500 -- (-1244.646) (-1240.980) (-1244.225) [-1239.882] * (-1238.558) [-1237.772] (-1242.398) (-1240.660) -- 0:01:01 141000 -- (-1243.153) (-1240.929) (-1238.599) [-1238.763] * (-1237.987) (-1238.015) (-1239.736) [-1240.642] -- 0:01:00 141500 -- [-1244.280] (-1239.656) (-1237.943) (-1238.283) * (-1241.609) (-1238.972) [-1240.894] (-1240.516) -- 0:01:00 142000 -- (-1240.631) [-1240.179] (-1238.749) (-1238.281) * [-1243.070] (-1241.231) (-1239.337) (-1244.223) -- 0:01:00 142500 -- (-1240.049) [-1240.849] (-1238.974) (-1238.248) * (-1241.400) (-1247.533) (-1239.347) [-1238.169] -- 0:01:00 143000 -- [-1238.414] (-1239.832) (-1240.767) (-1238.293) * (-1241.759) (-1241.135) [-1239.146] (-1239.183) -- 0:00:59 143500 -- (-1238.331) (-1239.760) (-1238.663) [-1239.224] * (-1244.233) (-1238.812) [-1238.914] (-1237.926) -- 0:00:59 144000 -- (-1239.319) [-1239.142] (-1239.465) (-1239.326) * (-1239.918) (-1242.188) (-1239.324) [-1239.405] -- 0:00:59 144500 -- (-1237.398) [-1238.803] (-1237.881) (-1239.869) * (-1239.922) (-1238.604) [-1238.726] (-1237.210) -- 0:00:59 145000 -- (-1240.383) (-1238.170) [-1243.648] (-1241.101) * (-1238.713) (-1238.947) [-1239.233] (-1237.210) -- 0:00:58 Average standard deviation of split frequencies: 0.024811 145500 -- [-1240.499] (-1239.491) (-1243.326) (-1242.154) * (-1237.590) [-1239.236] (-1239.773) (-1237.831) -- 0:00:58 146000 -- (-1238.307) (-1237.848) [-1238.483] (-1238.436) * [-1237.362] (-1239.275) (-1240.105) (-1237.410) -- 0:00:58 146500 -- (-1238.069) [-1238.169] (-1239.019) (-1240.804) * (-1238.084) [-1237.472] (-1239.248) (-1237.457) -- 0:00:58 147000 -- (-1240.163) (-1240.777) (-1242.118) [-1240.797] * (-1238.803) (-1238.106) [-1239.646] (-1237.457) -- 0:00:58 147500 -- (-1243.377) (-1237.933) (-1240.562) [-1238.636] * (-1238.882) (-1237.969) (-1240.084) [-1237.959] -- 0:00:57 148000 -- (-1241.423) (-1239.339) (-1241.420) [-1237.635] * (-1237.389) [-1238.654] (-1240.964) (-1238.033) -- 0:00:57 148500 -- (-1240.979) [-1239.955] (-1238.331) (-1239.522) * (-1238.174) (-1238.783) [-1239.935] (-1239.055) -- 0:00:57 149000 -- [-1239.431] (-1238.359) (-1238.191) (-1240.918) * (-1237.591) (-1238.073) (-1241.715) [-1240.673] -- 0:00:57 149500 -- [-1239.812] (-1238.789) (-1239.080) (-1241.434) * (-1239.085) [-1237.694] (-1239.463) (-1239.255) -- 0:00:56 150000 -- [-1240.720] (-1239.020) (-1237.748) (-1240.749) * (-1238.861) (-1237.592) (-1245.331) [-1239.245] -- 0:00:56 Average standard deviation of split frequencies: 0.026512 150500 -- (-1238.292) (-1237.877) [-1236.995] (-1238.813) * (-1237.982) [-1238.882] (-1239.288) (-1239.246) -- 0:00:56 151000 -- (-1238.298) [-1243.513] (-1236.990) (-1238.774) * (-1239.369) (-1237.134) (-1238.823) [-1238.318] -- 0:00:56 151500 -- [-1240.505] (-1242.829) (-1242.606) (-1238.910) * (-1238.881) (-1240.921) [-1242.296] (-1238.245) -- 0:00:56 152000 -- (-1239.595) (-1238.177) (-1238.514) [-1241.683] * [-1238.645] (-1238.296) (-1240.841) (-1239.900) -- 0:00:55 152500 -- [-1241.091] (-1238.134) (-1247.608) (-1238.630) * (-1237.908) (-1237.809) [-1238.358] (-1237.969) -- 0:00:55 153000 -- (-1239.767) (-1242.111) [-1238.587] (-1238.984) * [-1237.936] (-1241.722) (-1240.241) (-1241.323) -- 0:00:55 153500 -- (-1242.569) (-1239.715) [-1239.862] (-1238.328) * (-1238.675) (-1238.216) (-1240.749) [-1239.322] -- 0:00:55 154000 -- (-1240.831) (-1244.825) (-1239.349) [-1239.067] * (-1240.559) (-1241.140) (-1240.668) [-1239.252] -- 0:00:54 154500 -- [-1241.235] (-1240.210) (-1239.309) (-1239.584) * (-1239.450) [-1240.185] (-1239.439) (-1239.665) -- 0:00:54 155000 -- (-1239.876) [-1239.409] (-1238.716) (-1240.482) * (-1240.523) [-1241.456] (-1237.544) (-1240.697) -- 0:00:54 Average standard deviation of split frequencies: 0.025288 155500 -- (-1241.369) (-1240.699) (-1238.766) [-1240.970] * (-1238.797) [-1237.885] (-1239.121) (-1239.745) -- 0:00:59 156000 -- [-1240.947] (-1241.577) (-1238.016) (-1239.692) * [-1238.649] (-1237.870) (-1237.774) (-1241.257) -- 0:00:59 156500 -- [-1239.799] (-1241.588) (-1237.809) (-1240.574) * (-1238.957) (-1241.183) (-1238.283) [-1239.388] -- 0:00:59 157000 -- [-1239.641] (-1244.374) (-1237.705) (-1240.105) * (-1243.944) [-1242.891] (-1237.856) (-1238.118) -- 0:00:59 157500 -- [-1239.801] (-1239.829) (-1237.652) (-1239.441) * [-1242.685] (-1239.904) (-1237.864) (-1239.217) -- 0:00:58 158000 -- (-1239.626) (-1238.626) [-1237.638] (-1242.220) * (-1239.557) [-1239.699] (-1238.881) (-1239.221) -- 0:00:58 158500 -- (-1240.198) (-1241.746) (-1238.108) [-1240.003] * [-1239.870] (-1242.822) (-1237.328) (-1237.970) -- 0:00:58 159000 -- [-1239.020] (-1241.674) (-1237.766) (-1238.626) * (-1239.584) (-1239.800) [-1238.653] (-1244.612) -- 0:00:58 159500 -- (-1239.120) (-1242.795) [-1238.579] (-1239.302) * (-1237.806) (-1239.344) [-1237.479] (-1244.670) -- 0:00:57 160000 -- (-1238.435) [-1241.756] (-1238.490) (-1239.170) * (-1240.610) [-1241.368] (-1240.091) (-1240.333) -- 0:00:57 Average standard deviation of split frequencies: 0.024776 160500 -- [-1238.393] (-1243.622) (-1237.897) (-1246.434) * [-1239.040] (-1239.581) (-1238.617) (-1242.149) -- 0:00:57 161000 -- [-1238.679] (-1243.692) (-1239.266) (-1242.035) * (-1238.116) (-1240.883) [-1239.480] (-1238.723) -- 0:00:57 161500 -- (-1238.475) (-1238.539) (-1239.197) [-1242.560] * (-1242.769) [-1237.849] (-1239.242) (-1240.769) -- 0:00:57 162000 -- (-1238.399) (-1239.442) [-1242.248] (-1237.385) * (-1239.310) (-1246.574) (-1239.892) [-1240.046] -- 0:00:56 162500 -- (-1238.864) (-1241.263) (-1241.004) [-1237.101] * (-1237.938) (-1240.115) [-1241.726] (-1240.569) -- 0:00:56 163000 -- (-1239.173) (-1242.392) (-1238.572) [-1239.835] * [-1240.346] (-1243.097) (-1239.753) (-1237.798) -- 0:00:56 163500 -- [-1239.737] (-1240.060) (-1239.612) (-1238.487) * [-1240.100] (-1243.001) (-1241.876) (-1238.759) -- 0:00:56 164000 -- (-1246.118) (-1238.846) [-1241.165] (-1239.287) * (-1239.718) (-1244.919) (-1241.436) [-1246.732] -- 0:00:56 164500 -- (-1237.786) (-1240.228) (-1238.495) [-1239.236] * (-1240.676) (-1242.922) (-1238.466) [-1238.794] -- 0:00:55 165000 -- [-1239.140] (-1241.366) (-1240.331) (-1240.397) * (-1238.709) (-1240.881) [-1238.553] (-1243.168) -- 0:00:55 Average standard deviation of split frequencies: 0.024138 165500 -- (-1239.429) (-1238.738) [-1240.988] (-1242.399) * (-1238.210) (-1240.675) (-1240.260) [-1239.190] -- 0:00:55 166000 -- (-1238.635) [-1238.823] (-1243.203) (-1239.384) * (-1237.772) (-1239.837) (-1240.563) [-1239.417] -- 0:00:55 166500 -- (-1239.435) (-1239.008) [-1240.330] (-1242.249) * (-1237.776) (-1240.158) (-1238.985) [-1240.977] -- 0:00:55 167000 -- (-1237.709) [-1238.521] (-1240.879) (-1242.160) * (-1238.979) (-1239.794) (-1238.791) [-1242.034] -- 0:00:54 167500 -- (-1241.257) (-1238.869) (-1237.828) [-1241.116] * (-1240.382) [-1241.446] (-1240.247) (-1242.678) -- 0:00:54 168000 -- (-1240.193) (-1242.202) [-1237.734] (-1238.354) * [-1240.970] (-1241.816) (-1237.571) (-1245.172) -- 0:00:54 168500 -- (-1243.615) (-1238.587) [-1241.806] (-1241.977) * (-1241.745) (-1238.910) [-1237.571] (-1240.883) -- 0:00:54 169000 -- (-1242.086) [-1238.792] (-1245.453) (-1243.669) * (-1244.138) (-1243.006) [-1237.367] (-1238.891) -- 0:00:54 169500 -- (-1240.074) (-1240.418) [-1238.855] (-1242.619) * [-1238.738] (-1241.422) (-1237.304) (-1240.085) -- 0:00:53 170000 -- (-1241.806) [-1241.150] (-1239.277) (-1243.313) * (-1238.963) (-1241.147) [-1237.296] (-1239.435) -- 0:00:53 Average standard deviation of split frequencies: 0.023696 170500 -- (-1242.636) [-1240.273] (-1241.822) (-1238.393) * (-1239.275) (-1242.307) [-1239.868] (-1237.780) -- 0:00:58 171000 -- (-1240.181) (-1240.749) (-1238.281) [-1239.588] * [-1239.938] (-1240.521) (-1242.338) (-1237.521) -- 0:00:58 171500 -- (-1244.447) (-1240.235) [-1237.691] (-1241.056) * (-1244.536) [-1240.349] (-1240.097) (-1237.544) -- 0:00:57 172000 -- [-1239.501] (-1246.945) (-1237.934) (-1239.100) * (-1241.132) (-1237.359) [-1240.152] (-1237.502) -- 0:00:57 172500 -- (-1239.949) (-1242.978) (-1240.653) [-1237.801] * [-1241.554] (-1239.589) (-1239.883) (-1238.488) -- 0:00:57 173000 -- [-1239.239] (-1241.411) (-1241.012) (-1238.553) * (-1239.043) (-1241.895) [-1239.316] (-1238.652) -- 0:00:57 173500 -- (-1239.116) (-1238.643) (-1241.867) [-1237.684] * (-1242.883) (-1239.153) [-1238.229] (-1240.690) -- 0:00:57 174000 -- [-1239.767] (-1238.576) (-1237.528) (-1237.325) * [-1238.726] (-1238.867) (-1242.314) (-1243.021) -- 0:00:56 174500 -- (-1240.046) (-1240.298) (-1238.623) [-1237.273] * [-1243.189] (-1238.770) (-1242.270) (-1238.215) -- 0:00:56 175000 -- (-1237.671) (-1240.078) [-1238.570] (-1238.383) * (-1241.628) (-1237.338) [-1237.461] (-1242.047) -- 0:00:56 Average standard deviation of split frequencies: 0.021874 175500 -- (-1237.505) (-1246.575) [-1238.571] (-1240.068) * [-1240.768] (-1237.420) (-1241.061) (-1239.835) -- 0:00:56 176000 -- (-1237.770) [-1239.307] (-1238.430) (-1239.857) * [-1239.026] (-1238.052) (-1242.765) (-1239.334) -- 0:00:56 176500 -- (-1237.137) (-1237.903) [-1238.417] (-1239.684) * (-1238.228) [-1237.073] (-1239.504) (-1239.936) -- 0:00:55 177000 -- (-1237.214) (-1242.134) (-1240.302) [-1237.454] * [-1239.574] (-1238.003) (-1238.649) (-1238.641) -- 0:00:55 177500 -- [-1237.497] (-1240.178) (-1239.743) (-1238.903) * (-1238.716) [-1237.766] (-1240.104) (-1238.384) -- 0:00:55 178000 -- (-1237.467) (-1240.131) (-1240.266) [-1237.699] * (-1237.915) [-1237.357] (-1238.370) (-1241.028) -- 0:00:55 178500 -- (-1242.462) [-1237.817] (-1240.874) (-1241.497) * (-1237.789) (-1237.722) [-1242.936] (-1239.893) -- 0:00:55 179000 -- [-1243.279] (-1238.666) (-1238.314) (-1240.593) * (-1237.396) (-1240.800) (-1239.348) [-1238.726] -- 0:00:55 179500 -- (-1243.748) (-1240.258) (-1241.875) [-1238.688] * (-1237.948) (-1238.688) [-1237.660] (-1241.801) -- 0:00:54 180000 -- [-1243.166] (-1241.211) (-1238.803) (-1239.429) * [-1237.544] (-1240.357) (-1238.196) (-1239.534) -- 0:00:54 Average standard deviation of split frequencies: 0.018845 180500 -- [-1242.489] (-1240.744) (-1239.128) (-1240.045) * (-1238.001) (-1237.484) [-1240.085] (-1241.402) -- 0:00:54 181000 -- [-1239.183] (-1250.410) (-1241.882) (-1238.967) * (-1239.085) (-1241.173) [-1240.461] (-1239.468) -- 0:00:54 181500 -- (-1238.880) (-1241.884) [-1240.716] (-1238.139) * (-1239.274) [-1240.199] (-1244.287) (-1239.227) -- 0:00:54 182000 -- (-1238.335) [-1239.609] (-1241.236) (-1241.720) * [-1241.291] (-1242.637) (-1241.382) (-1241.030) -- 0:00:53 182500 -- (-1238.807) (-1239.815) [-1238.139] (-1239.640) * (-1245.685) [-1238.656] (-1237.733) (-1242.060) -- 0:00:53 183000 -- [-1238.924] (-1238.430) (-1239.037) (-1239.691) * (-1244.293) (-1241.042) [-1237.577] (-1245.051) -- 0:00:53 183500 -- (-1238.832) (-1239.442) (-1243.764) [-1237.434] * (-1244.694) [-1239.617] (-1239.481) (-1239.579) -- 0:00:53 184000 -- (-1238.347) (-1237.846) (-1237.725) [-1237.482] * (-1238.316) (-1239.993) (-1237.483) [-1238.462] -- 0:00:53 184500 -- (-1238.922) (-1239.828) [-1239.345] (-1243.003) * (-1238.394) (-1239.383) (-1238.935) [-1238.543] -- 0:00:53 185000 -- (-1241.503) [-1238.697] (-1241.004) (-1242.759) * (-1239.185) [-1241.516] (-1237.753) (-1239.000) -- 0:00:52 Average standard deviation of split frequencies: 0.020142 185500 -- (-1243.330) [-1240.676] (-1240.849) (-1240.237) * [-1239.025] (-1241.476) (-1238.640) (-1238.817) -- 0:00:52 186000 -- (-1238.166) (-1242.268) (-1238.805) [-1245.529] * [-1238.051] (-1237.232) (-1238.278) (-1237.679) -- 0:00:56 186500 -- [-1239.314] (-1238.732) (-1237.450) (-1241.263) * [-1240.237] (-1237.940) (-1237.154) (-1239.749) -- 0:00:56 187000 -- (-1237.253) (-1240.847) (-1237.198) [-1238.266] * (-1238.664) [-1237.605] (-1237.913) (-1239.743) -- 0:00:56 187500 -- (-1237.262) (-1238.192) (-1238.566) [-1238.441] * [-1239.743] (-1237.861) (-1238.181) (-1240.183) -- 0:00:56 188000 -- [-1237.262] (-1237.479) (-1239.577) (-1240.454) * [-1237.581] (-1238.649) (-1237.984) (-1239.284) -- 0:00:56 188500 -- (-1238.772) (-1238.414) (-1239.577) [-1240.936] * (-1238.972) [-1240.183] (-1238.329) (-1238.654) -- 0:00:55 189000 -- [-1238.793] (-1237.884) (-1240.931) (-1238.276) * (-1243.973) [-1238.375] (-1238.401) (-1241.605) -- 0:00:55 189500 -- [-1241.152] (-1240.096) (-1238.307) (-1237.805) * [-1239.413] (-1239.533) (-1238.295) (-1239.405) -- 0:00:55 190000 -- (-1243.299) [-1238.095] (-1238.825) (-1240.592) * (-1239.550) (-1240.206) (-1239.366) [-1238.562] -- 0:00:55 Average standard deviation of split frequencies: 0.022252 190500 -- [-1241.932] (-1238.496) (-1238.639) (-1240.934) * (-1241.902) (-1239.437) [-1237.109] (-1238.493) -- 0:00:55 191000 -- (-1242.213) (-1240.865) [-1240.995] (-1239.644) * [-1240.881] (-1237.658) (-1238.192) (-1239.184) -- 0:00:55 191500 -- [-1239.394] (-1242.735) (-1241.163) (-1240.416) * (-1238.394) [-1237.941] (-1242.262) (-1240.186) -- 0:00:54 192000 -- (-1244.422) (-1240.361) [-1240.200] (-1239.136) * (-1239.334) (-1237.501) (-1242.224) [-1238.450] -- 0:00:54 192500 -- (-1239.365) [-1238.307] (-1240.319) (-1240.396) * [-1239.211] (-1237.393) (-1243.332) (-1240.574) -- 0:00:54 193000 -- [-1242.314] (-1238.349) (-1238.852) (-1240.606) * (-1240.751) (-1237.558) (-1238.752) [-1241.968] -- 0:00:54 193500 -- (-1240.247) (-1241.542) (-1238.652) [-1238.967] * (-1238.916) (-1242.071) (-1240.024) [-1241.815] -- 0:00:54 194000 -- (-1240.338) (-1244.284) [-1238.001] (-1239.287) * (-1239.838) [-1238.145] (-1237.665) (-1242.944) -- 0:00:54 194500 -- [-1238.174] (-1238.744) (-1238.093) (-1238.706) * [-1237.377] (-1238.149) (-1240.356) (-1240.634) -- 0:00:53 195000 -- (-1239.013) (-1239.279) [-1240.331] (-1241.335) * (-1237.362) (-1238.977) (-1241.971) [-1239.181] -- 0:00:53 Average standard deviation of split frequencies: 0.019114 195500 -- (-1238.891) (-1244.950) (-1239.933) [-1240.384] * (-1237.418) [-1239.137] (-1239.810) (-1241.386) -- 0:00:53 196000 -- (-1239.351) [-1237.879] (-1239.756) (-1239.266) * [-1237.640] (-1242.250) (-1238.422) (-1238.002) -- 0:00:53 196500 -- (-1239.379) [-1239.024] (-1241.350) (-1239.330) * [-1238.372] (-1242.103) (-1238.693) (-1238.508) -- 0:00:53 197000 -- (-1238.286) (-1240.151) (-1242.224) [-1238.607] * (-1240.648) (-1242.441) [-1239.153] (-1238.444) -- 0:00:52 197500 -- (-1241.520) (-1238.010) (-1237.330) [-1238.555] * [-1237.929] (-1240.220) (-1239.510) (-1240.520) -- 0:00:52 198000 -- (-1238.855) (-1238.182) (-1237.332) [-1238.426] * (-1238.051) [-1238.867] (-1239.276) (-1239.577) -- 0:00:52 198500 -- [-1238.022] (-1241.387) (-1238.373) (-1238.426) * (-1240.818) (-1237.242) (-1239.970) [-1239.778] -- 0:00:52 199000 -- (-1238.332) (-1242.846) [-1243.411] (-1238.550) * (-1238.592) (-1239.105) (-1237.692) [-1240.288] -- 0:00:52 199500 -- (-1238.443) [-1238.163] (-1242.383) (-1239.529) * [-1238.613] (-1239.130) (-1238.660) (-1239.780) -- 0:00:52 200000 -- (-1237.236) (-1238.563) (-1240.882) [-1239.580] * (-1238.404) (-1237.482) [-1238.660] (-1238.835) -- 0:00:51 Average standard deviation of split frequencies: 0.018241 200500 -- (-1241.942) [-1238.023] (-1239.113) (-1241.695) * [-1239.142] (-1237.368) (-1238.660) (-1237.779) -- 0:00:51 201000 -- (-1240.008) (-1238.815) [-1238.108] (-1238.762) * (-1238.143) [-1238.670] (-1240.005) (-1238.302) -- 0:00:51 201500 -- (-1239.548) (-1238.806) [-1237.975] (-1239.461) * (-1237.907) [-1237.299] (-1239.136) (-1239.311) -- 0:00:51 202000 -- (-1238.959) [-1238.942] (-1241.333) (-1242.823) * (-1238.928) [-1243.201] (-1238.691) (-1246.886) -- 0:00:55 202500 -- (-1239.695) (-1242.131) (-1242.807) [-1240.127] * [-1240.904] (-1237.072) (-1239.850) (-1242.403) -- 0:00:55 203000 -- (-1240.395) [-1238.796] (-1239.388) (-1245.158) * (-1238.400) [-1239.387] (-1238.728) (-1239.831) -- 0:00:54 203500 -- (-1239.657) (-1241.006) (-1239.735) [-1243.198] * (-1243.087) (-1241.049) (-1241.028) [-1240.193] -- 0:00:54 204000 -- (-1240.092) [-1240.966] (-1238.135) (-1243.127) * (-1239.231) (-1240.069) [-1238.213] (-1238.846) -- 0:00:54 204500 -- (-1238.203) [-1238.315] (-1241.228) (-1238.978) * (-1237.677) (-1240.422) (-1241.455) [-1239.037] -- 0:00:54 205000 -- (-1238.027) [-1242.072] (-1239.032) (-1241.554) * [-1239.456] (-1240.422) (-1239.146) (-1239.007) -- 0:00:54 Average standard deviation of split frequencies: 0.019391 205500 -- [-1238.056] (-1238.933) (-1239.031) (-1240.911) * (-1240.009) [-1237.342] (-1239.488) (-1240.563) -- 0:00:54 206000 -- [-1238.297] (-1241.335) (-1237.581) (-1239.531) * [-1238.092] (-1241.277) (-1239.824) (-1237.640) -- 0:00:53 206500 -- (-1239.390) [-1243.538] (-1238.199) (-1238.412) * (-1237.812) (-1239.598) [-1238.952] (-1237.041) -- 0:00:53 207000 -- (-1244.101) (-1239.118) (-1239.960) [-1238.008] * (-1240.649) [-1238.487] (-1239.877) (-1237.250) -- 0:00:53 207500 -- (-1245.165) (-1240.176) [-1240.721] (-1239.312) * (-1244.271) (-1238.744) [-1239.414] (-1237.350) -- 0:00:53 208000 -- [-1238.717] (-1238.281) (-1241.254) (-1238.314) * (-1241.793) (-1239.269) [-1240.590] (-1237.559) -- 0:00:53 208500 -- (-1239.448) (-1240.028) (-1243.456) [-1238.402] * (-1240.996) [-1241.177] (-1238.647) (-1237.406) -- 0:00:53 209000 -- (-1239.168) (-1241.575) [-1240.102] (-1241.304) * (-1239.634) (-1245.527) (-1239.444) [-1239.797] -- 0:00:52 209500 -- [-1239.597] (-1238.958) (-1238.599) (-1239.333) * [-1237.332] (-1240.828) (-1240.425) (-1239.320) -- 0:00:52 210000 -- (-1239.660) [-1238.337] (-1239.340) (-1237.884) * (-1237.274) (-1238.755) (-1239.194) [-1238.299] -- 0:00:52 Average standard deviation of split frequencies: 0.019020 210500 -- [-1238.430] (-1240.097) (-1239.718) (-1237.232) * (-1240.915) [-1238.445] (-1242.100) (-1238.759) -- 0:00:52 211000 -- [-1239.098] (-1239.423) (-1239.211) (-1237.816) * (-1242.114) [-1238.171] (-1239.026) (-1239.017) -- 0:00:52 211500 -- [-1238.935] (-1242.048) (-1239.117) (-1238.039) * (-1242.231) (-1239.017) [-1238.804] (-1240.005) -- 0:00:52 212000 -- (-1238.924) [-1239.737] (-1239.929) (-1238.475) * (-1239.826) (-1239.812) [-1237.523] (-1240.276) -- 0:00:52 212500 -- (-1240.213) (-1239.430) [-1237.722] (-1238.864) * (-1238.583) (-1243.803) (-1238.342) [-1240.091] -- 0:00:51 213000 -- (-1240.755) [-1242.313] (-1238.193) (-1238.394) * (-1241.133) [-1238.159] (-1237.952) (-1238.527) -- 0:00:51 213500 -- (-1240.332) (-1241.096) (-1244.035) [-1240.150] * (-1240.281) [-1239.110] (-1238.406) (-1239.856) -- 0:00:51 214000 -- (-1239.417) (-1241.513) (-1242.276) [-1241.021] * (-1240.281) (-1243.433) (-1238.840) [-1238.291] -- 0:00:51 214500 -- (-1242.037) [-1239.984] (-1241.407) (-1241.012) * (-1243.380) (-1241.357) [-1238.171] (-1238.565) -- 0:00:51 215000 -- [-1240.031] (-1240.043) (-1239.460) (-1241.510) * (-1243.184) (-1239.723) (-1237.923) [-1237.708] -- 0:00:51 Average standard deviation of split frequencies: 0.018793 215500 -- (-1238.577) (-1240.108) [-1239.726] (-1243.616) * (-1241.258) (-1238.510) (-1239.435) [-1237.843] -- 0:00:50 216000 -- (-1237.496) (-1240.354) [-1237.668] (-1242.499) * [-1246.896] (-1239.418) (-1239.449) (-1238.687) -- 0:00:50 216500 -- [-1237.972] (-1239.767) (-1244.075) (-1242.627) * (-1246.335) (-1239.829) (-1240.208) [-1238.832] -- 0:00:50 217000 -- (-1238.890) [-1241.463] (-1239.339) (-1241.650) * (-1244.908) (-1242.803) (-1238.713) [-1240.405] -- 0:00:50 217500 -- (-1239.912) [-1237.870] (-1244.684) (-1240.207) * (-1238.937) [-1242.767] (-1241.398) (-1238.645) -- 0:00:50 218000 -- (-1241.720) (-1239.216) (-1240.383) [-1238.985] * (-1239.902) (-1241.563) [-1241.323] (-1238.600) -- 0:00:53 218500 -- (-1240.775) [-1239.401] (-1242.856) (-1238.767) * (-1240.886) (-1243.305) (-1239.752) [-1242.083] -- 0:00:53 219000 -- [-1239.261] (-1239.774) (-1242.183) (-1238.597) * (-1241.304) (-1239.084) (-1239.978) [-1241.227] -- 0:00:53 219500 -- (-1238.622) (-1240.311) [-1247.467] (-1238.775) * [-1242.496] (-1241.547) (-1238.296) (-1239.816) -- 0:00:53 220000 -- (-1237.862) (-1244.430) [-1242.387] (-1239.059) * [-1238.894] (-1237.800) (-1238.233) (-1239.090) -- 0:00:53 Average standard deviation of split frequencies: 0.016965 220500 -- (-1237.452) (-1240.495) (-1238.301) [-1239.341] * (-1240.719) (-1237.734) (-1238.427) [-1240.189] -- 0:00:53 221000 -- [-1238.105] (-1239.180) (-1241.972) (-1238.781) * (-1242.922) (-1239.168) (-1239.229) [-1239.262] -- 0:00:52 221500 -- (-1238.918) (-1237.852) [-1241.579] (-1237.391) * (-1240.639) (-1244.591) (-1238.058) [-1238.757] -- 0:00:52 222000 -- (-1242.738) (-1238.715) [-1242.603] (-1239.198) * (-1238.880) (-1240.415) (-1238.507) [-1242.558] -- 0:00:52 222500 -- (-1239.690) [-1239.602] (-1241.566) (-1237.369) * [-1238.370] (-1239.503) (-1238.763) (-1239.008) -- 0:00:52 223000 -- (-1238.627) (-1239.605) (-1239.186) [-1237.547] * (-1238.559) (-1238.921) (-1240.642) [-1241.867] -- 0:00:52 223500 -- [-1239.940] (-1238.278) (-1238.024) (-1238.474) * (-1239.106) [-1240.114] (-1238.259) (-1239.428) -- 0:00:52 224000 -- (-1241.684) (-1239.279) (-1237.729) [-1237.649] * (-1239.786) [-1240.114] (-1237.510) (-1238.925) -- 0:00:51 224500 -- (-1237.967) [-1238.551] (-1238.907) (-1237.240) * [-1239.511] (-1243.389) (-1238.479) (-1238.722) -- 0:00:51 225000 -- (-1237.959) (-1241.586) (-1237.532) [-1240.783] * (-1240.677) (-1245.518) [-1241.465] (-1238.955) -- 0:00:51 Average standard deviation of split frequencies: 0.018251 225500 -- (-1239.264) (-1245.837) [-1239.710] (-1238.771) * (-1242.140) [-1241.379] (-1246.794) (-1239.299) -- 0:00:51 226000 -- [-1238.924] (-1238.230) (-1239.822) (-1238.314) * (-1240.163) (-1240.408) (-1243.287) [-1239.875] -- 0:00:51 226500 -- (-1239.244) (-1238.478) [-1238.449] (-1239.675) * (-1241.537) (-1237.835) (-1239.196) [-1239.108] -- 0:00:51 227000 -- (-1239.017) (-1239.173) [-1238.331] (-1239.774) * (-1241.648) (-1239.363) [-1239.288] (-1238.795) -- 0:00:51 227500 -- (-1241.233) (-1241.834) (-1238.155) [-1238.845] * (-1242.374) [-1241.418] (-1241.096) (-1239.646) -- 0:00:50 228000 -- (-1242.267) (-1240.547) (-1240.244) [-1239.919] * [-1240.443] (-1247.496) (-1238.438) (-1239.260) -- 0:00:50 228500 -- (-1241.341) [-1238.851] (-1242.775) (-1245.865) * (-1238.466) (-1238.817) [-1238.568] (-1240.008) -- 0:00:50 229000 -- (-1240.705) [-1239.291] (-1242.122) (-1241.396) * (-1241.056) (-1238.014) (-1239.202) [-1237.896] -- 0:00:50 229500 -- (-1237.780) [-1238.813] (-1238.641) (-1241.725) * (-1247.607) (-1237.614) (-1237.414) [-1241.104] -- 0:00:50 230000 -- [-1238.935] (-1241.232) (-1238.040) (-1241.513) * (-1243.939) (-1242.310) (-1237.717) [-1239.503] -- 0:00:50 Average standard deviation of split frequencies: 0.017825 230500 -- (-1237.332) (-1247.399) [-1238.640] (-1245.739) * (-1240.191) (-1237.948) (-1241.472) [-1238.790] -- 0:00:50 231000 -- [-1239.929] (-1241.607) (-1238.668) (-1245.120) * (-1237.710) [-1237.648] (-1240.160) (-1239.629) -- 0:00:49 231500 -- (-1239.992) (-1239.621) [-1237.759] (-1239.291) * (-1240.474) [-1238.105] (-1241.505) (-1242.215) -- 0:00:49 232000 -- [-1238.591] (-1237.527) (-1239.620) (-1239.600) * (-1242.661) [-1237.875] (-1238.753) (-1242.373) -- 0:00:49 232500 -- (-1238.029) [-1241.653] (-1240.588) (-1239.125) * [-1237.969] (-1240.651) (-1238.476) (-1244.969) -- 0:00:49 233000 -- [-1238.237] (-1238.059) (-1238.528) (-1239.291) * [-1239.250] (-1238.714) (-1241.712) (-1241.597) -- 0:00:52 233500 -- (-1238.713) (-1237.476) [-1239.386] (-1238.023) * (-1239.868) (-1239.051) [-1241.712] (-1241.890) -- 0:00:52 234000 -- (-1239.421) (-1237.378) (-1238.208) [-1238.874] * (-1240.990) [-1238.849] (-1238.875) (-1239.307) -- 0:00:52 234500 -- [-1237.798] (-1240.540) (-1240.169) (-1238.107) * (-1241.162) (-1239.064) [-1239.937] (-1238.345) -- 0:00:52 235000 -- (-1238.770) (-1244.364) [-1239.004] (-1238.995) * (-1238.447) (-1239.374) [-1237.636] (-1238.344) -- 0:00:52 Average standard deviation of split frequencies: 0.017977 235500 -- [-1240.438] (-1239.176) (-1239.510) (-1240.216) * (-1239.896) (-1239.065) (-1237.636) [-1241.668] -- 0:00:51 236000 -- (-1238.508) (-1238.923) (-1238.204) [-1240.457] * [-1240.339] (-1238.001) (-1237.827) (-1240.575) -- 0:00:51 236500 -- (-1240.704) [-1238.486] (-1241.211) (-1238.581) * (-1241.629) (-1238.323) (-1237.394) [-1239.045] -- 0:00:51 237000 -- (-1240.853) (-1240.002) [-1242.065] (-1240.097) * [-1240.189] (-1238.220) (-1237.716) (-1238.978) -- 0:00:51 237500 -- (-1238.340) [-1240.033] (-1244.203) (-1240.203) * (-1241.860) [-1240.228] (-1239.824) (-1241.420) -- 0:00:51 238000 -- (-1238.899) (-1240.762) [-1237.789] (-1238.096) * (-1246.086) [-1239.445] (-1239.395) (-1239.554) -- 0:00:51 238500 -- (-1238.924) (-1243.360) (-1239.698) [-1240.034] * (-1238.916) (-1239.569) (-1241.632) [-1239.505] -- 0:00:51 239000 -- (-1239.052) (-1239.734) (-1240.349) [-1238.654] * (-1240.472) (-1240.836) (-1240.535) [-1238.137] -- 0:00:50 239500 -- [-1239.046] (-1239.837) (-1237.556) (-1243.896) * (-1239.658) [-1239.011] (-1238.962) (-1240.236) -- 0:00:50 240000 -- [-1239.020] (-1239.996) (-1238.133) (-1238.990) * [-1241.399] (-1238.038) (-1238.587) (-1239.520) -- 0:00:50 Average standard deviation of split frequencies: 0.016804 240500 -- (-1238.213) (-1239.749) [-1238.026] (-1239.284) * (-1241.545) (-1238.130) (-1239.780) [-1239.709] -- 0:00:50 241000 -- (-1237.867) [-1239.000] (-1237.748) (-1242.855) * (-1240.381) (-1238.036) (-1238.174) [-1239.752] -- 0:00:50 241500 -- (-1237.871) (-1239.612) (-1237.724) [-1242.342] * (-1241.578) (-1238.120) (-1238.113) [-1239.636] -- 0:00:50 242000 -- (-1237.406) [-1238.868] (-1241.198) (-1239.735) * (-1241.605) (-1240.348) [-1239.195] (-1237.746) -- 0:00:50 242500 -- (-1237.635) (-1238.179) [-1241.471] (-1240.900) * (-1239.207) (-1239.427) [-1239.900] (-1238.527) -- 0:00:49 243000 -- (-1237.531) [-1237.957] (-1240.137) (-1240.767) * (-1238.992) (-1239.656) (-1239.231) [-1239.003] -- 0:00:49 243500 -- [-1238.895] (-1241.213) (-1240.696) (-1237.329) * (-1238.585) (-1239.542) (-1239.724) [-1238.786] -- 0:00:49 244000 -- [-1237.520] (-1239.368) (-1238.285) (-1238.304) * (-1242.537) [-1237.698] (-1238.219) (-1240.098) -- 0:00:49 244500 -- (-1238.588) (-1240.402) [-1237.996] (-1241.035) * [-1238.869] (-1239.042) (-1237.721) (-1240.091) -- 0:00:49 245000 -- [-1239.507] (-1237.714) (-1238.835) (-1238.635) * (-1240.078) [-1240.756] (-1243.904) (-1243.162) -- 0:00:49 Average standard deviation of split frequencies: 0.016959 245500 -- (-1240.850) (-1237.234) (-1240.845) [-1238.552] * (-1240.892) (-1240.563) [-1238.338] (-1241.981) -- 0:00:49 246000 -- (-1238.265) (-1241.540) (-1240.328) [-1239.600] * (-1242.464) [-1244.065] (-1238.307) (-1245.216) -- 0:00:49 246500 -- (-1239.019) [-1238.565] (-1239.218) (-1239.183) * (-1240.057) (-1239.627) (-1240.038) [-1241.000] -- 0:00:48 247000 -- [-1240.363] (-1238.748) (-1239.405) (-1238.956) * [-1241.906] (-1240.756) (-1240.483) (-1242.150) -- 0:00:48 247500 -- (-1243.759) [-1243.658] (-1238.323) (-1237.751) * (-1238.999) (-1238.306) [-1239.082] (-1239.278) -- 0:00:48 248000 -- (-1243.770) (-1240.116) [-1239.105] (-1238.004) * [-1240.278] (-1242.647) (-1239.575) (-1238.206) -- 0:00:48 248500 -- (-1241.074) (-1243.155) [-1238.670] (-1239.514) * (-1240.656) [-1242.774] (-1239.171) (-1238.318) -- 0:00:48 249000 -- [-1240.332] (-1242.070) (-1240.927) (-1238.324) * [-1241.241] (-1238.325) (-1239.326) (-1238.246) -- 0:00:51 249500 -- (-1242.249) (-1244.967) (-1244.394) [-1238.448] * (-1240.682) (-1241.342) (-1239.358) [-1238.695] -- 0:00:51 250000 -- (-1242.896) (-1241.683) [-1238.639] (-1237.926) * (-1239.670) (-1239.003) [-1237.675] (-1239.806) -- 0:00:51 Average standard deviation of split frequencies: 0.016267 250500 -- (-1243.349) (-1239.749) (-1240.698) [-1238.950] * [-1237.315] (-1241.384) (-1238.774) (-1242.673) -- 0:00:50 251000 -- (-1241.728) [-1239.178] (-1241.909) (-1240.843) * (-1238.257) (-1239.164) [-1238.805] (-1241.386) -- 0:00:50 251500 -- (-1238.641) (-1242.319) (-1243.332) [-1238.441] * (-1237.599) (-1240.832) [-1238.656] (-1241.034) -- 0:00:50 252000 -- (-1241.484) (-1243.340) [-1238.965] (-1241.680) * [-1238.470] (-1239.446) (-1238.076) (-1240.300) -- 0:00:50 252500 -- (-1239.894) (-1238.809) (-1239.091) [-1242.063] * [-1242.846] (-1239.558) (-1239.002) (-1237.875) -- 0:00:50 253000 -- (-1238.603) [-1237.741] (-1237.514) (-1241.940) * [-1241.085] (-1240.311) (-1240.524) (-1238.881) -- 0:00:50 253500 -- (-1241.412) [-1239.638] (-1239.010) (-1239.729) * (-1243.147) (-1240.827) (-1238.511) [-1238.956] -- 0:00:50 254000 -- (-1240.816) [-1239.595] (-1240.254) (-1240.505) * (-1239.069) [-1238.867] (-1238.517) (-1241.243) -- 0:00:49 254500 -- [-1238.506] (-1238.035) (-1238.739) (-1238.343) * (-1238.080) (-1240.275) [-1239.652] (-1240.913) -- 0:00:49 255000 -- (-1239.112) (-1237.732) (-1240.935) [-1238.003] * (-1239.010) (-1239.914) [-1239.859] (-1238.749) -- 0:00:49 Average standard deviation of split frequencies: 0.017736 255500 -- (-1239.124) (-1237.724) (-1243.376) [-1240.428] * (-1238.218) (-1238.751) [-1238.838] (-1237.890) -- 0:00:49 256000 -- (-1240.456) [-1238.603] (-1241.077) (-1239.962) * (-1239.908) (-1238.195) (-1239.089) [-1239.970] -- 0:00:49 256500 -- [-1241.396] (-1240.950) (-1238.802) (-1241.491) * (-1241.471) [-1237.482] (-1240.027) (-1237.927) -- 0:00:49 257000 -- (-1238.556) (-1242.389) [-1239.383] (-1240.770) * [-1241.007] (-1239.676) (-1240.909) (-1237.909) -- 0:00:49 257500 -- (-1240.768) [-1239.240] (-1238.821) (-1239.132) * [-1239.566] (-1240.032) (-1239.092) (-1239.021) -- 0:00:49 258000 -- (-1238.587) (-1241.784) [-1238.629] (-1238.520) * [-1240.655] (-1238.989) (-1239.847) (-1239.683) -- 0:00:48 258500 -- (-1246.600) (-1241.425) (-1240.332) [-1238.599] * (-1240.318) (-1240.527) [-1238.831] (-1239.268) -- 0:00:48 259000 -- [-1239.630] (-1241.661) (-1238.222) (-1238.572) * [-1240.626] (-1241.306) (-1238.505) (-1237.683) -- 0:00:48 259500 -- (-1241.076) (-1242.615) (-1241.689) [-1239.035] * (-1246.589) (-1243.634) (-1239.929) [-1240.041] -- 0:00:48 260000 -- (-1239.837) (-1240.694) (-1241.183) [-1242.001] * (-1240.706) (-1243.441) (-1240.815) [-1242.633] -- 0:00:48 Average standard deviation of split frequencies: 0.016170 260500 -- (-1240.160) (-1240.227) [-1239.393] (-1238.857) * [-1241.094] (-1244.586) (-1240.313) (-1245.608) -- 0:00:48 261000 -- (-1240.083) (-1241.912) [-1240.561] (-1239.065) * [-1238.173] (-1242.435) (-1238.304) (-1240.221) -- 0:00:48 261500 -- (-1240.169) [-1242.309] (-1240.740) (-1238.480) * [-1240.264] (-1241.913) (-1239.152) (-1239.992) -- 0:00:48 262000 -- (-1239.053) (-1239.940) [-1238.753] (-1240.532) * (-1239.771) (-1242.066) (-1238.746) [-1239.053] -- 0:00:47 262500 -- (-1238.022) [-1241.246] (-1238.496) (-1241.367) * (-1239.415) [-1241.327] (-1243.557) (-1241.518) -- 0:00:47 263000 -- (-1237.950) [-1239.449] (-1237.956) (-1238.372) * (-1240.100) (-1241.422) (-1238.664) [-1239.238] -- 0:00:47 263500 -- (-1238.366) [-1239.616] (-1240.555) (-1239.278) * (-1239.371) [-1240.508] (-1241.521) (-1239.727) -- 0:00:47 264000 -- (-1238.570) (-1240.178) (-1241.773) [-1239.059] * [-1237.247] (-1239.431) (-1238.083) (-1240.271) -- 0:00:47 264500 -- (-1239.335) [-1241.170] (-1239.759) (-1240.129) * [-1237.321] (-1241.063) (-1237.704) (-1240.934) -- 0:00:47 265000 -- (-1240.373) (-1242.529) [-1238.073] (-1239.242) * (-1240.047) (-1243.485) (-1238.216) [-1238.099] -- 0:00:49 Average standard deviation of split frequencies: 0.017427 265500 -- (-1237.939) [-1240.012] (-1238.240) (-1239.015) * [-1244.139] (-1239.119) (-1238.463) (-1237.592) -- 0:00:49 266000 -- (-1238.218) [-1239.618] (-1238.605) (-1239.010) * (-1238.096) [-1239.453] (-1239.524) (-1240.210) -- 0:00:49 266500 -- (-1243.380) (-1238.457) [-1241.415] (-1238.531) * [-1240.703] (-1241.710) (-1239.094) (-1241.133) -- 0:00:49 267000 -- (-1242.152) (-1238.149) (-1240.838) [-1238.421] * (-1237.757) (-1239.447) (-1240.620) [-1239.422] -- 0:00:49 267500 -- [-1238.263] (-1239.390) (-1241.960) (-1237.870) * [-1238.625] (-1238.812) (-1239.018) (-1241.487) -- 0:00:49 268000 -- (-1238.099) (-1238.603) [-1238.608] (-1238.123) * (-1239.910) (-1238.928) [-1240.795] (-1240.406) -- 0:00:49 268500 -- [-1237.919] (-1237.901) (-1238.498) (-1242.964) * [-1239.685] (-1239.569) (-1243.479) (-1238.509) -- 0:00:49 269000 -- (-1238.029) [-1240.633] (-1237.757) (-1241.719) * (-1243.325) (-1239.390) [-1237.493] (-1238.787) -- 0:00:48 269500 -- [-1238.682] (-1237.624) (-1238.445) (-1242.459) * (-1242.524) (-1238.790) [-1239.118] (-1239.487) -- 0:00:48 270000 -- [-1239.120] (-1240.776) (-1239.040) (-1240.081) * (-1241.526) [-1240.645] (-1238.649) (-1239.657) -- 0:00:48 Average standard deviation of split frequencies: 0.016836 270500 -- (-1240.023) (-1241.177) [-1237.966] (-1239.020) * (-1239.681) (-1239.495) (-1237.844) [-1238.029] -- 0:00:48 271000 -- [-1238.385] (-1238.585) (-1238.924) (-1237.568) * (-1239.946) [-1238.928] (-1238.119) (-1237.622) -- 0:00:48 271500 -- (-1238.464) [-1239.775] (-1237.969) (-1239.659) * (-1237.803) (-1239.016) (-1240.020) [-1243.753] -- 0:00:48 272000 -- (-1238.360) [-1239.324] (-1237.905) (-1237.388) * (-1241.135) [-1238.368] (-1238.976) (-1239.727) -- 0:00:48 272500 -- (-1239.761) (-1238.900) (-1239.409) [-1239.993] * (-1243.513) (-1239.258) [-1240.455] (-1239.054) -- 0:00:48 273000 -- [-1239.281] (-1242.039) (-1239.302) (-1238.286) * [-1240.187] (-1238.518) (-1243.987) (-1237.943) -- 0:00:47 273500 -- (-1239.542) [-1240.951] (-1240.719) (-1239.959) * (-1239.608) (-1239.292) [-1238.569] (-1237.978) -- 0:00:47 274000 -- [-1240.005] (-1240.050) (-1238.207) (-1237.797) * (-1240.869) (-1239.179) (-1237.750) [-1237.877] -- 0:00:47 274500 -- [-1239.209] (-1241.179) (-1238.238) (-1238.481) * (-1241.084) (-1239.340) [-1238.280] (-1237.816) -- 0:00:47 275000 -- (-1239.563) (-1238.098) (-1241.085) [-1238.478] * (-1238.237) [-1238.046] (-1239.011) (-1238.679) -- 0:00:47 Average standard deviation of split frequencies: 0.015372 275500 -- (-1238.205) [-1239.333] (-1240.775) (-1241.241) * [-1242.246] (-1238.468) (-1238.476) (-1238.501) -- 0:00:47 276000 -- (-1238.736) [-1239.478] (-1239.657) (-1242.002) * (-1239.309) (-1237.646) (-1240.736) [-1238.500] -- 0:00:47 276500 -- [-1238.751] (-1242.147) (-1240.638) (-1239.636) * (-1239.838) [-1239.549] (-1237.617) (-1249.845) -- 0:00:47 277000 -- (-1238.796) [-1237.895] (-1239.673) (-1240.504) * (-1238.620) (-1237.861) [-1237.588] (-1241.207) -- 0:00:46 277500 -- (-1237.933) [-1238.076] (-1238.351) (-1238.098) * (-1239.265) (-1238.512) [-1237.332] (-1245.256) -- 0:00:46 278000 -- (-1238.356) (-1238.288) (-1242.018) [-1238.839] * (-1238.984) [-1238.352] (-1238.363) (-1239.283) -- 0:00:46 278500 -- (-1240.625) (-1242.250) (-1242.667) [-1238.259] * (-1243.114) (-1238.281) [-1237.776] (-1239.837) -- 0:00:46 279000 -- (-1242.234) (-1242.254) [-1241.924] (-1238.306) * (-1243.377) (-1238.539) (-1238.007) [-1239.837] -- 0:00:46 279500 -- (-1240.901) (-1238.405) (-1238.553) [-1237.957] * (-1238.137) [-1239.316] (-1237.312) (-1243.409) -- 0:00:46 280000 -- (-1238.839) (-1239.211) [-1238.659] (-1238.018) * (-1240.593) (-1238.221) (-1239.452) [-1238.764] -- 0:00:48 Average standard deviation of split frequencies: 0.015303 280500 -- (-1238.431) (-1243.441) (-1240.158) [-1238.324] * (-1241.012) [-1237.968] (-1238.914) (-1237.544) -- 0:00:48 281000 -- [-1238.317] (-1242.714) (-1241.045) (-1238.977) * (-1237.682) [-1241.169] (-1239.364) (-1237.731) -- 0:00:48 281500 -- (-1239.351) (-1238.543) [-1239.423] (-1240.089) * [-1239.026] (-1240.364) (-1241.200) (-1237.949) -- 0:00:48 282000 -- (-1238.413) (-1242.754) (-1242.764) [-1239.826] * (-1239.492) (-1240.978) (-1238.465) [-1238.953] -- 0:00:48 282500 -- (-1237.943) (-1240.708) (-1242.422) [-1239.625] * (-1240.054) (-1242.231) (-1240.501) [-1239.014] -- 0:00:48 283000 -- (-1239.236) (-1238.326) [-1240.811] (-1240.082) * (-1240.481) (-1242.384) (-1241.512) [-1239.355] -- 0:00:48 283500 -- [-1240.802] (-1238.302) (-1239.335) (-1237.368) * (-1245.406) [-1237.785] (-1241.980) (-1241.858) -- 0:00:48 284000 -- (-1240.015) (-1240.469) [-1240.019] (-1237.801) * (-1237.946) (-1238.820) (-1242.309) [-1240.311] -- 0:00:47 284500 -- (-1238.521) (-1240.890) (-1239.607) [-1238.342] * (-1238.926) (-1240.268) [-1240.196] (-1240.442) -- 0:00:47 285000 -- (-1237.601) [-1238.040] (-1239.876) (-1238.711) * (-1240.167) (-1242.928) [-1240.482] (-1241.004) -- 0:00:47 Average standard deviation of split frequencies: 0.015475 285500 -- [-1241.350] (-1240.542) (-1239.408) (-1238.555) * (-1239.615) (-1240.727) [-1244.653] (-1242.863) -- 0:00:47 286000 -- (-1238.994) (-1248.514) (-1239.060) [-1237.308] * (-1237.735) [-1240.725] (-1243.424) (-1239.197) -- 0:00:47 286500 -- (-1240.480) [-1240.797] (-1239.833) (-1241.076) * (-1239.395) [-1241.953] (-1238.836) (-1239.681) -- 0:00:47 287000 -- [-1238.085] (-1240.837) (-1239.849) (-1238.971) * (-1239.096) (-1239.839) [-1238.671] (-1239.584) -- 0:00:47 287500 -- (-1238.253) (-1239.600) [-1238.332] (-1239.390) * (-1238.677) (-1240.685) (-1237.974) [-1242.869] -- 0:00:47 288000 -- [-1239.081] (-1242.260) (-1240.201) (-1238.003) * (-1237.866) [-1244.300] (-1238.366) (-1245.586) -- 0:00:46 288500 -- [-1238.582] (-1242.507) (-1239.889) (-1238.077) * [-1238.639] (-1241.211) (-1238.187) (-1239.115) -- 0:00:46 289000 -- (-1238.438) (-1243.662) [-1239.381] (-1238.004) * [-1238.248] (-1240.206) (-1238.610) (-1241.424) -- 0:00:46 289500 -- (-1238.496) (-1249.121) (-1240.381) [-1238.368] * (-1239.115) (-1240.129) (-1237.899) [-1240.351] -- 0:00:46 290000 -- (-1238.504) [-1240.396] (-1241.214) (-1238.186) * (-1239.790) (-1240.581) [-1237.725] (-1241.070) -- 0:00:46 Average standard deviation of split frequencies: 0.015677 290500 -- [-1240.353] (-1238.393) (-1240.766) (-1239.435) * (-1240.618) (-1238.358) (-1239.715) [-1239.128] -- 0:00:46 291000 -- (-1238.291) (-1237.866) (-1238.754) [-1239.814] * [-1239.184] (-1237.858) (-1238.244) (-1238.326) -- 0:00:46 291500 -- (-1238.646) [-1239.057] (-1239.283) (-1243.379) * (-1239.624) [-1238.229] (-1237.599) (-1239.809) -- 0:00:46 292000 -- (-1242.037) [-1239.116] (-1238.769) (-1240.344) * [-1241.406] (-1238.885) (-1237.593) (-1238.668) -- 0:00:46 292500 -- (-1238.626) [-1238.549] (-1238.649) (-1245.525) * (-1240.727) [-1240.196] (-1237.541) (-1241.152) -- 0:00:45 293000 -- (-1239.587) (-1238.209) (-1238.250) [-1238.682] * (-1239.296) [-1237.832] (-1238.035) (-1239.251) -- 0:00:45 293500 -- [-1238.756] (-1238.061) (-1239.064) (-1240.061) * (-1241.363) (-1242.420) [-1237.332] (-1238.631) -- 0:00:45 294000 -- (-1237.539) [-1237.545] (-1243.579) (-1239.149) * (-1242.022) (-1239.312) (-1241.252) [-1238.229] -- 0:00:45 294500 -- (-1237.100) [-1238.001] (-1237.941) (-1239.421) * (-1237.667) [-1239.751] (-1238.286) (-1237.444) -- 0:00:45 295000 -- (-1238.049) (-1238.953) [-1237.347] (-1238.453) * [-1238.516] (-1238.868) (-1238.664) (-1243.500) -- 0:00:45 Average standard deviation of split frequencies: 0.014953 295500 -- (-1238.878) (-1240.047) [-1237.707] (-1238.270) * (-1239.135) [-1238.979] (-1240.731) (-1241.238) -- 0:00:45 296000 -- (-1237.591) [-1240.427] (-1238.316) (-1241.825) * (-1242.736) [-1241.985] (-1240.346) (-1239.602) -- 0:00:47 296500 -- [-1239.403] (-1240.736) (-1240.425) (-1239.491) * (-1237.592) (-1238.319) [-1238.453] (-1238.741) -- 0:00:47 297000 -- (-1237.342) (-1243.352) (-1238.195) [-1239.558] * (-1242.307) [-1237.476] (-1242.010) (-1240.421) -- 0:00:47 297500 -- (-1241.805) (-1240.338) (-1237.816) [-1238.930] * [-1243.010] (-1239.515) (-1240.544) (-1240.635) -- 0:00:47 298000 -- (-1245.078) (-1240.101) [-1239.668] (-1239.012) * (-1242.525) (-1243.591) (-1239.483) [-1238.418] -- 0:00:47 298500 -- (-1244.989) (-1238.610) [-1239.443] (-1238.886) * [-1237.733] (-1245.732) (-1238.355) (-1239.491) -- 0:00:47 299000 -- [-1237.985] (-1238.958) (-1239.015) (-1240.011) * (-1239.659) [-1238.790] (-1239.242) (-1239.960) -- 0:00:46 299500 -- [-1239.360] (-1238.938) (-1243.441) (-1238.326) * (-1239.279) (-1238.422) [-1239.193] (-1239.669) -- 0:00:46 300000 -- (-1239.206) (-1237.622) [-1242.144] (-1238.039) * (-1237.980) (-1238.608) (-1238.570) [-1238.553] -- 0:00:46 Average standard deviation of split frequencies: 0.015033 300500 -- [-1239.277] (-1238.010) (-1241.014) (-1240.467) * [-1238.477] (-1238.236) (-1237.153) (-1238.666) -- 0:00:46 301000 -- [-1239.596] (-1237.574) (-1238.889) (-1237.637) * (-1240.565) [-1237.925] (-1238.283) (-1238.041) -- 0:00:46 301500 -- (-1241.171) (-1238.553) (-1237.440) [-1237.600] * (-1242.074) [-1238.113] (-1238.808) (-1241.770) -- 0:00:46 302000 -- (-1242.731) (-1239.280) [-1237.924] (-1237.418) * (-1238.595) [-1240.417] (-1242.457) (-1239.982) -- 0:00:46 302500 -- (-1238.797) (-1239.234) (-1239.069) [-1237.772] * (-1239.570) [-1238.992] (-1244.442) (-1239.270) -- 0:00:46 303000 -- (-1238.840) (-1242.335) (-1238.085) [-1241.080] * (-1239.141) (-1242.081) (-1238.603) [-1237.609] -- 0:00:46 303500 -- (-1240.288) (-1239.020) [-1240.184] (-1239.596) * (-1239.925) (-1240.528) [-1238.350] (-1240.489) -- 0:00:45 304000 -- (-1241.446) (-1243.381) (-1240.834) [-1237.618] * (-1241.324) (-1238.703) [-1239.877] (-1238.273) -- 0:00:45 304500 -- (-1238.615) (-1240.655) (-1240.890) [-1240.518] * (-1239.889) [-1238.695] (-1238.894) (-1239.890) -- 0:00:45 305000 -- [-1237.974] (-1241.596) (-1241.367) (-1238.648) * (-1238.985) [-1238.565] (-1239.712) (-1238.769) -- 0:00:45 Average standard deviation of split frequencies: 0.012405 305500 -- (-1238.114) (-1241.314) [-1241.182] (-1239.115) * [-1239.780] (-1238.514) (-1240.065) (-1238.390) -- 0:00:45 306000 -- (-1238.653) [-1238.434] (-1239.788) (-1238.222) * (-1238.550) (-1238.228) [-1240.019] (-1242.228) -- 0:00:45 306500 -- (-1237.466) [-1242.353] (-1239.855) (-1238.507) * [-1239.488] (-1241.886) (-1238.564) (-1238.752) -- 0:00:45 307000 -- (-1242.295) (-1238.751) (-1242.705) [-1238.009] * [-1240.076] (-1241.632) (-1238.206) (-1239.380) -- 0:00:45 307500 -- (-1241.096) (-1241.224) (-1239.985) [-1241.886] * (-1240.420) [-1239.909] (-1239.384) (-1239.478) -- 0:00:45 308000 -- (-1237.528) [-1241.691] (-1238.412) (-1241.806) * [-1240.233] (-1237.697) (-1238.442) (-1240.669) -- 0:00:44 308500 -- [-1237.532] (-1241.511) (-1242.812) (-1243.678) * (-1239.332) [-1239.028] (-1242.943) (-1238.469) -- 0:00:44 309000 -- (-1237.495) [-1237.917] (-1239.904) (-1241.515) * [-1239.025] (-1245.838) (-1246.535) (-1239.435) -- 0:00:44 309500 -- (-1237.702) (-1241.130) (-1240.820) [-1242.200] * [-1238.262] (-1238.996) (-1243.606) (-1240.500) -- 0:00:44 310000 -- (-1240.642) [-1241.444] (-1239.362) (-1240.303) * (-1239.188) (-1238.325) [-1240.588] (-1239.049) -- 0:00:44 Average standard deviation of split frequencies: 0.012729 310500 -- (-1239.722) [-1240.919] (-1238.800) (-1238.839) * (-1241.769) (-1238.292) [-1238.434] (-1239.802) -- 0:00:44 311000 -- (-1238.492) (-1239.483) [-1237.803] (-1239.115) * (-1238.958) [-1239.763] (-1239.949) (-1238.523) -- 0:00:44 311500 -- (-1239.369) (-1244.323) (-1238.294) [-1240.112] * (-1239.005) [-1241.492] (-1241.461) (-1239.228) -- 0:00:46 312000 -- [-1243.517] (-1239.572) (-1239.258) (-1241.498) * (-1239.569) [-1244.926] (-1242.534) (-1240.604) -- 0:00:46 312500 -- (-1241.360) (-1241.074) [-1238.534] (-1238.171) * (-1239.180) [-1238.164] (-1238.597) (-1239.189) -- 0:00:46 313000 -- (-1240.353) (-1239.420) (-1238.815) [-1237.687] * (-1239.180) [-1238.519] (-1242.825) (-1238.807) -- 0:00:46 313500 -- (-1239.926) [-1240.403] (-1239.506) (-1242.619) * (-1241.007) (-1238.197) (-1238.720) [-1238.220] -- 0:00:45 314000 -- (-1238.488) (-1239.022) (-1239.750) [-1239.640] * [-1239.970] (-1237.708) (-1240.090) (-1238.883) -- 0:00:45 314500 -- (-1240.016) (-1238.367) (-1239.904) [-1239.898] * (-1240.784) (-1238.964) (-1239.521) [-1238.210] -- 0:00:45 315000 -- (-1238.445) [-1238.467] (-1238.930) (-1243.790) * [-1239.188] (-1240.192) (-1240.795) (-1240.000) -- 0:00:45 Average standard deviation of split frequencies: 0.012680 315500 -- (-1244.539) (-1237.476) [-1237.430] (-1239.015) * [-1237.649] (-1240.826) (-1239.220) (-1242.417) -- 0:00:45 316000 -- (-1241.716) [-1240.905] (-1239.455) (-1239.567) * [-1239.313] (-1238.197) (-1241.058) (-1240.794) -- 0:00:45 316500 -- [-1239.166] (-1241.889) (-1240.284) (-1238.543) * (-1238.488) [-1238.678] (-1240.617) (-1238.793) -- 0:00:45 317000 -- [-1239.891] (-1239.049) (-1242.158) (-1239.160) * (-1240.527) (-1245.887) [-1239.424] (-1237.547) -- 0:00:45 317500 -- (-1239.961) [-1239.959] (-1239.571) (-1242.167) * (-1240.776) (-1243.657) (-1239.811) [-1238.415] -- 0:00:45 318000 -- (-1239.905) [-1240.028] (-1247.514) (-1238.948) * (-1241.953) (-1241.123) (-1238.290) [-1238.717] -- 0:00:45 318500 -- (-1244.439) (-1238.362) (-1238.461) [-1239.934] * [-1241.343] (-1239.388) (-1238.285) (-1241.318) -- 0:00:44 319000 -- (-1243.204) [-1238.334] (-1239.839) (-1240.243) * (-1240.276) (-1245.449) [-1238.875] (-1237.856) -- 0:00:44 319500 -- (-1240.672) (-1239.786) (-1237.950) [-1241.908] * [-1238.574] (-1239.754) (-1238.795) (-1238.992) -- 0:00:44 320000 -- (-1237.739) [-1238.812] (-1242.559) (-1239.940) * (-1243.204) (-1239.603) (-1239.764) [-1239.494] -- 0:00:44 Average standard deviation of split frequencies: 0.011242 320500 -- (-1240.183) (-1238.441) [-1237.197] (-1238.339) * (-1239.458) (-1238.815) (-1243.282) [-1237.488] -- 0:00:44 321000 -- [-1237.592] (-1239.752) (-1241.254) (-1237.971) * (-1239.603) [-1241.786] (-1245.061) (-1237.876) -- 0:00:44 321500 -- (-1237.585) [-1239.786] (-1239.267) (-1239.357) * [-1238.897] (-1242.875) (-1239.082) (-1238.710) -- 0:00:44 322000 -- [-1237.680] (-1240.167) (-1241.736) (-1239.511) * (-1238.362) [-1243.233] (-1240.325) (-1240.059) -- 0:00:44 322500 -- (-1237.483) (-1238.788) (-1242.838) [-1240.063] * (-1238.268) (-1239.034) [-1239.720] (-1242.748) -- 0:00:44 323000 -- (-1237.636) (-1241.748) (-1237.240) [-1238.339] * (-1237.459) (-1238.267) (-1239.352) [-1237.836] -- 0:00:44 323500 -- (-1244.572) (-1238.352) [-1238.971] (-1237.855) * (-1238.131) (-1242.572) (-1240.118) [-1237.816] -- 0:00:43 324000 -- (-1238.008) (-1239.872) (-1242.153) [-1239.565] * (-1240.447) (-1239.927) [-1238.413] (-1238.011) -- 0:00:43 324500 -- (-1239.646) [-1238.070] (-1241.565) (-1239.604) * (-1240.008) (-1238.220) [-1240.922] (-1240.542) -- 0:00:43 325000 -- [-1237.795] (-1239.798) (-1242.328) (-1239.915) * (-1241.103) (-1240.625) (-1237.206) [-1239.319] -- 0:00:43 Average standard deviation of split frequencies: 0.012177 325500 -- (-1238.784) (-1239.223) (-1239.817) [-1238.263] * (-1241.552) [-1237.510] (-1237.847) (-1239.457) -- 0:00:43 326000 -- [-1238.158] (-1239.571) (-1238.581) (-1239.440) * (-1241.454) (-1238.481) [-1240.914] (-1242.767) -- 0:00:43 326500 -- [-1238.662] (-1239.567) (-1240.921) (-1238.876) * [-1240.837] (-1237.481) (-1241.497) (-1242.447) -- 0:00:43 327000 -- (-1239.293) [-1239.357] (-1247.083) (-1239.585) * (-1245.110) (-1238.175) [-1237.807] (-1239.185) -- 0:00:43 327500 -- (-1237.872) (-1243.719) (-1240.361) [-1238.401] * (-1239.618) (-1238.993) [-1238.415] (-1240.153) -- 0:00:45 328000 -- [-1240.865] (-1238.756) (-1240.528) (-1241.405) * (-1239.777) [-1239.467] (-1238.292) (-1240.723) -- 0:00:45 328500 -- (-1240.904) [-1238.487] (-1239.950) (-1239.130) * (-1240.889) (-1237.667) [-1237.810] (-1239.331) -- 0:00:44 329000 -- (-1239.489) (-1240.007) (-1245.806) [-1238.251] * (-1240.345) (-1241.595) (-1244.770) [-1239.436] -- 0:00:44 329500 -- (-1237.985) [-1241.025] (-1238.013) (-1239.455) * (-1239.160) (-1237.588) [-1239.884] (-1240.272) -- 0:00:44 330000 -- (-1238.352) (-1240.162) (-1237.406) [-1238.391] * (-1238.440) (-1239.192) (-1239.796) [-1241.265] -- 0:00:44 Average standard deviation of split frequencies: 0.011780 330500 -- (-1237.956) (-1240.138) [-1240.717] (-1239.984) * (-1238.991) [-1239.328] (-1243.198) (-1240.858) -- 0:00:44 331000 -- (-1237.766) [-1238.875] (-1240.743) (-1243.524) * [-1240.696] (-1238.756) (-1242.288) (-1238.719) -- 0:00:44 331500 -- (-1241.729) (-1238.560) [-1237.885] (-1242.652) * (-1239.549) (-1239.594) [-1237.750] (-1238.459) -- 0:00:44 332000 -- (-1242.080) (-1241.699) (-1237.806) [-1239.819] * (-1239.700) [-1239.364] (-1239.149) (-1238.422) -- 0:00:44 332500 -- (-1241.738) [-1240.179] (-1238.517) (-1239.870) * (-1240.802) (-1240.437) (-1239.556) [-1240.331] -- 0:00:44 333000 -- [-1240.793] (-1241.363) (-1239.092) (-1237.807) * (-1241.985) [-1238.318] (-1239.098) (-1245.394) -- 0:00:44 333500 -- [-1238.678] (-1240.412) (-1237.892) (-1238.589) * (-1242.070) (-1240.558) (-1240.571) [-1240.053] -- 0:00:43 334000 -- [-1240.160] (-1240.115) (-1241.276) (-1238.738) * (-1247.707) (-1239.138) [-1238.355] (-1238.430) -- 0:00:43 334500 -- [-1243.436] (-1238.845) (-1241.457) (-1238.123) * (-1241.416) (-1237.470) (-1239.117) [-1239.494] -- 0:00:43 335000 -- (-1241.665) (-1241.196) [-1241.299] (-1237.938) * [-1239.573] (-1237.966) (-1243.086) (-1241.639) -- 0:00:43 Average standard deviation of split frequencies: 0.012049 335500 -- [-1238.835] (-1242.215) (-1240.260) (-1241.408) * [-1237.418] (-1238.205) (-1241.283) (-1238.371) -- 0:00:43 336000 -- [-1240.166] (-1239.161) (-1237.291) (-1238.667) * (-1238.703) (-1243.486) (-1239.205) [-1240.468] -- 0:00:43 336500 -- (-1240.382) [-1240.601] (-1237.779) (-1242.978) * (-1237.484) [-1241.998] (-1240.905) (-1239.550) -- 0:00:43 337000 -- (-1240.844) [-1240.118] (-1237.737) (-1240.567) * (-1241.648) [-1237.972] (-1238.299) (-1242.050) -- 0:00:43 337500 -- [-1239.158] (-1242.560) (-1239.470) (-1238.687) * (-1238.151) (-1238.198) [-1239.508] (-1244.102) -- 0:00:43 338000 -- (-1240.283) (-1242.004) [-1241.086] (-1239.484) * [-1237.818] (-1237.642) (-1239.289) (-1241.213) -- 0:00:43 338500 -- (-1240.036) [-1240.683] (-1237.600) (-1238.106) * (-1238.261) [-1238.450] (-1237.392) (-1240.532) -- 0:00:42 339000 -- [-1240.890] (-1239.456) (-1238.831) (-1237.845) * [-1238.260] (-1244.141) (-1238.463) (-1241.524) -- 0:00:42 339500 -- (-1239.951) [-1240.685] (-1241.132) (-1239.896) * [-1239.590] (-1241.709) (-1237.651) (-1240.412) -- 0:00:42 340000 -- (-1237.988) [-1239.192] (-1246.215) (-1238.157) * (-1239.394) (-1240.609) (-1240.757) [-1239.942] -- 0:00:42 Average standard deviation of split frequencies: 0.013546 340500 -- (-1239.607) [-1242.470] (-1240.001) (-1240.781) * (-1241.223) [-1240.281] (-1238.898) (-1242.274) -- 0:00:42 341000 -- (-1238.507) [-1239.486] (-1239.679) (-1240.412) * (-1240.449) (-1239.599) [-1238.861] (-1241.904) -- 0:00:42 341500 -- (-1241.821) [-1238.536] (-1237.904) (-1239.454) * (-1239.681) (-1239.313) (-1240.267) [-1239.333] -- 0:00:42 342000 -- (-1239.298) [-1238.753] (-1239.583) (-1239.805) * (-1240.290) (-1239.781) [-1242.064] (-1245.047) -- 0:00:42 342500 -- (-1239.390) [-1238.930] (-1241.381) (-1238.987) * (-1239.828) (-1242.222) [-1239.633] (-1246.543) -- 0:00:42 343000 -- (-1239.295) [-1239.758] (-1241.068) (-1240.224) * (-1239.744) [-1240.358] (-1238.425) (-1242.362) -- 0:00:44 343500 -- [-1238.748] (-1238.166) (-1244.611) (-1241.166) * [-1240.124] (-1238.174) (-1237.496) (-1238.576) -- 0:00:43 344000 -- [-1237.996] (-1238.897) (-1244.999) (-1237.018) * [-1238.963] (-1240.630) (-1239.090) (-1238.884) -- 0:00:43 344500 -- (-1239.134) [-1238.867] (-1239.481) (-1240.447) * (-1238.968) (-1238.147) (-1240.643) [-1238.051] -- 0:00:43 345000 -- (-1238.647) (-1238.602) (-1238.274) [-1240.547] * (-1240.808) (-1239.890) [-1237.905] (-1238.558) -- 0:00:43 Average standard deviation of split frequencies: 0.013481 345500 -- [-1239.465] (-1239.184) (-1239.570) (-1239.998) * (-1237.628) [-1238.428] (-1240.061) (-1237.673) -- 0:00:43 346000 -- [-1239.827] (-1239.779) (-1238.994) (-1238.231) * (-1243.507) (-1239.678) [-1240.963] (-1239.480) -- 0:00:43 346500 -- (-1240.576) (-1239.684) [-1238.352] (-1240.242) * (-1243.890) (-1238.734) (-1241.972) [-1242.379] -- 0:00:43 347000 -- (-1241.002) (-1240.348) (-1239.207) [-1238.529] * (-1246.722) [-1240.352] (-1244.363) (-1240.384) -- 0:00:43 347500 -- (-1241.949) (-1243.219) (-1239.550) [-1238.946] * [-1243.708] (-1240.647) (-1240.471) (-1239.151) -- 0:00:43 348000 -- [-1238.228] (-1240.743) (-1239.516) (-1238.874) * [-1242.656] (-1237.176) (-1242.440) (-1239.209) -- 0:00:43 348500 -- (-1240.265) (-1241.331) (-1240.730) [-1237.870] * (-1249.767) (-1238.850) [-1242.633] (-1240.886) -- 0:00:42 349000 -- (-1240.044) [-1237.451] (-1243.085) (-1239.123) * (-1249.353) [-1240.662] (-1240.535) (-1239.054) -- 0:00:42 349500 -- (-1242.040) (-1237.794) (-1239.035) [-1240.748] * (-1245.061) (-1239.841) (-1237.856) [-1238.203] -- 0:00:42 350000 -- (-1241.003) (-1243.779) [-1238.544] (-1238.325) * [-1237.736] (-1238.967) (-1238.328) (-1239.835) -- 0:00:42 Average standard deviation of split frequencies: 0.014563 350500 -- (-1238.428) (-1243.918) [-1238.103] (-1239.109) * (-1240.005) [-1239.143] (-1237.758) (-1240.877) -- 0:00:42 351000 -- (-1238.278) [-1240.432] (-1239.636) (-1239.104) * (-1243.472) [-1239.143] (-1238.272) (-1238.074) -- 0:00:42 351500 -- (-1238.776) (-1240.942) (-1239.312) [-1239.428] * (-1239.776) (-1243.446) [-1240.579] (-1238.228) -- 0:00:42 352000 -- (-1238.598) (-1241.797) [-1237.462] (-1238.258) * [-1241.794] (-1243.687) (-1240.672) (-1238.885) -- 0:00:42 352500 -- [-1238.788] (-1240.774) (-1237.533) (-1239.755) * (-1240.972) [-1240.879] (-1241.149) (-1244.306) -- 0:00:42 353000 -- [-1238.259] (-1242.215) (-1239.329) (-1239.135) * (-1239.929) [-1240.346] (-1239.588) (-1240.939) -- 0:00:42 353500 -- [-1237.815] (-1239.048) (-1238.828) (-1243.089) * (-1238.411) (-1240.583) (-1239.987) [-1239.558] -- 0:00:42 354000 -- (-1238.040) (-1243.305) [-1238.526] (-1239.084) * (-1239.921) [-1239.256] (-1238.751) (-1242.075) -- 0:00:41 354500 -- [-1238.147] (-1243.250) (-1238.372) (-1241.662) * (-1238.582) (-1237.877) [-1238.386] (-1240.663) -- 0:00:41 355000 -- [-1238.694] (-1240.006) (-1238.362) (-1242.183) * (-1238.127) (-1238.429) (-1238.649) [-1239.316] -- 0:00:41 Average standard deviation of split frequencies: 0.014345 355500 -- (-1240.551) [-1239.143] (-1238.682) (-1240.599) * (-1239.257) (-1238.527) (-1238.263) [-1238.709] -- 0:00:41 356000 -- (-1243.146) (-1237.785) (-1239.434) [-1237.195] * (-1238.036) [-1239.206] (-1237.591) (-1238.326) -- 0:00:41 356500 -- (-1243.034) [-1237.957] (-1239.289) (-1238.579) * (-1238.909) (-1240.107) (-1240.186) [-1237.470] -- 0:00:41 357000 -- [-1239.433] (-1241.251) (-1241.035) (-1237.615) * (-1238.912) (-1239.735) (-1238.313) [-1238.145] -- 0:00:41 357500 -- (-1239.572) (-1240.704) [-1243.223] (-1240.619) * (-1240.631) (-1239.595) [-1238.382] (-1238.997) -- 0:00:41 358000 -- (-1237.910) (-1239.320) (-1239.056) [-1238.260] * [-1242.089] (-1238.858) (-1238.646) (-1238.257) -- 0:00:41 358500 -- [-1239.288] (-1237.455) (-1237.992) (-1238.765) * (-1241.340) [-1238.975] (-1241.718) (-1239.312) -- 0:00:41 359000 -- (-1237.553) (-1239.858) (-1238.879) [-1241.168] * (-1240.141) [-1240.382] (-1239.344) (-1238.704) -- 0:00:42 359500 -- [-1239.282] (-1243.268) (-1239.155) (-1240.814) * [-1237.492] (-1240.748) (-1239.750) (-1238.956) -- 0:00:42 360000 -- (-1237.358) (-1238.562) (-1240.835) [-1238.588] * (-1237.299) (-1239.797) (-1240.911) [-1238.230] -- 0:00:42 Average standard deviation of split frequencies: 0.015146 360500 -- [-1238.837] (-1241.809) (-1240.581) (-1237.753) * (-1238.645) (-1239.545) (-1237.584) [-1241.108] -- 0:00:42 361000 -- (-1239.094) (-1242.111) (-1238.224) [-1238.680] * (-1240.402) [-1238.662] (-1239.474) (-1242.458) -- 0:00:42 361500 -- (-1239.971) [-1240.213] (-1240.141) (-1239.363) * (-1238.901) (-1240.030) (-1238.071) [-1240.844] -- 0:00:42 362000 -- (-1240.695) [-1238.140] (-1242.067) (-1238.602) * (-1238.599) [-1239.279] (-1241.740) (-1243.800) -- 0:00:42 362500 -- (-1249.591) (-1242.163) [-1242.499] (-1241.072) * (-1243.154) (-1240.829) [-1239.777] (-1239.255) -- 0:00:42 363000 -- (-1239.727) (-1237.694) (-1238.458) [-1239.900] * [-1239.034] (-1238.989) (-1239.781) (-1238.985) -- 0:00:42 363500 -- (-1242.443) (-1239.970) (-1238.210) [-1237.877] * (-1238.499) [-1238.668] (-1245.588) (-1240.181) -- 0:00:42 364000 -- (-1238.417) [-1240.913] (-1239.060) (-1238.477) * [-1238.563] (-1238.686) (-1238.215) (-1240.769) -- 0:00:41 364500 -- (-1239.423) [-1237.580] (-1241.344) (-1238.421) * (-1240.585) (-1238.856) [-1241.942] (-1242.791) -- 0:00:41 365000 -- (-1241.551) [-1238.895] (-1239.523) (-1237.709) * (-1239.548) (-1244.112) [-1239.343] (-1242.189) -- 0:00:41 Average standard deviation of split frequencies: 0.016171 365500 -- (-1239.546) (-1237.849) [-1238.112] (-1237.623) * (-1239.626) (-1247.391) (-1238.398) [-1238.953] -- 0:00:41 366000 -- (-1240.909) (-1237.876) (-1238.233) [-1237.545] * (-1240.709) (-1245.440) (-1238.762) [-1239.019] -- 0:00:41 366500 -- (-1238.666) (-1243.959) (-1237.764) [-1238.114] * (-1238.715) [-1239.755] (-1238.236) (-1238.556) -- 0:00:41 367000 -- (-1239.654) (-1239.044) [-1237.135] (-1239.170) * [-1240.895] (-1242.960) (-1238.056) (-1239.229) -- 0:00:41 367500 -- (-1239.911) (-1238.223) [-1238.544] (-1239.871) * (-1241.631) (-1240.200) [-1238.425] (-1239.292) -- 0:00:41 368000 -- (-1238.802) (-1240.147) (-1238.485) [-1238.103] * (-1241.326) [-1239.218] (-1238.034) (-1243.094) -- 0:00:41 368500 -- (-1243.471) (-1239.302) (-1239.819) [-1238.103] * [-1241.068] (-1240.718) (-1241.139) (-1243.489) -- 0:00:41 369000 -- (-1238.274) (-1240.343) [-1238.347] (-1238.229) * (-1238.076) [-1238.188] (-1241.042) (-1240.471) -- 0:00:41 369500 -- [-1239.594] (-1238.894) (-1243.210) (-1239.090) * (-1240.281) [-1240.510] (-1238.623) (-1243.958) -- 0:00:40 370000 -- [-1238.943] (-1242.365) (-1240.748) (-1238.980) * (-1240.212) [-1238.116] (-1241.914) (-1237.766) -- 0:00:40 Average standard deviation of split frequencies: 0.015561 370500 -- (-1240.978) (-1241.690) [-1239.795] (-1239.361) * [-1238.148] (-1239.416) (-1241.069) (-1240.733) -- 0:00:40 371000 -- (-1238.726) [-1239.326] (-1240.200) (-1239.130) * (-1239.478) (-1240.330) (-1238.021) [-1238.895] -- 0:00:40 371500 -- (-1237.942) (-1240.486) (-1239.615) [-1239.257] * (-1240.720) [-1244.108] (-1238.127) (-1239.968) -- 0:00:40 372000 -- (-1237.943) (-1240.186) [-1237.420] (-1240.709) * (-1251.013) (-1240.168) (-1237.763) [-1241.866] -- 0:00:40 372500 -- (-1240.320) (-1240.972) [-1237.440] (-1238.387) * [-1241.877] (-1240.806) (-1237.799) (-1241.885) -- 0:00:40 373000 -- (-1238.014) (-1240.434) [-1239.884] (-1239.286) * (-1238.617) (-1242.631) [-1241.787] (-1238.564) -- 0:00:40 373500 -- (-1237.861) (-1238.635) [-1238.840] (-1237.867) * (-1239.225) (-1238.880) (-1238.210) [-1239.918] -- 0:00:40 374000 -- [-1240.224] (-1242.351) (-1240.598) (-1238.515) * (-1238.380) (-1242.390) [-1239.167] (-1241.760) -- 0:00:40 374500 -- [-1239.554] (-1240.343) (-1240.108) (-1239.929) * (-1238.867) (-1239.131) [-1238.881] (-1238.144) -- 0:00:40 375000 -- (-1240.264) (-1246.206) (-1241.802) [-1239.240] * [-1238.540] (-1238.546) (-1237.643) (-1237.563) -- 0:00:40 Average standard deviation of split frequencies: 0.016159 375500 -- (-1241.118) (-1244.020) [-1239.699] (-1240.812) * [-1238.517] (-1248.287) (-1238.622) (-1240.084) -- 0:00:41 376000 -- (-1242.038) (-1242.651) [-1238.819] (-1241.626) * (-1238.546) (-1242.049) (-1239.589) [-1237.939] -- 0:00:41 376500 -- (-1239.582) (-1242.895) [-1237.866] (-1241.493) * (-1239.534) (-1238.052) [-1239.382] (-1237.705) -- 0:00:41 377000 -- [-1238.356] (-1239.241) (-1237.219) (-1242.035) * [-1237.943] (-1241.686) (-1240.083) (-1238.186) -- 0:00:41 377500 -- (-1237.845) (-1237.716) [-1238.182] (-1237.964) * (-1239.079) [-1240.545] (-1239.143) (-1238.186) -- 0:00:41 378000 -- (-1237.397) (-1242.099) (-1238.616) [-1237.813] * (-1237.882) (-1238.996) (-1242.952) [-1237.440] -- 0:00:41 378500 -- (-1238.263) (-1239.096) [-1238.868] (-1239.925) * (-1239.131) (-1239.656) (-1237.646) [-1241.395] -- 0:00:41 379000 -- (-1239.377) (-1238.741) [-1238.014] (-1239.838) * [-1240.120] (-1240.151) (-1237.989) (-1243.043) -- 0:00:40 379500 -- [-1241.525] (-1242.379) (-1238.697) (-1241.013) * (-1239.427) (-1246.094) (-1240.328) [-1237.352] -- 0:00:40 380000 -- (-1240.580) (-1237.551) [-1238.312] (-1243.650) * (-1239.357) (-1241.668) [-1239.438] (-1237.573) -- 0:00:40 Average standard deviation of split frequencies: 0.015617 380500 -- (-1242.876) (-1237.940) [-1240.619] (-1241.206) * (-1238.151) [-1243.382] (-1238.318) (-1239.079) -- 0:00:40 381000 -- (-1239.119) [-1238.941] (-1237.180) (-1238.313) * (-1241.294) [-1237.655] (-1238.815) (-1239.026) -- 0:00:40 381500 -- (-1239.115) [-1238.679] (-1237.542) (-1238.245) * (-1244.078) (-1240.632) [-1239.250] (-1238.543) -- 0:00:40 382000 -- (-1246.668) (-1238.720) [-1237.542] (-1239.584) * (-1243.945) (-1237.825) [-1237.982] (-1240.615) -- 0:00:40 382500 -- (-1237.761) (-1239.201) [-1237.283] (-1238.440) * (-1238.956) (-1237.719) [-1241.511] (-1241.389) -- 0:00:40 383000 -- (-1238.660) (-1239.264) [-1238.507] (-1240.002) * [-1243.980] (-1238.707) (-1238.487) (-1243.784) -- 0:00:40 383500 -- (-1242.125) (-1238.880) [-1237.688] (-1242.822) * (-1244.631) (-1237.877) [-1242.281] (-1244.124) -- 0:00:40 384000 -- (-1240.493) (-1238.065) [-1239.823] (-1244.759) * (-1239.231) [-1246.350] (-1242.912) (-1242.693) -- 0:00:40 384500 -- (-1242.685) (-1238.127) [-1240.149] (-1240.050) * (-1238.431) (-1240.970) (-1242.764) [-1239.210] -- 0:00:40 385000 -- (-1241.547) (-1237.409) (-1244.791) [-1242.505] * [-1238.357] (-1239.504) (-1237.637) (-1237.407) -- 0:00:39 Average standard deviation of split frequencies: 0.015401 385500 -- [-1239.107] (-1237.672) (-1241.439) (-1239.160) * (-1239.424) (-1237.278) [-1238.713] (-1238.236) -- 0:00:39 386000 -- [-1241.615] (-1243.245) (-1240.785) (-1237.636) * (-1237.992) (-1238.656) [-1237.594] (-1238.484) -- 0:00:39 386500 -- (-1239.291) [-1239.385] (-1238.726) (-1237.587) * (-1238.958) [-1241.386] (-1238.779) (-1241.489) -- 0:00:39 387000 -- (-1237.455) (-1242.393) [-1239.895] (-1239.053) * (-1240.609) [-1241.988] (-1243.073) (-1241.099) -- 0:00:39 387500 -- [-1238.327] (-1242.540) (-1242.700) (-1237.427) * (-1240.887) (-1242.636) (-1240.517) [-1237.536] -- 0:00:39 388000 -- (-1239.825) [-1239.654] (-1241.350) (-1237.907) * (-1239.902) [-1237.965] (-1240.628) (-1238.006) -- 0:00:39 388500 -- (-1239.986) [-1238.919] (-1238.653) (-1239.048) * (-1238.221) (-1240.614) [-1240.120] (-1238.168) -- 0:00:39 389000 -- (-1240.690) (-1243.203) (-1239.316) [-1239.122] * (-1240.404) (-1240.178) [-1240.081] (-1239.784) -- 0:00:39 389500 -- (-1238.573) (-1242.318) (-1239.582) [-1239.129] * (-1240.032) [-1237.425] (-1240.662) (-1241.335) -- 0:00:39 390000 -- (-1238.312) (-1242.288) [-1238.617] (-1239.479) * (-1238.203) (-1240.136) [-1238.111] (-1239.683) -- 0:00:39 Average standard deviation of split frequencies: 0.015821 390500 -- [-1238.920] (-1239.842) (-1240.507) (-1242.361) * (-1240.942) [-1239.956] (-1237.848) (-1238.580) -- 0:00:39 391000 -- [-1239.992] (-1242.864) (-1244.999) (-1241.891) * (-1239.636) (-1239.894) (-1239.008) [-1237.919] -- 0:00:40 391500 -- (-1238.503) (-1240.955) (-1241.893) [-1238.868] * (-1239.340) (-1238.826) [-1238.207] (-1242.121) -- 0:00:40 392000 -- (-1238.737) [-1238.086] (-1241.391) (-1238.391) * (-1238.131) (-1237.542) (-1241.820) [-1237.730] -- 0:00:40 392500 -- [-1238.294] (-1238.652) (-1241.147) (-1240.045) * (-1240.268) (-1240.237) [-1239.076] (-1238.061) -- 0:00:40 393000 -- (-1241.351) (-1240.612) (-1241.605) [-1240.988] * (-1238.163) (-1238.941) (-1238.124) [-1239.802] -- 0:00:40 393500 -- (-1239.528) (-1238.648) (-1239.229) [-1241.299] * [-1239.334] (-1238.971) (-1238.598) (-1240.093) -- 0:00:40 394000 -- (-1238.795) (-1238.148) [-1240.809] (-1240.235) * (-1240.304) [-1238.403] (-1240.592) (-1238.412) -- 0:00:39 394500 -- (-1240.839) (-1239.317) (-1239.160) [-1237.656] * (-1238.401) (-1239.227) (-1238.381) [-1239.173] -- 0:00:39 395000 -- (-1240.499) (-1240.547) [-1239.009] (-1241.192) * (-1237.936) (-1239.452) [-1240.099] (-1237.404) -- 0:00:39 Average standard deviation of split frequencies: 0.015872 395500 -- (-1238.313) (-1240.761) [-1244.531] (-1238.671) * (-1238.048) (-1238.503) (-1240.255) [-1238.417] -- 0:00:39 396000 -- [-1238.772] (-1237.776) (-1240.225) (-1238.256) * (-1239.516) (-1238.786) (-1238.897) [-1237.230] -- 0:00:39 396500 -- (-1240.720) (-1237.850) (-1239.926) [-1237.634] * (-1240.075) (-1237.671) [-1237.574] (-1237.079) -- 0:00:39 397000 -- (-1244.160) [-1239.125] (-1238.823) (-1237.410) * (-1238.452) [-1238.086] (-1239.296) (-1237.076) -- 0:00:39 397500 -- (-1239.415) (-1242.851) [-1240.563] (-1238.020) * [-1240.235] (-1239.228) (-1239.279) (-1238.953) -- 0:00:39 398000 -- (-1241.464) (-1240.086) (-1242.103) [-1239.577] * (-1240.104) (-1241.636) [-1237.658] (-1237.050) -- 0:00:39 398500 -- [-1239.488] (-1241.163) (-1239.801) (-1238.946) * [-1244.225] (-1239.859) (-1242.890) (-1239.364) -- 0:00:39 399000 -- (-1239.578) (-1240.060) (-1244.782) [-1239.138] * (-1241.466) (-1239.941) [-1240.534] (-1237.605) -- 0:00:39 399500 -- [-1239.248] (-1240.677) (-1239.211) (-1241.477) * [-1241.285] (-1240.905) (-1241.872) (-1237.605) -- 0:00:39 400000 -- (-1243.638) [-1237.731] (-1239.802) (-1245.268) * (-1241.033) (-1243.304) [-1239.131] (-1238.047) -- 0:00:39 Average standard deviation of split frequencies: 0.015622 400500 -- (-1239.788) [-1239.811] (-1240.552) (-1243.371) * [-1238.372] (-1238.095) (-1238.505) (-1237.619) -- 0:00:38 401000 -- (-1244.362) [-1238.627] (-1241.082) (-1244.343) * (-1238.190) (-1241.390) [-1237.745] (-1241.496) -- 0:00:38 401500 -- [-1238.967] (-1239.295) (-1240.666) (-1240.644) * (-1238.228) (-1239.121) [-1238.422] (-1242.129) -- 0:00:38 402000 -- (-1238.779) (-1241.024) (-1240.390) [-1238.153] * (-1239.807) (-1241.330) [-1238.375] (-1242.068) -- 0:00:38 402500 -- (-1240.250) (-1238.510) (-1239.115) [-1239.058] * [-1240.013] (-1238.897) (-1237.566) (-1238.553) -- 0:00:38 403000 -- (-1238.346) [-1238.266] (-1239.350) (-1240.971) * (-1237.913) [-1239.090] (-1237.862) (-1238.154) -- 0:00:38 403500 -- (-1239.663) (-1237.811) [-1238.775] (-1241.539) * (-1239.428) (-1240.002) [-1237.881] (-1238.024) -- 0:00:38 404000 -- (-1241.843) (-1239.142) (-1238.676) [-1240.441] * (-1237.483) [-1238.739] (-1240.670) (-1239.385) -- 0:00:38 404500 -- [-1242.195] (-1238.996) (-1241.577) (-1239.492) * [-1238.724] (-1239.809) (-1240.412) (-1239.843) -- 0:00:38 405000 -- (-1239.953) (-1238.507) [-1239.641] (-1243.683) * (-1244.738) [-1237.799] (-1240.591) (-1238.687) -- 0:00:38 Average standard deviation of split frequencies: 0.016194 405500 -- [-1238.658] (-1239.256) (-1239.602) (-1239.627) * (-1244.069) (-1237.500) (-1240.591) [-1238.687] -- 0:00:38 406000 -- (-1241.457) (-1241.381) [-1237.937] (-1240.252) * (-1239.047) (-1237.835) [-1242.431] (-1239.549) -- 0:00:38 406500 -- (-1241.347) (-1238.522) [-1241.289] (-1238.911) * (-1237.243) (-1237.330) [-1238.498] (-1238.442) -- 0:00:37 407000 -- (-1241.453) (-1241.998) (-1239.053) [-1238.302] * [-1238.312] (-1239.334) (-1237.947) (-1239.326) -- 0:00:39 407500 -- (-1241.806) [-1242.467] (-1237.738) (-1238.276) * (-1237.301) (-1242.295) [-1237.785] (-1239.247) -- 0:00:39 408000 -- [-1239.190] (-1239.169) (-1238.857) (-1238.493) * (-1238.167) [-1237.965] (-1239.877) (-1238.674) -- 0:00:39 408500 -- (-1237.335) [-1238.430] (-1239.160) (-1238.704) * (-1238.648) (-1237.900) [-1240.087] (-1238.295) -- 0:00:39 409000 -- (-1241.272) [-1241.569] (-1239.918) (-1238.340) * (-1239.400) (-1237.900) [-1238.243] (-1239.288) -- 0:00:39 409500 -- [-1239.358] (-1238.807) (-1241.942) (-1240.071) * [-1242.357] (-1237.686) (-1238.132) (-1237.852) -- 0:00:38 410000 -- (-1239.657) (-1238.851) [-1244.067] (-1241.861) * (-1242.108) [-1238.198] (-1238.455) (-1237.232) -- 0:00:38 Average standard deviation of split frequencies: 0.016581 410500 -- (-1240.111) [-1237.768] (-1242.678) (-1238.861) * [-1241.019] (-1239.081) (-1238.999) (-1237.261) -- 0:00:38 411000 -- (-1241.401) (-1240.482) (-1239.524) [-1241.121] * [-1239.638] (-1238.340) (-1238.240) (-1238.216) -- 0:00:38 411500 -- [-1241.689] (-1238.848) (-1238.262) (-1239.275) * (-1239.164) (-1240.469) [-1238.876] (-1238.472) -- 0:00:38 412000 -- (-1239.359) [-1239.601] (-1242.221) (-1241.089) * (-1238.965) (-1242.963) [-1239.566] (-1237.665) -- 0:00:38 412500 -- [-1238.678] (-1238.292) (-1239.923) (-1238.410) * (-1239.336) (-1240.171) [-1237.781] (-1237.194) -- 0:00:38 413000 -- (-1241.348) (-1239.346) (-1240.337) [-1238.560] * (-1237.281) (-1240.455) (-1238.964) [-1239.425] -- 0:00:38 413500 -- (-1238.625) [-1239.251] (-1242.161) (-1243.412) * [-1237.321] (-1242.205) (-1240.371) (-1238.050) -- 0:00:38 414000 -- (-1238.703) (-1238.934) [-1241.120] (-1240.088) * (-1242.203) (-1239.396) [-1240.123] (-1240.627) -- 0:00:38 414500 -- [-1241.247] (-1237.231) (-1238.001) (-1241.074) * (-1237.635) [-1239.496] (-1238.055) (-1241.127) -- 0:00:38 415000 -- (-1238.103) (-1238.059) [-1238.750] (-1237.741) * (-1237.423) [-1237.552] (-1239.106) (-1240.061) -- 0:00:38 Average standard deviation of split frequencies: 0.016242 415500 -- [-1238.998] (-1239.665) (-1237.774) (-1238.348) * [-1237.909] (-1238.383) (-1241.767) (-1241.070) -- 0:00:37 416000 -- (-1238.524) [-1241.627] (-1238.017) (-1238.329) * (-1237.838) (-1239.386) [-1239.377] (-1241.358) -- 0:00:37 416500 -- (-1241.705) (-1238.886) [-1238.120] (-1239.980) * (-1237.919) (-1239.063) [-1240.005] (-1238.782) -- 0:00:37 417000 -- [-1238.886] (-1240.836) (-1239.466) (-1238.881) * (-1237.200) [-1239.121] (-1239.980) (-1238.281) -- 0:00:37 417500 -- (-1242.240) (-1239.997) [-1237.616] (-1238.612) * (-1237.200) (-1239.694) [-1238.242] (-1241.999) -- 0:00:37 418000 -- (-1241.255) (-1239.158) (-1237.955) [-1237.741] * (-1239.984) (-1238.815) [-1239.617] (-1238.812) -- 0:00:37 418500 -- (-1239.443) [-1238.523] (-1238.631) (-1239.720) * (-1240.717) (-1239.274) (-1240.310) [-1239.723] -- 0:00:37 419000 -- (-1237.337) (-1241.464) (-1240.424) [-1240.563] * (-1242.869) (-1240.238) (-1241.206) [-1238.306] -- 0:00:37 419500 -- (-1238.798) (-1241.421) [-1241.494] (-1241.121) * [-1241.159] (-1239.323) (-1238.660) (-1238.760) -- 0:00:37 420000 -- (-1238.590) (-1241.480) (-1242.947) [-1238.834] * (-1240.904) (-1237.727) (-1239.455) [-1238.745] -- 0:00:37 Average standard deviation of split frequencies: 0.016311 420500 -- (-1239.680) (-1238.518) [-1243.008] (-1239.476) * (-1242.114) (-1237.703) [-1240.202] (-1238.879) -- 0:00:37 421000 -- [-1238.530] (-1240.448) (-1241.874) (-1238.298) * (-1244.343) [-1239.879] (-1241.535) (-1238.452) -- 0:00:37 421500 -- (-1240.078) [-1241.452] (-1240.528) (-1244.333) * (-1241.205) (-1238.721) [-1239.844] (-1239.035) -- 0:00:37 422000 -- (-1238.799) (-1238.065) [-1238.966] (-1237.660) * (-1239.548) (-1239.636) (-1244.725) [-1238.159] -- 0:00:36 422500 -- (-1245.580) (-1238.851) [-1238.332] (-1237.579) * (-1242.247) (-1239.264) (-1240.683) [-1237.942] -- 0:00:36 423000 -- (-1242.030) [-1239.592] (-1237.246) (-1239.617) * (-1240.490) [-1239.356] (-1237.692) (-1240.605) -- 0:00:36 423500 -- [-1240.902] (-1239.465) (-1238.172) (-1237.803) * [-1240.088] (-1238.505) (-1238.513) (-1241.298) -- 0:00:38 424000 -- (-1237.214) (-1243.935) (-1240.235) [-1237.787] * [-1238.817] (-1239.410) (-1238.501) (-1239.608) -- 0:00:38 424500 -- (-1237.232) (-1238.355) [-1240.372] (-1237.799) * (-1239.217) [-1238.599] (-1240.021) (-1239.045) -- 0:00:37 425000 -- [-1237.353] (-1237.619) (-1241.930) (-1238.718) * [-1240.450] (-1238.602) (-1239.560) (-1241.206) -- 0:00:37 Average standard deviation of split frequencies: 0.016906 425500 -- [-1240.090] (-1239.326) (-1241.150) (-1237.771) * (-1239.499) (-1239.387) (-1240.909) [-1240.499] -- 0:00:37 426000 -- (-1238.379) (-1240.459) (-1240.928) [-1238.025] * [-1238.593] (-1238.142) (-1241.844) (-1240.722) -- 0:00:37 426500 -- [-1239.406] (-1241.016) (-1239.773) (-1241.145) * (-1240.274) [-1238.175] (-1238.511) (-1239.834) -- 0:00:37 427000 -- (-1238.595) [-1239.858] (-1238.460) (-1239.946) * [-1241.524] (-1241.510) (-1240.181) (-1239.228) -- 0:00:37 427500 -- [-1238.673] (-1239.840) (-1238.111) (-1240.407) * (-1239.668) (-1240.151) [-1239.069] (-1240.944) -- 0:00:37 428000 -- (-1239.514) (-1244.032) (-1241.129) [-1239.167] * [-1238.750] (-1240.286) (-1240.617) (-1241.141) -- 0:00:37 428500 -- (-1239.381) (-1239.519) (-1238.141) [-1237.927] * [-1238.606] (-1240.220) (-1239.467) (-1239.835) -- 0:00:37 429000 -- (-1238.939) [-1238.486] (-1238.313) (-1238.741) * (-1239.149) (-1238.347) [-1240.433] (-1244.387) -- 0:00:37 429500 -- [-1239.375] (-1240.635) (-1238.474) (-1240.711) * [-1239.470] (-1240.569) (-1242.734) (-1238.519) -- 0:00:37 430000 -- (-1238.684) [-1240.458] (-1239.363) (-1239.319) * (-1237.586) (-1240.912) (-1240.382) [-1237.749] -- 0:00:37 Average standard deviation of split frequencies: 0.017283 430500 -- (-1238.760) (-1239.651) [-1238.604] (-1239.146) * (-1242.616) (-1240.228) (-1238.280) [-1240.907] -- 0:00:37 431000 -- (-1239.425) (-1239.141) (-1238.622) [-1237.382] * [-1243.006] (-1240.488) (-1243.038) (-1238.286) -- 0:00:36 431500 -- [-1240.401] (-1238.747) (-1239.083) (-1240.837) * (-1243.474) (-1237.360) [-1241.381] (-1237.533) -- 0:00:36 432000 -- (-1239.293) [-1238.950] (-1239.859) (-1239.548) * (-1238.002) [-1237.655] (-1241.618) (-1240.194) -- 0:00:36 432500 -- (-1239.235) (-1239.970) (-1244.363) [-1239.321] * (-1240.918) (-1237.556) (-1238.937) [-1237.956] -- 0:00:36 433000 -- (-1238.785) (-1240.862) (-1240.504) [-1241.028] * (-1239.094) [-1237.969] (-1240.916) (-1238.328) -- 0:00:36 433500 -- [-1238.872] (-1240.417) (-1238.822) (-1241.886) * (-1239.274) (-1239.261) (-1238.911) [-1238.109] -- 0:00:36 434000 -- [-1240.226] (-1241.316) (-1244.171) (-1239.048) * [-1241.005] (-1238.290) (-1238.743) (-1238.332) -- 0:00:36 434500 -- (-1241.151) (-1242.537) (-1246.515) [-1239.913] * (-1238.900) (-1237.910) (-1239.027) [-1239.490] -- 0:00:36 435000 -- (-1237.634) [-1238.969] (-1239.862) (-1238.820) * (-1241.392) (-1238.182) [-1238.820] (-1238.235) -- 0:00:36 Average standard deviation of split frequencies: 0.017359 435500 -- [-1237.732] (-1238.855) (-1246.809) (-1242.685) * [-1237.474] (-1239.481) (-1238.313) (-1240.775) -- 0:00:36 436000 -- (-1237.140) (-1238.363) [-1241.708] (-1243.756) * [-1238.365] (-1238.225) (-1238.876) (-1240.882) -- 0:00:36 436500 -- (-1237.706) (-1238.063) (-1239.255) [-1238.691] * (-1238.124) (-1243.268) [-1240.475] (-1237.845) -- 0:00:36 437000 -- (-1239.508) [-1238.771] (-1238.487) (-1238.732) * [-1241.795] (-1239.408) (-1239.069) (-1240.288) -- 0:00:36 437500 -- (-1240.120) [-1239.052] (-1237.692) (-1239.117) * (-1239.824) [-1239.131] (-1237.778) (-1243.190) -- 0:00:36 438000 -- (-1239.955) (-1238.033) [-1237.471] (-1239.193) * [-1240.448] (-1240.612) (-1237.853) (-1244.386) -- 0:00:35 438500 -- (-1238.082) (-1241.280) (-1238.854) [-1240.644] * (-1239.807) [-1240.103] (-1240.522) (-1239.510) -- 0:00:35 439000 -- [-1238.062] (-1238.188) (-1238.951) (-1238.858) * [-1238.179] (-1240.271) (-1240.532) (-1242.128) -- 0:00:35 439500 -- (-1238.296) [-1239.249] (-1238.137) (-1238.312) * [-1238.590] (-1241.285) (-1243.910) (-1242.019) -- 0:00:36 440000 -- (-1239.773) (-1237.789) [-1238.217] (-1239.909) * (-1241.620) (-1241.577) (-1241.349) [-1238.371] -- 0:00:36 Average standard deviation of split frequencies: 0.017532 440500 -- (-1240.685) (-1239.542) [-1240.220] (-1241.374) * (-1239.410) [-1238.097] (-1239.265) (-1241.490) -- 0:00:36 441000 -- (-1241.271) (-1240.809) [-1239.791] (-1240.542) * (-1238.112) [-1240.600] (-1238.927) (-1239.791) -- 0:00:36 441500 -- [-1242.438] (-1241.656) (-1240.535) (-1239.597) * (-1238.149) [-1239.529] (-1239.478) (-1237.813) -- 0:00:36 442000 -- (-1237.744) [-1241.101] (-1239.225) (-1238.623) * (-1238.447) [-1239.505] (-1240.203) (-1241.010) -- 0:00:36 442500 -- (-1237.861) [-1239.536] (-1243.785) (-1244.010) * [-1243.840] (-1240.222) (-1238.353) (-1237.941) -- 0:00:36 443000 -- (-1238.137) (-1238.955) (-1239.119) [-1238.536] * (-1241.473) [-1239.162] (-1240.933) (-1240.853) -- 0:00:36 443500 -- (-1237.782) (-1239.842) [-1239.217] (-1240.559) * (-1243.398) (-1239.256) (-1239.448) [-1239.465] -- 0:00:36 444000 -- (-1240.646) (-1240.184) (-1238.651) [-1239.291] * (-1239.876) (-1238.679) (-1238.705) [-1238.822] -- 0:00:36 444500 -- (-1237.985) (-1246.918) [-1239.059] (-1241.063) * (-1240.474) [-1238.402] (-1237.943) (-1238.277) -- 0:00:36 445000 -- (-1238.684) [-1240.586] (-1240.440) (-1244.288) * [-1238.456] (-1237.688) (-1239.403) (-1238.670) -- 0:00:36 Average standard deviation of split frequencies: 0.018027 445500 -- (-1238.341) (-1239.610) [-1238.242] (-1239.765) * (-1238.591) (-1238.382) [-1237.520] (-1238.879) -- 0:00:36 446000 -- (-1240.542) (-1237.850) (-1239.311) [-1240.928] * (-1238.755) (-1238.003) (-1238.594) [-1238.779] -- 0:00:36 446500 -- (-1237.567) [-1237.739] (-1239.222) (-1240.193) * (-1239.706) (-1242.143) [-1239.904] (-1238.651) -- 0:00:35 447000 -- (-1239.060) [-1242.493] (-1239.103) (-1243.659) * (-1242.843) (-1238.227) [-1240.093] (-1238.596) -- 0:00:35 447500 -- (-1238.946) [-1238.232] (-1241.419) (-1242.806) * (-1240.442) (-1238.256) (-1241.145) [-1239.620] -- 0:00:35 448000 -- (-1239.372) (-1239.344) [-1237.619] (-1242.691) * (-1241.547) [-1238.256] (-1240.742) (-1240.383) -- 0:00:35 448500 -- [-1239.823] (-1239.868) (-1240.528) (-1242.563) * (-1237.977) (-1237.714) [-1237.611] (-1240.642) -- 0:00:35 449000 -- [-1240.234] (-1237.954) (-1244.123) (-1239.546) * (-1238.100) (-1237.606) [-1239.133] (-1241.191) -- 0:00:35 449500 -- (-1238.263) (-1237.726) [-1240.960] (-1237.822) * (-1244.926) [-1237.808] (-1238.154) (-1238.468) -- 0:00:35 450000 -- (-1242.146) [-1239.684] (-1241.331) (-1241.807) * (-1240.488) (-1237.934) (-1238.156) [-1238.468] -- 0:00:35 Average standard deviation of split frequencies: 0.018363 450500 -- (-1239.929) (-1238.982) (-1239.114) [-1238.750] * (-1240.283) (-1240.344) (-1240.184) [-1239.180] -- 0:00:35 451000 -- (-1240.927) [-1238.922] (-1239.127) (-1239.850) * (-1238.060) [-1241.172] (-1238.796) (-1237.354) -- 0:00:35 451500 -- [-1239.232] (-1239.775) (-1239.866) (-1242.016) * (-1238.360) [-1241.698] (-1238.799) (-1237.408) -- 0:00:35 452000 -- (-1241.266) [-1239.877] (-1243.799) (-1242.774) * [-1238.204] (-1240.975) (-1239.176) (-1240.013) -- 0:00:35 452500 -- (-1240.790) [-1239.168] (-1239.416) (-1244.384) * [-1238.898] (-1240.429) (-1237.872) (-1240.881) -- 0:00:35 453000 -- (-1240.815) (-1239.467) [-1237.701] (-1244.764) * (-1238.424) [-1238.960] (-1237.477) (-1241.598) -- 0:00:35 453500 -- (-1239.536) [-1238.674] (-1238.117) (-1239.044) * (-1244.408) [-1237.680] (-1239.885) (-1240.965) -- 0:00:34 454000 -- (-1240.842) (-1240.964) [-1238.428] (-1239.118) * (-1242.743) [-1238.032] (-1239.480) (-1239.886) -- 0:00:34 454500 -- (-1243.256) [-1241.036] (-1237.950) (-1241.259) * (-1240.597) [-1238.020] (-1240.530) (-1245.302) -- 0:00:34 455000 -- (-1242.001) [-1240.494] (-1241.977) (-1239.294) * (-1238.757) (-1239.422) (-1237.390) [-1238.379] -- 0:00:34 Average standard deviation of split frequencies: 0.018034 455500 -- (-1240.713) [-1238.402] (-1239.824) (-1241.051) * (-1239.852) [-1243.192] (-1239.341) (-1241.930) -- 0:00:35 456000 -- [-1238.454] (-1240.168) (-1239.981) (-1238.467) * (-1239.755) (-1238.372) (-1242.180) [-1239.070] -- 0:00:35 456500 -- [-1238.409] (-1236.981) (-1238.314) (-1238.426) * (-1243.128) (-1239.306) [-1243.373] (-1238.391) -- 0:00:35 457000 -- (-1240.450) (-1236.982) [-1237.885] (-1238.058) * (-1239.764) [-1239.433] (-1242.553) (-1238.881) -- 0:00:35 457500 -- (-1240.713) (-1238.012) [-1239.754] (-1238.059) * [-1238.414] (-1239.897) (-1244.864) (-1239.840) -- 0:00:35 458000 -- [-1239.301] (-1245.508) (-1241.707) (-1239.043) * [-1238.843] (-1244.023) (-1240.415) (-1239.947) -- 0:00:35 458500 -- (-1238.906) [-1242.071] (-1241.507) (-1239.034) * [-1240.163] (-1242.262) (-1237.931) (-1239.949) -- 0:00:35 459000 -- (-1240.031) (-1239.232) [-1238.644] (-1242.507) * (-1240.809) [-1240.979] (-1238.855) (-1238.978) -- 0:00:35 459500 -- (-1239.905) (-1243.770) [-1243.698] (-1238.074) * (-1240.304) [-1240.514] (-1241.206) (-1238.655) -- 0:00:35 460000 -- (-1246.803) (-1242.286) [-1238.440] (-1237.676) * (-1241.214) [-1240.435] (-1242.419) (-1239.088) -- 0:00:35 Average standard deviation of split frequencies: 0.017794 460500 -- (-1246.885) (-1240.600) [-1238.833] (-1239.326) * (-1240.272) (-1240.193) [-1241.603] (-1239.768) -- 0:00:35 461000 -- (-1238.459) (-1242.394) (-1241.785) [-1239.270] * [-1237.646] (-1241.617) (-1240.079) (-1239.845) -- 0:00:35 461500 -- (-1238.339) (-1242.136) (-1240.415) [-1240.846] * [-1241.089] (-1241.078) (-1238.448) (-1238.974) -- 0:00:35 462000 -- [-1240.697] (-1238.747) (-1238.304) (-1241.308) * (-1243.005) (-1241.258) (-1240.018) [-1239.098] -- 0:00:34 462500 -- (-1239.300) (-1240.206) (-1244.875) [-1240.424] * [-1242.531] (-1243.909) (-1240.129) (-1238.410) -- 0:00:34 463000 -- (-1241.893) (-1240.662) (-1237.156) [-1237.824] * (-1239.574) (-1241.248) [-1238.171] (-1239.098) -- 0:00:34 463500 -- (-1238.307) (-1244.514) [-1238.570] (-1242.128) * (-1239.220) [-1238.889] (-1239.305) (-1239.768) -- 0:00:34 464000 -- [-1242.740] (-1243.134) (-1240.620) (-1241.297) * (-1238.206) [-1242.100] (-1237.610) (-1241.352) -- 0:00:34 464500 -- (-1241.845) (-1241.481) (-1242.500) [-1240.066] * (-1239.521) (-1238.599) (-1237.882) [-1239.091] -- 0:00:34 465000 -- (-1241.802) (-1238.157) (-1243.291) [-1241.188] * [-1239.159] (-1240.940) (-1239.950) (-1239.429) -- 0:00:34 Average standard deviation of split frequencies: 0.017029 465500 -- (-1242.050) [-1238.041] (-1240.778) (-1241.820) * (-1237.414) [-1240.528] (-1239.137) (-1240.301) -- 0:00:34 466000 -- (-1241.449) (-1240.460) (-1240.679) [-1243.272] * [-1238.358] (-1239.176) (-1238.781) (-1240.529) -- 0:00:34 466500 -- (-1242.245) [-1238.606] (-1238.737) (-1240.931) * (-1237.295) (-1240.802) (-1238.947) [-1239.222] -- 0:00:34 467000 -- (-1241.643) (-1238.822) (-1239.919) [-1241.849] * [-1237.682] (-1241.060) (-1239.076) (-1240.363) -- 0:00:34 467500 -- (-1241.090) (-1238.809) [-1238.827] (-1240.341) * [-1240.755] (-1239.984) (-1240.607) (-1243.645) -- 0:00:34 468000 -- (-1238.770) (-1240.985) (-1238.643) [-1241.967] * (-1238.969) (-1239.000) [-1241.186] (-1238.239) -- 0:00:34 468500 -- [-1241.772] (-1240.104) (-1240.678) (-1240.163) * (-1239.253) (-1241.072) (-1238.738) [-1239.824] -- 0:00:34 469000 -- (-1241.293) (-1237.611) [-1238.174] (-1239.134) * (-1237.870) (-1240.833) (-1238.939) [-1237.807] -- 0:00:33 469500 -- (-1240.030) (-1243.064) [-1237.969] (-1238.993) * (-1238.119) (-1239.516) [-1239.326] (-1240.338) -- 0:00:33 470000 -- (-1237.399) (-1240.554) (-1241.432) [-1238.031] * [-1238.735] (-1240.889) (-1238.574) (-1237.312) -- 0:00:33 Average standard deviation of split frequencies: 0.016732 470500 -- (-1237.791) (-1240.444) (-1239.375) [-1239.734] * (-1238.090) [-1242.523] (-1240.134) (-1239.926) -- 0:00:33 471000 -- (-1238.861) (-1240.439) [-1238.378] (-1239.839) * (-1238.546) [-1238.739] (-1239.942) (-1237.804) -- 0:00:33 471500 -- [-1239.234] (-1239.359) (-1238.670) (-1238.796) * [-1238.637] (-1240.818) (-1239.974) (-1237.804) -- 0:00:34 472000 -- (-1241.719) (-1237.950) (-1239.575) [-1238.272] * (-1239.402) [-1241.800] (-1238.086) (-1237.804) -- 0:00:34 472500 -- [-1239.863] (-1240.449) (-1243.935) (-1239.055) * [-1238.475] (-1244.057) (-1241.262) (-1241.103) -- 0:00:34 473000 -- (-1237.813) (-1240.177) [-1241.128] (-1238.133) * (-1240.328) (-1242.721) [-1244.316] (-1240.025) -- 0:00:34 473500 -- (-1238.971) [-1243.076] (-1239.885) (-1238.063) * (-1241.358) [-1238.293] (-1240.431) (-1239.988) -- 0:00:34 474000 -- (-1242.511) (-1241.854) [-1239.037] (-1243.338) * (-1240.392) (-1238.578) [-1243.893] (-1237.980) -- 0:00:34 474500 -- (-1243.567) (-1238.529) (-1240.572) [-1238.267] * (-1239.737) [-1238.309] (-1243.108) (-1240.266) -- 0:00:34 475000 -- (-1239.450) (-1238.996) (-1240.050) [-1240.895] * (-1239.953) (-1237.476) [-1239.195] (-1238.026) -- 0:00:34 Average standard deviation of split frequencies: 0.016370 475500 -- [-1237.890] (-1240.745) (-1238.914) (-1239.965) * [-1241.711] (-1238.626) (-1240.732) (-1241.430) -- 0:00:34 476000 -- (-1240.815) [-1238.892] (-1237.933) (-1238.951) * [-1241.927] (-1238.421) (-1237.792) (-1239.754) -- 0:00:34 476500 -- (-1240.984) [-1238.982] (-1240.444) (-1239.735) * (-1242.286) (-1238.580) (-1240.261) [-1238.870] -- 0:00:34 477000 -- [-1238.295] (-1240.613) (-1243.408) (-1239.118) * (-1239.922) (-1240.818) [-1240.529] (-1243.314) -- 0:00:33 477500 -- (-1239.500) (-1238.791) [-1239.244] (-1241.493) * [-1238.505] (-1239.322) (-1238.731) (-1239.662) -- 0:00:33 478000 -- (-1240.446) (-1239.204) (-1239.809) [-1238.317] * (-1242.207) (-1239.098) [-1239.051] (-1241.888) -- 0:00:33 478500 -- [-1240.229] (-1239.341) (-1237.836) (-1238.562) * (-1238.250) (-1238.866) (-1243.285) [-1238.553] -- 0:00:33 479000 -- (-1238.064) (-1238.679) (-1239.122) [-1242.785] * [-1238.986] (-1239.967) (-1239.632) (-1241.760) -- 0:00:33 479500 -- (-1237.623) (-1240.337) (-1242.769) [-1240.140] * (-1239.837) (-1237.477) [-1240.009] (-1239.508) -- 0:00:33 480000 -- (-1237.545) [-1246.552] (-1238.979) (-1240.240) * (-1239.734) [-1237.731] (-1241.072) (-1240.112) -- 0:00:33 Average standard deviation of split frequencies: 0.016384 480500 -- (-1237.532) [-1242.747] (-1239.531) (-1242.316) * [-1238.054] (-1244.367) (-1240.611) (-1241.001) -- 0:00:33 481000 -- (-1237.982) (-1238.532) (-1237.481) [-1239.410] * [-1238.309] (-1242.361) (-1243.242) (-1241.316) -- 0:00:33 481500 -- (-1237.883) (-1238.866) (-1242.887) [-1242.155] * (-1239.278) (-1240.617) (-1242.436) [-1238.705] -- 0:00:33 482000 -- (-1239.794) (-1239.580) (-1238.892) [-1239.630] * (-1242.183) [-1242.159] (-1243.253) (-1240.566) -- 0:00:33 482500 -- (-1239.794) (-1238.125) [-1237.429] (-1240.606) * [-1241.114] (-1246.319) (-1237.398) (-1237.479) -- 0:00:33 483000 -- (-1238.015) [-1237.972] (-1238.087) (-1240.776) * (-1241.257) (-1242.363) (-1240.349) [-1238.521] -- 0:00:33 483500 -- (-1239.504) [-1237.778] (-1244.283) (-1237.985) * [-1237.616] (-1242.432) (-1238.526) (-1238.099) -- 0:00:33 484000 -- (-1237.886) (-1239.819) [-1238.725] (-1238.320) * (-1241.115) (-1244.631) (-1240.171) [-1240.545] -- 0:00:33 484500 -- (-1242.896) [-1240.160] (-1239.296) (-1237.632) * (-1241.001) (-1241.196) (-1240.513) [-1241.367] -- 0:00:32 485000 -- [-1239.350] (-1241.460) (-1240.700) (-1239.152) * (-1239.259) (-1241.792) (-1241.779) [-1239.584] -- 0:00:32 Average standard deviation of split frequencies: 0.015862 485500 -- (-1238.233) [-1238.539] (-1242.788) (-1240.801) * (-1238.721) (-1240.543) [-1237.809] (-1238.847) -- 0:00:32 486000 -- (-1239.509) [-1239.607] (-1242.420) (-1241.176) * (-1239.441) [-1239.700] (-1238.401) (-1237.801) -- 0:00:32 486500 -- [-1239.301] (-1244.834) (-1238.182) (-1241.484) * (-1240.704) (-1238.768) (-1242.373) [-1237.042] -- 0:00:32 487000 -- [-1239.968] (-1242.112) (-1243.203) (-1239.004) * (-1240.506) (-1239.719) [-1238.753] (-1238.434) -- 0:00:33 487500 -- (-1238.659) (-1238.470) (-1239.731) [-1239.919] * [-1237.543] (-1240.794) (-1237.632) (-1237.831) -- 0:00:33 488000 -- (-1237.806) (-1238.166) (-1238.745) [-1242.859] * (-1238.213) (-1239.331) (-1241.552) [-1239.607] -- 0:00:33 488500 -- [-1238.204] (-1240.618) (-1239.704) (-1241.062) * (-1241.690) (-1240.340) (-1249.186) [-1242.684] -- 0:00:33 489000 -- (-1242.120) (-1237.957) (-1239.576) [-1238.543] * (-1239.373) [-1240.259] (-1239.843) (-1238.335) -- 0:00:33 489500 -- [-1242.505] (-1240.162) (-1244.184) (-1238.568) * [-1239.855] (-1242.351) (-1241.096) (-1243.073) -- 0:00:33 490000 -- (-1238.852) [-1239.835] (-1240.886) (-1241.524) * (-1240.260) [-1237.685] (-1243.716) (-1243.742) -- 0:00:33 Average standard deviation of split frequencies: 0.015541 490500 -- [-1238.818] (-1239.564) (-1244.890) (-1245.132) * (-1242.407) (-1241.413) (-1240.691) [-1239.967] -- 0:00:33 491000 -- [-1238.719] (-1237.864) (-1239.560) (-1238.449) * (-1239.983) (-1240.338) [-1243.174] (-1238.157) -- 0:00:33 491500 -- (-1238.486) [-1238.699] (-1240.314) (-1238.000) * (-1238.237) (-1238.121) [-1238.862] (-1238.817) -- 0:00:33 492000 -- [-1237.808] (-1241.304) (-1242.259) (-1240.101) * (-1241.340) [-1238.997] (-1239.850) (-1239.151) -- 0:00:33 492500 -- (-1242.553) (-1243.957) [-1241.804] (-1241.116) * (-1239.363) [-1239.720] (-1238.446) (-1239.501) -- 0:00:32 493000 -- [-1240.484] (-1243.132) (-1242.079) (-1241.316) * [-1237.446] (-1238.556) (-1239.367) (-1251.979) -- 0:00:32 493500 -- (-1240.902) [-1239.844] (-1238.205) (-1240.632) * [-1239.573] (-1238.381) (-1237.835) (-1242.753) -- 0:00:32 494000 -- (-1242.227) [-1237.479] (-1239.220) (-1241.406) * (-1238.208) [-1241.105] (-1238.118) (-1250.859) -- 0:00:32 494500 -- (-1242.145) (-1238.206) [-1237.600] (-1243.449) * [-1238.196] (-1239.158) (-1238.705) (-1240.014) -- 0:00:32 495000 -- [-1242.218] (-1238.611) (-1237.608) (-1243.080) * [-1242.742] (-1239.012) (-1238.631) (-1240.064) -- 0:00:32 Average standard deviation of split frequencies: 0.015151 495500 -- [-1239.945] (-1239.661) (-1240.173) (-1240.377) * (-1238.073) (-1241.058) (-1241.420) [-1239.526] -- 0:00:32 496000 -- (-1239.009) (-1244.723) [-1238.133] (-1241.425) * (-1240.046) [-1242.289] (-1239.435) (-1240.992) -- 0:00:32 496500 -- (-1237.331) (-1238.795) (-1238.872) [-1237.762] * (-1239.177) [-1239.493] (-1238.823) (-1240.515) -- 0:00:32 497000 -- [-1237.032] (-1241.833) (-1240.117) (-1238.753) * [-1239.137] (-1239.745) (-1237.970) (-1238.834) -- 0:00:32 497500 -- (-1240.097) [-1238.626] (-1241.118) (-1240.180) * (-1244.847) (-1241.447) (-1239.456) [-1239.406] -- 0:00:32 498000 -- (-1241.645) [-1237.533] (-1244.019) (-1239.612) * (-1240.766) [-1239.693] (-1239.574) (-1240.718) -- 0:00:32 498500 -- (-1238.252) (-1237.363) (-1240.710) [-1239.511] * (-1239.391) (-1238.774) (-1237.687) [-1239.161] -- 0:00:32 499000 -- (-1240.976) [-1237.540] (-1238.742) (-1241.814) * (-1239.563) (-1239.061) (-1239.099) [-1237.918] -- 0:00:32 499500 -- (-1239.574) [-1237.670] (-1240.197) (-1245.661) * (-1240.097) (-1242.869) [-1238.618] (-1237.688) -- 0:00:32 500000 -- [-1240.017] (-1237.717) (-1238.062) (-1240.987) * (-1240.243) [-1239.690] (-1238.358) (-1238.015) -- 0:00:32 Average standard deviation of split frequencies: 0.014345 500500 -- [-1244.112] (-1238.904) (-1238.658) (-1246.747) * [-1239.330] (-1241.041) (-1238.325) (-1238.524) -- 0:00:31 501000 -- [-1238.046] (-1238.378) (-1239.385) (-1239.033) * (-1237.986) [-1239.552] (-1241.974) (-1241.244) -- 0:00:31 501500 -- [-1237.616] (-1244.611) (-1238.734) (-1240.047) * [-1238.151] (-1238.099) (-1238.101) (-1241.962) -- 0:00:31 502000 -- (-1240.122) (-1242.909) (-1239.381) [-1240.745] * (-1237.212) [-1241.178] (-1240.219) (-1239.186) -- 0:00:32 502500 -- (-1238.989) (-1243.193) (-1239.200) [-1238.622] * (-1237.212) [-1239.669] (-1237.241) (-1241.922) -- 0:00:32 503000 -- (-1240.828) (-1237.895) (-1237.833) [-1239.731] * (-1241.269) [-1239.332] (-1245.655) (-1238.064) -- 0:00:32 503500 -- (-1239.609) (-1238.483) (-1238.435) [-1241.617] * (-1240.994) [-1241.598] (-1239.731) (-1241.334) -- 0:00:32 504000 -- (-1239.337) [-1240.439] (-1237.638) (-1237.419) * (-1238.963) [-1238.887] (-1243.332) (-1238.836) -- 0:00:32 504500 -- (-1237.523) [-1242.561] (-1239.826) (-1238.856) * (-1242.074) (-1242.157) [-1241.531] (-1239.387) -- 0:00:32 505000 -- [-1237.700] (-1244.346) (-1243.198) (-1239.527) * [-1242.639] (-1239.920) (-1241.249) (-1240.526) -- 0:00:32 Average standard deviation of split frequencies: 0.014139 505500 -- [-1237.812] (-1245.122) (-1239.719) (-1240.526) * (-1240.280) [-1239.600] (-1237.542) (-1240.357) -- 0:00:32 506000 -- (-1239.239) (-1238.772) (-1238.762) [-1239.315] * (-1237.880) (-1238.026) [-1237.278] (-1237.289) -- 0:00:32 506500 -- (-1242.023) [-1237.474] (-1240.556) (-1242.627) * (-1238.744) [-1242.019] (-1238.574) (-1238.341) -- 0:00:32 507000 -- [-1240.536] (-1237.315) (-1238.233) (-1240.950) * (-1237.896) (-1243.003) [-1239.503] (-1238.787) -- 0:00:32 507500 -- (-1238.313) (-1237.440) [-1240.329] (-1240.787) * [-1238.093] (-1240.704) (-1241.554) (-1237.340) -- 0:00:32 508000 -- (-1239.708) (-1241.750) [-1239.535] (-1237.721) * (-1240.274) [-1239.528] (-1241.182) (-1239.163) -- 0:00:31 508500 -- (-1238.836) [-1240.205] (-1240.637) (-1238.932) * (-1240.137) [-1238.866] (-1241.698) (-1243.657) -- 0:00:31 509000 -- (-1238.480) (-1240.952) (-1245.324) [-1242.227] * (-1239.120) [-1239.640] (-1242.992) (-1238.203) -- 0:00:31 509500 -- [-1242.541] (-1239.318) (-1247.113) (-1239.433) * (-1237.591) (-1237.993) (-1242.063) [-1240.580] -- 0:00:31 510000 -- [-1238.108] (-1238.212) (-1240.846) (-1244.297) * (-1237.838) (-1238.023) [-1243.871] (-1238.892) -- 0:00:31 Average standard deviation of split frequencies: 0.014661 510500 -- (-1241.576) [-1239.457] (-1237.964) (-1241.862) * (-1238.447) [-1239.472] (-1241.994) (-1238.369) -- 0:00:31 511000 -- (-1239.617) [-1238.422] (-1239.683) (-1239.513) * (-1238.484) (-1240.208) (-1240.943) [-1237.464] -- 0:00:31 511500 -- (-1238.249) (-1238.023) [-1241.293] (-1239.905) * (-1239.488) [-1246.055] (-1239.281) (-1238.328) -- 0:00:31 512000 -- (-1240.933) [-1241.531] (-1242.763) (-1239.630) * (-1239.760) (-1241.184) [-1239.121] (-1237.831) -- 0:00:31 512500 -- (-1240.712) [-1239.507] (-1238.720) (-1240.613) * [-1239.247] (-1239.191) (-1238.819) (-1238.884) -- 0:00:31 513000 -- (-1238.637) (-1241.965) (-1239.601) [-1238.791] * [-1237.760] (-1238.928) (-1239.295) (-1239.752) -- 0:00:31 513500 -- (-1239.021) (-1240.012) [-1238.521] (-1240.308) * (-1241.181) (-1242.153) (-1238.836) [-1240.509] -- 0:00:31 514000 -- (-1240.079) (-1239.427) [-1238.809] (-1237.711) * [-1238.645] (-1238.515) (-1238.518) (-1239.628) -- 0:00:31 514500 -- (-1240.073) (-1242.378) [-1240.465] (-1237.880) * [-1238.830] (-1241.351) (-1242.062) (-1239.344) -- 0:00:31 515000 -- (-1240.066) (-1238.484) (-1239.992) [-1239.855] * [-1239.140] (-1240.843) (-1241.673) (-1242.214) -- 0:00:31 Average standard deviation of split frequencies: 0.014241 515500 -- (-1239.562) (-1239.050) (-1238.822) [-1239.653] * (-1239.175) (-1241.879) (-1240.360) [-1238.647] -- 0:00:31 516000 -- [-1239.159] (-1240.687) (-1239.662) (-1239.553) * (-1242.292) (-1240.718) (-1247.518) [-1238.059] -- 0:00:30 516500 -- (-1239.755) [-1238.940] (-1238.049) (-1237.962) * [-1240.162] (-1241.598) (-1239.718) (-1238.493) -- 0:00:30 517000 -- [-1237.464] (-1241.251) (-1239.138) (-1240.384) * [-1239.111] (-1237.184) (-1239.768) (-1237.638) -- 0:00:30 517500 -- (-1237.428) (-1241.998) [-1239.176] (-1240.848) * (-1243.056) [-1241.847] (-1238.608) (-1238.388) -- 0:00:30 518000 -- [-1237.457] (-1239.589) (-1240.103) (-1239.191) * (-1240.848) [-1242.014] (-1238.930) (-1240.140) -- 0:00:31 518500 -- (-1237.457) (-1241.153) [-1240.319] (-1239.017) * [-1239.421] (-1239.104) (-1238.305) (-1239.067) -- 0:00:31 519000 -- (-1238.064) (-1237.391) [-1239.339] (-1238.404) * (-1241.665) (-1240.216) [-1240.543] (-1240.004) -- 0:00:31 519500 -- [-1242.037] (-1238.389) (-1239.386) (-1238.345) * (-1240.129) (-1242.102) [-1238.477] (-1239.878) -- 0:00:31 520000 -- (-1242.406) [-1238.548] (-1248.244) (-1238.947) * (-1240.208) [-1239.335] (-1238.476) (-1240.116) -- 0:00:31 Average standard deviation of split frequencies: 0.013581 520500 -- (-1242.258) [-1239.824] (-1243.435) (-1237.772) * (-1240.675) [-1237.982] (-1238.365) (-1241.883) -- 0:00:31 521000 -- (-1238.702) [-1238.659] (-1238.860) (-1240.874) * (-1242.079) [-1238.910] (-1237.758) (-1239.281) -- 0:00:31 521500 -- (-1238.702) [-1238.296] (-1242.248) (-1243.745) * [-1241.271] (-1240.431) (-1240.396) (-1238.366) -- 0:00:31 522000 -- (-1242.231) (-1237.509) (-1238.148) [-1240.098] * (-1238.253) [-1239.307] (-1237.460) (-1241.374) -- 0:00:31 522500 -- (-1238.481) (-1238.330) [-1238.418] (-1238.943) * (-1238.212) (-1239.391) (-1237.750) [-1239.090] -- 0:00:31 523000 -- [-1238.522] (-1238.270) (-1243.393) (-1238.943) * (-1240.046) [-1238.140] (-1242.837) (-1240.146) -- 0:00:31 523500 -- (-1238.047) [-1238.575] (-1243.326) (-1239.537) * (-1240.428) (-1238.680) (-1238.112) [-1238.775] -- 0:00:30 524000 -- (-1240.342) (-1239.085) (-1245.290) [-1238.454] * (-1239.383) [-1239.103] (-1241.925) (-1238.470) -- 0:00:30 524500 -- (-1239.442) [-1238.288] (-1240.699) (-1241.892) * (-1239.819) [-1239.665] (-1240.360) (-1237.961) -- 0:00:30 525000 -- (-1240.545) [-1239.143] (-1240.429) (-1241.832) * (-1238.248) [-1237.648] (-1237.920) (-1238.085) -- 0:00:30 Average standard deviation of split frequencies: 0.013232 525500 -- (-1240.353) [-1240.424] (-1240.196) (-1239.838) * (-1239.499) (-1239.184) (-1239.353) [-1238.824] -- 0:00:30 526000 -- (-1240.698) [-1240.398] (-1240.493) (-1241.697) * (-1237.719) [-1238.238] (-1239.055) (-1239.258) -- 0:00:30 526500 -- [-1242.708] (-1239.893) (-1241.287) (-1239.964) * [-1241.187] (-1239.162) (-1239.504) (-1239.400) -- 0:00:30 527000 -- (-1239.721) (-1239.425) [-1240.027] (-1238.976) * (-1239.689) (-1239.443) (-1239.510) [-1243.185] -- 0:00:30 527500 -- [-1239.261] (-1240.182) (-1241.645) (-1240.372) * (-1239.459) (-1240.282) (-1243.913) [-1240.848] -- 0:00:30 528000 -- (-1238.263) [-1240.541] (-1241.724) (-1239.644) * [-1238.388] (-1242.112) (-1237.211) (-1239.644) -- 0:00:30 528500 -- (-1237.887) (-1243.843) [-1241.873] (-1239.940) * (-1238.277) [-1239.064] (-1237.686) (-1240.878) -- 0:00:30 529000 -- (-1237.981) (-1239.283) (-1240.960) [-1242.182] * (-1238.617) [-1241.176] (-1237.789) (-1242.732) -- 0:00:30 529500 -- (-1237.373) (-1238.670) [-1238.657] (-1241.404) * (-1238.148) [-1242.052] (-1241.268) (-1241.448) -- 0:00:30 530000 -- (-1241.115) (-1240.371) (-1238.626) [-1241.155] * (-1238.995) (-1242.416) [-1242.103] (-1239.409) -- 0:00:30 Average standard deviation of split frequencies: 0.012855 530500 -- [-1239.768] (-1238.667) (-1239.609) (-1242.009) * [-1237.907] (-1238.406) (-1241.259) (-1238.008) -- 0:00:30 531000 -- [-1239.987] (-1237.498) (-1240.697) (-1240.509) * (-1240.072) [-1238.590] (-1238.976) (-1240.543) -- 0:00:30 531500 -- [-1238.875] (-1237.486) (-1238.007) (-1237.568) * (-1237.419) (-1241.669) [-1238.257] (-1240.469) -- 0:00:29 532000 -- (-1239.099) [-1238.457] (-1238.124) (-1238.296) * (-1237.713) (-1241.381) (-1239.750) [-1237.696] -- 0:00:29 532500 -- (-1238.242) (-1237.840) [-1239.162] (-1241.639) * (-1240.150) [-1239.798] (-1239.287) (-1238.536) -- 0:00:29 533000 -- [-1240.831] (-1239.961) (-1239.756) (-1243.987) * [-1240.163] (-1238.485) (-1239.434) (-1239.635) -- 0:00:29 533500 -- [-1241.293] (-1239.991) (-1241.028) (-1239.298) * (-1242.630) (-1238.923) [-1238.730] (-1240.612) -- 0:00:29 534000 -- (-1239.072) (-1239.931) (-1238.789) [-1237.807] * (-1238.863) (-1243.923) [-1239.204] (-1238.479) -- 0:00:29 534500 -- [-1240.353] (-1243.695) (-1240.605) (-1239.280) * (-1240.913) [-1238.278] (-1239.660) (-1239.707) -- 0:00:30 535000 -- (-1237.466) (-1240.724) (-1240.004) [-1238.625] * [-1239.598] (-1238.104) (-1238.120) (-1239.642) -- 0:00:30 Average standard deviation of split frequencies: 0.012468 535500 -- [-1238.834] (-1238.051) (-1239.019) (-1238.585) * (-1237.619) (-1237.884) (-1239.119) [-1239.133] -- 0:00:30 536000 -- (-1239.074) (-1239.140) [-1238.503] (-1238.330) * (-1237.513) (-1237.382) (-1242.262) [-1240.729] -- 0:00:30 536500 -- [-1239.688] (-1237.487) (-1240.463) (-1240.466) * (-1241.061) (-1239.724) (-1238.709) [-1240.508] -- 0:00:30 537000 -- (-1238.260) (-1237.314) (-1239.002) [-1238.125] * [-1239.626] (-1241.842) (-1238.750) (-1242.863) -- 0:00:30 537500 -- [-1238.626] (-1237.803) (-1237.593) (-1239.691) * [-1241.475] (-1237.034) (-1240.642) (-1241.079) -- 0:00:30 538000 -- (-1239.092) (-1243.004) [-1239.411] (-1238.841) * (-1241.867) [-1238.417] (-1239.711) (-1237.831) -- 0:00:30 538500 -- [-1238.771] (-1245.883) (-1237.333) (-1238.388) * [-1238.982] (-1237.477) (-1243.399) (-1238.722) -- 0:00:29 539000 -- (-1239.892) (-1239.238) (-1238.154) [-1237.724] * (-1239.263) (-1237.605) [-1241.246] (-1242.429) -- 0:00:29 539500 -- (-1242.119) (-1237.583) [-1237.872] (-1237.780) * (-1239.984) (-1238.377) (-1244.924) [-1240.435] -- 0:00:29 540000 -- (-1239.970) (-1241.648) [-1237.839] (-1241.058) * [-1239.667] (-1239.894) (-1240.723) (-1240.102) -- 0:00:29 Average standard deviation of split frequencies: 0.012463 540500 -- (-1240.496) (-1240.243) [-1239.782] (-1239.104) * (-1239.667) (-1239.989) [-1237.865] (-1238.559) -- 0:00:29 541000 -- (-1239.205) (-1238.905) [-1241.186] (-1240.433) * (-1238.138) [-1238.484] (-1238.764) (-1237.845) -- 0:00:29 541500 -- (-1240.536) (-1238.781) [-1239.947] (-1241.407) * (-1238.146) [-1238.974] (-1239.839) (-1240.992) -- 0:00:29 542000 -- (-1243.512) (-1239.857) (-1239.397) [-1239.557] * (-1240.401) (-1238.702) [-1238.206] (-1240.217) -- 0:00:29 542500 -- (-1237.835) (-1239.978) (-1239.119) [-1238.231] * [-1240.051] (-1240.415) (-1239.370) (-1238.526) -- 0:00:29 543000 -- (-1238.071) [-1238.033] (-1239.673) (-1237.943) * (-1239.558) (-1239.832) [-1240.199] (-1238.556) -- 0:00:29 543500 -- [-1239.111] (-1241.600) (-1240.901) (-1240.448) * (-1241.496) (-1237.405) [-1239.706] (-1242.288) -- 0:00:29 544000 -- (-1241.946) (-1241.565) [-1238.732] (-1240.556) * (-1242.379) (-1238.591) (-1241.658) [-1239.101] -- 0:00:29 544500 -- (-1240.368) (-1238.632) (-1238.200) [-1240.939] * (-1243.282) (-1239.554) (-1242.250) [-1237.284] -- 0:00:29 545000 -- (-1240.091) (-1240.122) (-1237.379) [-1240.158] * (-1241.660) (-1243.871) (-1238.693) [-1237.365] -- 0:00:29 Average standard deviation of split frequencies: 0.012748 545500 -- (-1240.198) [-1239.895] (-1240.985) (-1238.976) * [-1238.003] (-1247.432) (-1238.260) (-1239.548) -- 0:00:29 546000 -- [-1239.535] (-1238.728) (-1237.602) (-1243.249) * (-1239.495) [-1242.189] (-1237.967) (-1240.146) -- 0:00:29 546500 -- (-1240.079) (-1237.162) (-1237.738) [-1237.643] * (-1238.913) [-1239.517] (-1238.778) (-1242.197) -- 0:00:29 547000 -- (-1240.939) (-1241.479) (-1239.622) [-1237.708] * (-1241.883) (-1237.962) (-1237.813) [-1240.283] -- 0:00:28 547500 -- (-1240.326) [-1241.822] (-1239.172) (-1242.325) * [-1240.609] (-1239.957) (-1242.243) (-1237.171) -- 0:00:28 548000 -- (-1239.178) (-1240.053) (-1239.919) [-1241.591] * (-1240.519) [-1238.773] (-1242.727) (-1240.127) -- 0:00:28 548500 -- (-1239.164) [-1239.052] (-1239.097) (-1240.343) * (-1242.437) [-1238.598] (-1237.386) (-1239.692) -- 0:00:28 549000 -- (-1238.645) [-1237.580] (-1238.349) (-1238.227) * (-1246.795) (-1238.550) [-1239.315] (-1239.861) -- 0:00:28 549500 -- (-1237.345) [-1240.323] (-1238.293) (-1239.184) * (-1242.356) (-1237.980) [-1239.589] (-1239.993) -- 0:00:28 550000 -- [-1237.744] (-1238.591) (-1239.087) (-1239.976) * (-1238.969) (-1239.896) (-1240.270) [-1238.242] -- 0:00:28 Average standard deviation of split frequencies: 0.012740 550500 -- [-1237.365] (-1241.344) (-1240.177) (-1238.179) * (-1239.151) [-1242.083] (-1241.475) (-1238.066) -- 0:00:28 551000 -- (-1241.059) (-1240.539) [-1242.729] (-1239.451) * [-1239.189] (-1239.468) (-1240.712) (-1239.634) -- 0:00:29 551500 -- (-1239.847) [-1242.265] (-1239.078) (-1240.856) * (-1241.587) [-1240.702] (-1237.997) (-1238.229) -- 0:00:29 552000 -- [-1238.467] (-1237.703) (-1238.242) (-1238.460) * (-1238.049) (-1238.143) [-1240.061] (-1242.171) -- 0:00:29 552500 -- (-1237.540) (-1238.498) [-1237.868] (-1240.291) * [-1238.036] (-1238.416) (-1238.362) (-1238.541) -- 0:00:29 553000 -- (-1238.186) [-1239.476] (-1237.715) (-1239.413) * [-1237.741] (-1242.666) (-1239.547) (-1237.753) -- 0:00:29 553500 -- (-1239.629) [-1240.541] (-1238.012) (-1239.374) * [-1237.325] (-1244.165) (-1239.914) (-1239.316) -- 0:00:29 554000 -- (-1241.939) (-1240.568) [-1238.239] (-1238.806) * (-1240.088) (-1239.228) [-1239.503] (-1240.265) -- 0:00:28 554500 -- [-1241.206] (-1238.700) (-1239.726) (-1239.157) * [-1238.998] (-1238.641) (-1240.339) (-1239.270) -- 0:00:28 555000 -- (-1241.330) (-1243.587) (-1238.664) [-1238.589] * [-1238.531] (-1241.421) (-1241.586) (-1238.666) -- 0:00:28 Average standard deviation of split frequencies: 0.012518 555500 -- (-1239.367) [-1239.030] (-1237.839) (-1238.166) * (-1242.139) [-1240.944] (-1240.496) (-1239.355) -- 0:00:28 556000 -- (-1239.528) [-1238.812] (-1238.428) (-1240.067) * [-1238.084] (-1243.919) (-1240.326) (-1239.347) -- 0:00:28 556500 -- (-1240.463) [-1238.175] (-1238.575) (-1244.265) * (-1238.547) (-1245.624) (-1240.172) [-1239.035] -- 0:00:28 557000 -- (-1239.924) [-1238.290] (-1239.836) (-1246.922) * [-1242.146] (-1239.223) (-1239.714) (-1238.447) -- 0:00:28 557500 -- (-1239.502) [-1238.588] (-1239.580) (-1244.024) * (-1241.602) (-1238.565) [-1239.470] (-1240.932) -- 0:00:28 558000 -- (-1238.582) (-1240.190) (-1237.693) [-1240.312] * [-1237.955] (-1237.963) (-1237.680) (-1240.122) -- 0:00:28 558500 -- (-1237.968) [-1242.549] (-1237.755) (-1238.675) * (-1239.823) (-1239.795) [-1240.529] (-1239.412) -- 0:00:28 559000 -- (-1238.607) (-1248.689) [-1237.339] (-1238.674) * (-1240.728) (-1240.034) (-1241.501) [-1241.340] -- 0:00:28 559500 -- (-1239.485) (-1237.966) (-1238.449) [-1238.258] * (-1239.222) (-1239.145) (-1238.593) [-1239.154] -- 0:00:28 560000 -- [-1239.102] (-1237.558) (-1241.158) (-1238.109) * (-1239.023) (-1239.176) [-1239.059] (-1238.374) -- 0:00:28 Average standard deviation of split frequencies: 0.012139 560500 -- [-1240.310] (-1237.784) (-1241.167) (-1239.425) * (-1237.969) (-1239.598) (-1238.441) [-1238.233] -- 0:00:28 561000 -- (-1237.705) (-1239.128) [-1239.307] (-1240.012) * (-1239.400) (-1238.146) [-1241.425] (-1240.643) -- 0:00:28 561500 -- (-1238.410) (-1241.659) [-1239.076] (-1239.402) * (-1238.927) (-1237.952) (-1238.757) [-1239.948] -- 0:00:28 562000 -- (-1238.602) (-1239.803) (-1242.821) [-1240.904] * [-1239.585] (-1238.376) (-1239.437) (-1239.857) -- 0:00:28 562500 -- (-1239.201) [-1239.658] (-1241.652) (-1238.803) * (-1237.700) [-1243.767] (-1239.679) (-1241.292) -- 0:00:28 563000 -- (-1240.460) [-1238.864] (-1240.591) (-1241.737) * [-1237.603] (-1239.264) (-1238.914) (-1240.319) -- 0:00:27 563500 -- [-1239.683] (-1241.738) (-1241.328) (-1242.452) * (-1239.955) (-1239.681) (-1238.759) [-1237.675] -- 0:00:27 564000 -- (-1244.003) (-1240.339) (-1239.856) [-1240.813] * (-1242.487) [-1237.989] (-1237.748) (-1241.936) -- 0:00:27 564500 -- (-1239.037) (-1239.950) [-1239.368] (-1238.698) * (-1240.734) [-1238.821] (-1238.364) (-1238.892) -- 0:00:27 565000 -- (-1239.717) (-1241.065) (-1238.828) [-1237.490] * [-1240.046] (-1239.753) (-1237.837) (-1240.923) -- 0:00:27 Average standard deviation of split frequencies: 0.012285 565500 -- (-1238.708) (-1242.756) [-1241.871] (-1238.365) * [-1241.811] (-1239.018) (-1238.678) (-1239.832) -- 0:00:27 566000 -- (-1243.522) [-1238.830] (-1239.307) (-1240.354) * (-1241.239) (-1239.425) (-1238.046) [-1237.873] -- 0:00:27 566500 -- [-1241.951] (-1238.868) (-1239.064) (-1243.420) * (-1244.013) (-1242.048) (-1238.220) [-1237.447] -- 0:00:27 567000 -- (-1240.499) (-1239.507) [-1240.439] (-1242.914) * (-1240.270) (-1238.394) (-1239.273) [-1239.222] -- 0:00:28 567500 -- (-1239.201) [-1239.038] (-1238.232) (-1239.506) * (-1238.262) (-1237.291) (-1238.215) [-1239.326] -- 0:00:28 568000 -- (-1237.984) (-1237.306) (-1239.253) [-1241.937] * [-1237.341] (-1238.063) (-1239.138) (-1238.297) -- 0:00:28 568500 -- (-1239.914) [-1239.784] (-1239.648) (-1237.437) * [-1240.916] (-1244.671) (-1242.188) (-1238.803) -- 0:00:28 569000 -- (-1237.077) (-1239.286) (-1238.254) [-1237.372] * (-1237.704) [-1239.593] (-1238.736) (-1239.242) -- 0:00:28 569500 -- (-1240.285) (-1239.965) (-1239.769) [-1237.476] * (-1237.979) [-1238.849] (-1237.842) (-1239.400) -- 0:00:27 570000 -- [-1239.938] (-1240.375) (-1237.856) (-1238.108) * (-1239.990) (-1238.084) [-1239.499] (-1239.133) -- 0:00:27 Average standard deviation of split frequencies: 0.013010 570500 -- (-1243.193) (-1239.795) [-1238.054] (-1239.513) * (-1237.027) [-1237.536] (-1243.564) (-1238.812) -- 0:00:27 571000 -- (-1240.571) (-1238.315) [-1238.210] (-1242.626) * (-1244.131) (-1237.825) (-1245.204) [-1240.954] -- 0:00:27 571500 -- [-1240.395] (-1237.778) (-1238.730) (-1240.346) * (-1246.916) (-1239.012) (-1242.408) [-1238.031] -- 0:00:27 572000 -- [-1237.358] (-1238.991) (-1238.023) (-1238.360) * (-1241.782) (-1239.305) [-1240.347] (-1238.048) -- 0:00:27 572500 -- (-1243.884) [-1240.001] (-1238.239) (-1242.869) * (-1242.439) (-1240.644) (-1237.519) [-1239.101] -- 0:00:27 573000 -- (-1237.909) [-1238.845] (-1237.178) (-1242.511) * [-1238.380] (-1241.184) (-1239.301) (-1239.661) -- 0:00:27 573500 -- (-1238.409) (-1238.035) (-1239.701) [-1241.185] * (-1239.263) [-1239.412] (-1243.750) (-1238.675) -- 0:00:27 574000 -- (-1239.020) (-1239.573) (-1239.616) [-1239.583] * (-1239.919) (-1241.262) (-1241.768) [-1238.343] -- 0:00:27 574500 -- (-1239.767) [-1243.550] (-1239.495) (-1237.639) * [-1241.328] (-1245.822) (-1245.152) (-1239.604) -- 0:00:27 575000 -- (-1239.118) [-1242.281] (-1238.985) (-1238.381) * (-1239.328) (-1240.533) (-1240.276) [-1238.736] -- 0:00:27 Average standard deviation of split frequencies: 0.012839 575500 -- [-1238.084] (-1238.864) (-1238.772) (-1238.041) * [-1238.365] (-1237.850) (-1238.913) (-1239.725) -- 0:00:27 576000 -- (-1237.690) (-1238.620) [-1237.778] (-1237.758) * (-1238.952) (-1237.835) [-1240.560] (-1242.032) -- 0:00:27 576500 -- [-1241.692] (-1238.988) (-1238.245) (-1238.011) * (-1242.545) [-1238.011] (-1239.011) (-1237.947) -- 0:00:27 577000 -- (-1238.120) [-1237.555] (-1237.760) (-1240.958) * [-1239.123] (-1237.711) (-1239.174) (-1239.157) -- 0:00:27 577500 -- (-1239.917) (-1237.320) [-1237.905] (-1241.377) * [-1240.570] (-1241.065) (-1242.258) (-1238.724) -- 0:00:27 578000 -- (-1242.658) (-1237.219) (-1242.026) [-1240.136] * (-1240.040) (-1239.169) (-1244.599) [-1238.850] -- 0:00:27 578500 -- (-1239.494) [-1240.437] (-1239.704) (-1240.810) * (-1239.906) (-1238.911) [-1239.492] (-1239.823) -- 0:00:26 579000 -- (-1239.552) (-1243.813) (-1239.518) [-1237.744] * (-1238.355) (-1240.443) [-1240.220] (-1239.692) -- 0:00:26 579500 -- (-1239.895) (-1245.271) [-1238.019] (-1238.712) * [-1239.316] (-1240.169) (-1242.330) (-1240.949) -- 0:00:26 580000 -- (-1238.654) [-1238.541] (-1239.370) (-1237.289) * [-1239.395] (-1239.996) (-1239.896) (-1241.057) -- 0:00:26 Average standard deviation of split frequencies: 0.012330 580500 -- (-1238.142) [-1240.330] (-1238.397) (-1238.199) * (-1242.270) [-1240.445] (-1242.309) (-1237.168) -- 0:00:26 581000 -- (-1238.495) (-1239.275) [-1238.143] (-1238.760) * (-1238.309) [-1237.229] (-1239.179) (-1237.992) -- 0:00:26 581500 -- (-1239.620) [-1239.675] (-1244.790) (-1240.505) * (-1238.720) (-1238.092) (-1238.872) [-1239.625] -- 0:00:26 582000 -- (-1239.069) [-1238.363] (-1239.904) (-1241.023) * (-1239.917) (-1238.071) [-1240.567] (-1241.674) -- 0:00:26 582500 -- (-1241.057) (-1239.088) (-1241.471) [-1239.533] * (-1240.104) [-1238.919] (-1237.999) (-1238.070) -- 0:00:26 583000 -- (-1239.973) [-1240.254] (-1237.145) (-1241.707) * (-1241.803) [-1238.275] (-1238.392) (-1237.820) -- 0:00:26 583500 -- (-1240.569) (-1241.631) (-1237.166) [-1237.552] * (-1241.361) (-1238.048) (-1242.342) [-1237.818] -- 0:00:27 584000 -- [-1240.829] (-1237.398) (-1240.684) (-1240.558) * (-1237.362) (-1239.521) [-1241.123] (-1239.423) -- 0:00:27 584500 -- (-1242.779) (-1240.226) [-1240.057] (-1239.647) * (-1238.933) (-1239.026) (-1240.758) [-1238.733] -- 0:00:27 585000 -- (-1238.151) (-1240.099) (-1238.517) [-1241.115] * [-1238.962] (-1238.531) (-1240.737) (-1239.397) -- 0:00:26 Average standard deviation of split frequencies: 0.012318 585500 -- [-1237.514] (-1240.523) (-1241.222) (-1238.523) * [-1237.701] (-1241.994) (-1238.421) (-1240.129) -- 0:00:26 586000 -- (-1239.042) (-1241.368) [-1238.914] (-1239.262) * (-1237.558) (-1241.227) (-1237.824) [-1243.390] -- 0:00:26 586500 -- (-1238.270) [-1239.711] (-1239.644) (-1239.067) * (-1243.882) (-1239.065) (-1238.795) [-1242.097] -- 0:00:26 587000 -- [-1238.528] (-1241.096) (-1240.946) (-1239.023) * (-1241.123) (-1239.323) [-1238.511] (-1238.800) -- 0:00:26 587500 -- (-1241.229) (-1241.688) (-1240.233) [-1238.666] * (-1239.569) (-1239.127) [-1237.725] (-1240.904) -- 0:00:26 588000 -- [-1242.151] (-1243.215) (-1237.252) (-1240.445) * (-1239.835) [-1239.444] (-1238.456) (-1241.119) -- 0:00:26 588500 -- (-1238.265) (-1240.757) (-1237.511) [-1239.495] * (-1239.320) (-1240.822) [-1238.244] (-1240.838) -- 0:00:26 589000 -- (-1239.762) [-1240.014] (-1238.571) (-1239.913) * (-1238.618) (-1239.961) [-1239.207] (-1237.901) -- 0:00:26 589500 -- (-1238.216) (-1238.130) (-1238.511) [-1239.603] * [-1238.872] (-1239.888) (-1242.683) (-1238.951) -- 0:00:26 590000 -- (-1237.932) [-1238.384] (-1240.015) (-1240.688) * (-1238.259) (-1241.012) (-1238.540) [-1238.941] -- 0:00:26 Average standard deviation of split frequencies: 0.012919 590500 -- (-1239.662) (-1240.477) (-1237.456) [-1240.020] * (-1237.901) (-1241.404) (-1239.416) [-1238.205] -- 0:00:26 591000 -- [-1241.711] (-1239.292) (-1240.564) (-1239.483) * (-1237.242) [-1237.963] (-1240.815) (-1238.415) -- 0:00:26 591500 -- (-1242.538) [-1240.649] (-1240.984) (-1239.245) * (-1237.328) (-1241.320) (-1241.844) [-1238.413] -- 0:00:26 592000 -- [-1241.787] (-1238.872) (-1239.239) (-1241.329) * [-1239.232] (-1239.744) (-1240.345) (-1240.089) -- 0:00:26 592500 -- (-1239.314) [-1243.868] (-1240.027) (-1240.717) * [-1238.273] (-1240.986) (-1239.722) (-1240.119) -- 0:00:26 593000 -- (-1238.860) (-1242.452) [-1241.410] (-1239.495) * [-1237.747] (-1239.924) (-1239.316) (-1239.617) -- 0:00:26 593500 -- (-1239.937) (-1239.648) (-1238.501) [-1238.359] * (-1239.887) [-1241.415] (-1237.880) (-1237.921) -- 0:00:26 594000 -- [-1237.506] (-1238.987) (-1243.057) (-1245.734) * (-1238.770) [-1244.280] (-1243.206) (-1238.302) -- 0:00:25 594500 -- (-1239.105) [-1240.238] (-1240.181) (-1243.104) * (-1239.560) [-1237.703] (-1240.879) (-1240.292) -- 0:00:25 595000 -- [-1239.402] (-1240.869) (-1240.923) (-1240.211) * (-1238.257) (-1243.324) [-1238.081] (-1240.677) -- 0:00:25 Average standard deviation of split frequencies: 0.013347 595500 -- (-1237.961) [-1239.084] (-1240.666) (-1243.181) * (-1240.323) (-1241.700) [-1237.284] (-1238.967) -- 0:00:25 596000 -- (-1238.741) (-1238.208) [-1238.759] (-1242.873) * (-1239.512) (-1239.287) [-1239.189] (-1239.775) -- 0:00:25 596500 -- (-1238.963) (-1239.017) [-1239.079] (-1240.547) * [-1241.017] (-1237.567) (-1239.616) (-1243.922) -- 0:00:25 597000 -- (-1237.768) [-1239.064] (-1241.227) (-1237.415) * (-1241.277) [-1237.565] (-1249.089) (-1238.775) -- 0:00:25 597500 -- (-1237.900) (-1237.708) [-1237.517] (-1238.836) * (-1243.099) (-1237.831) [-1242.492] (-1238.798) -- 0:00:25 598000 -- [-1239.118] (-1237.445) (-1237.700) (-1238.399) * (-1237.969) [-1238.624] (-1242.267) (-1243.468) -- 0:00:25 598500 -- (-1241.581) (-1239.062) (-1242.773) [-1238.877] * [-1237.932] (-1239.113) (-1239.157) (-1241.440) -- 0:00:25 599000 -- (-1241.746) [-1237.388] (-1238.547) (-1239.788) * (-1241.970) (-1240.276) (-1240.788) [-1238.336] -- 0:00:25 599500 -- (-1240.588) (-1238.090) (-1240.302) [-1237.739] * (-1240.332) [-1239.909] (-1242.614) (-1238.341) -- 0:00:26 600000 -- (-1239.541) (-1239.684) (-1238.892) [-1240.163] * (-1239.163) [-1237.631] (-1241.031) (-1240.637) -- 0:00:25 Average standard deviation of split frequencies: 0.012949 600500 -- (-1238.872) [-1238.681] (-1237.870) (-1239.496) * (-1238.985) (-1239.034) [-1237.825] (-1243.564) -- 0:00:25 601000 -- (-1239.761) (-1237.855) (-1239.206) [-1239.297] * [-1238.001] (-1240.942) (-1240.028) (-1238.608) -- 0:00:25 601500 -- (-1241.204) (-1238.172) (-1241.241) [-1239.751] * [-1238.663] (-1242.722) (-1240.066) (-1239.698) -- 0:00:25 602000 -- (-1238.057) (-1239.896) [-1240.498] (-1239.211) * (-1239.208) (-1242.754) [-1239.486] (-1238.504) -- 0:00:25 602500 -- (-1240.287) (-1238.691) (-1239.660) [-1240.315] * (-1240.007) [-1241.372] (-1242.909) (-1239.686) -- 0:00:25 603000 -- (-1240.534) [-1237.923] (-1240.085) (-1242.835) * (-1240.359) [-1237.389] (-1239.151) (-1239.398) -- 0:00:25 603500 -- (-1241.639) (-1237.738) (-1240.096) [-1238.202] * (-1238.823) (-1239.057) (-1244.477) [-1242.069] -- 0:00:25 604000 -- (-1237.959) (-1241.411) [-1240.234] (-1240.992) * (-1241.649) [-1238.767] (-1241.046) (-1240.693) -- 0:00:25 604500 -- (-1239.225) (-1240.331) [-1240.813] (-1238.443) * (-1243.744) [-1238.981] (-1238.775) (-1241.857) -- 0:00:25 605000 -- [-1239.998] (-1239.557) (-1238.930) (-1237.425) * (-1239.033) (-1238.494) [-1238.767] (-1239.906) -- 0:00:25 Average standard deviation of split frequencies: 0.012835 605500 -- (-1244.147) (-1238.834) [-1239.152] (-1239.869) * (-1241.603) (-1238.936) [-1239.865] (-1239.112) -- 0:00:25 606000 -- (-1239.672) (-1238.038) [-1243.279] (-1239.209) * (-1238.363) (-1237.597) [-1237.571] (-1239.707) -- 0:00:25 606500 -- (-1240.117) [-1239.241] (-1245.049) (-1239.390) * (-1237.846) [-1244.336] (-1237.288) (-1239.638) -- 0:00:25 607000 -- (-1242.420) [-1239.198] (-1238.748) (-1242.785) * (-1239.965) (-1248.535) [-1238.050] (-1237.986) -- 0:00:25 607500 -- (-1239.625) (-1241.419) [-1238.203] (-1237.468) * (-1237.446) (-1245.058) (-1238.948) [-1239.607] -- 0:00:25 608000 -- [-1239.887] (-1237.629) (-1241.866) (-1238.514) * (-1237.770) (-1241.058) [-1238.612] (-1238.766) -- 0:00:25 608500 -- (-1241.165) (-1239.222) [-1242.243] (-1241.400) * (-1238.974) (-1240.580) (-1242.579) [-1239.369] -- 0:00:25 609000 -- (-1239.545) [-1237.637] (-1239.459) (-1239.283) * (-1241.568) [-1237.606] (-1240.634) (-1240.138) -- 0:00:25 609500 -- [-1239.325] (-1240.519) (-1238.448) (-1239.020) * [-1238.514] (-1237.612) (-1242.602) (-1237.206) -- 0:00:24 610000 -- (-1238.974) [-1238.179] (-1238.416) (-1239.017) * [-1240.357] (-1239.953) (-1239.735) (-1251.529) -- 0:00:24 Average standard deviation of split frequencies: 0.013441 610500 -- (-1240.054) [-1239.673] (-1240.042) (-1239.319) * (-1240.978) [-1241.320] (-1240.080) (-1244.346) -- 0:00:24 611000 -- [-1238.822] (-1240.659) (-1238.499) (-1240.875) * (-1240.115) (-1240.173) (-1239.760) [-1241.441] -- 0:00:24 611500 -- [-1242.128] (-1239.474) (-1240.752) (-1239.958) * (-1241.957) (-1240.499) (-1237.805) [-1239.694] -- 0:00:24 612000 -- (-1239.604) [-1239.468] (-1240.850) (-1238.624) * (-1238.511) (-1241.038) (-1243.793) [-1238.867] -- 0:00:24 612500 -- (-1239.403) (-1242.349) [-1240.988] (-1247.756) * [-1242.110] (-1241.653) (-1241.278) (-1238.169) -- 0:00:24 613000 -- (-1241.075) (-1246.614) [-1243.963] (-1240.752) * [-1240.014] (-1240.904) (-1239.010) (-1241.492) -- 0:00:24 613500 -- [-1238.247] (-1239.693) (-1241.111) (-1244.249) * (-1239.613) (-1248.748) [-1241.379] (-1242.086) -- 0:00:24 614000 -- (-1237.383) [-1239.796] (-1241.804) (-1239.500) * (-1239.647) [-1240.420] (-1239.682) (-1240.014) -- 0:00:24 614500 -- [-1239.557] (-1239.018) (-1239.679) (-1241.777) * (-1240.219) (-1240.522) [-1242.235] (-1239.747) -- 0:00:24 615000 -- (-1238.701) (-1239.859) [-1239.470] (-1242.370) * (-1238.842) (-1239.808) [-1238.846] (-1239.322) -- 0:00:24 Average standard deviation of split frequencies: 0.013730 615500 -- (-1240.075) (-1237.783) [-1239.966] (-1240.957) * (-1240.394) [-1237.882] (-1238.205) (-1241.672) -- 0:00:24 616000 -- (-1242.313) (-1238.385) [-1241.473] (-1241.046) * [-1238.827] (-1239.013) (-1240.419) (-1241.122) -- 0:00:24 616500 -- [-1239.039] (-1238.417) (-1238.114) (-1240.513) * (-1237.886) (-1237.982) [-1241.130] (-1240.476) -- 0:00:24 617000 -- (-1239.601) (-1239.793) [-1237.293] (-1242.039) * [-1237.749] (-1239.929) (-1242.101) (-1239.407) -- 0:00:24 617500 -- (-1239.862) (-1239.809) (-1238.728) [-1238.413] * (-1238.628) (-1239.759) [-1238.340] (-1239.421) -- 0:00:24 618000 -- (-1238.526) (-1239.353) [-1240.220] (-1241.693) * (-1238.640) (-1246.257) (-1238.639) [-1238.290] -- 0:00:24 618500 -- (-1245.513) (-1237.587) [-1237.261] (-1238.675) * (-1239.005) (-1242.744) (-1239.281) [-1239.146] -- 0:00:24 619000 -- (-1240.744) (-1242.221) [-1238.953] (-1240.885) * (-1239.459) (-1246.930) (-1240.015) [-1237.962] -- 0:00:24 619500 -- (-1245.692) (-1238.617) (-1237.721) [-1238.210] * [-1238.839] (-1240.917) (-1240.294) (-1237.970) -- 0:00:24 620000 -- (-1244.938) (-1239.941) (-1239.223) [-1238.333] * (-1239.742) (-1238.691) [-1241.277] (-1237.272) -- 0:00:24 Average standard deviation of split frequencies: 0.012956 620500 -- [-1238.869] (-1237.583) (-1241.383) (-1238.713) * [-1240.702] (-1238.139) (-1238.008) (-1241.569) -- 0:00:24 621000 -- (-1237.581) [-1239.118] (-1237.562) (-1240.067) * (-1240.237) (-1240.146) (-1238.977) [-1238.340] -- 0:00:24 621500 -- [-1237.592] (-1241.922) (-1238.821) (-1239.836) * [-1238.921] (-1239.919) (-1242.249) (-1237.857) -- 0:00:24 622000 -- [-1237.292] (-1240.139) (-1239.375) (-1239.192) * [-1241.892] (-1242.844) (-1239.519) (-1240.889) -- 0:00:24 622500 -- (-1242.350) [-1242.163] (-1239.207) (-1237.813) * (-1240.854) [-1238.506] (-1239.001) (-1238.480) -- 0:00:24 623000 -- [-1240.091] (-1238.312) (-1238.674) (-1237.714) * (-1244.118) (-1243.891) (-1241.149) [-1237.824] -- 0:00:24 623500 -- (-1240.400) (-1239.043) [-1237.694] (-1239.393) * [-1238.544] (-1239.281) (-1238.718) (-1240.223) -- 0:00:24 624000 -- (-1240.233) [-1237.950] (-1237.783) (-1243.622) * (-1238.009) (-1240.560) [-1238.236] (-1239.300) -- 0:00:24 624500 -- (-1239.715) (-1237.466) (-1237.473) [-1237.733] * [-1238.306] (-1242.968) (-1237.269) (-1239.766) -- 0:00:24 625000 -- (-1239.963) (-1240.565) (-1239.479) [-1238.570] * (-1238.315) (-1239.038) (-1240.731) [-1238.729] -- 0:00:24 Average standard deviation of split frequencies: 0.012935 625500 -- [-1238.966] (-1239.021) (-1237.639) (-1238.393) * (-1238.274) (-1238.000) (-1237.913) [-1240.330] -- 0:00:23 626000 -- [-1238.582] (-1240.052) (-1239.314) (-1239.525) * (-1239.383) [-1240.015] (-1238.007) (-1240.059) -- 0:00:23 626500 -- [-1239.518] (-1240.450) (-1238.248) (-1241.292) * [-1238.216] (-1238.148) (-1239.466) (-1237.908) -- 0:00:23 627000 -- (-1241.012) (-1242.222) (-1241.763) [-1241.892] * (-1241.156) (-1240.779) (-1241.804) [-1238.017] -- 0:00:23 627500 -- (-1239.805) [-1239.025] (-1239.908) (-1240.263) * (-1241.169) (-1237.662) [-1238.580] (-1242.791) -- 0:00:23 628000 -- (-1239.575) (-1243.688) [-1241.755] (-1237.504) * (-1245.242) [-1237.563] (-1239.431) (-1237.932) -- 0:00:23 628500 -- (-1242.184) (-1237.523) [-1239.426] (-1240.750) * (-1239.602) [-1237.499] (-1239.864) (-1242.316) -- 0:00:23 629000 -- [-1239.832] (-1237.496) (-1240.128) (-1237.660) * (-1238.907) (-1237.671) (-1240.569) [-1241.829] -- 0:00:23 629500 -- (-1238.691) (-1239.607) [-1237.910] (-1240.514) * (-1238.249) (-1239.059) [-1240.148] (-1238.994) -- 0:00:23 630000 -- (-1238.943) (-1242.098) [-1237.790] (-1239.401) * (-1238.042) [-1237.872] (-1241.122) (-1241.072) -- 0:00:23 Average standard deviation of split frequencies: 0.012487 630500 -- (-1237.686) (-1244.991) (-1238.310) [-1237.931] * [-1240.684] (-1238.504) (-1241.349) (-1239.846) -- 0:00:23 631000 -- (-1238.915) (-1245.139) (-1240.374) [-1238.789] * (-1237.791) (-1238.213) (-1239.872) [-1239.637] -- 0:00:23 631500 -- (-1239.767) (-1241.814) [-1240.263] (-1241.642) * (-1237.164) (-1241.303) (-1240.472) [-1242.262] -- 0:00:23 632000 -- (-1241.650) (-1240.421) (-1241.343) [-1238.867] * (-1242.348) [-1239.847] (-1237.951) (-1239.780) -- 0:00:23 632500 -- (-1238.551) (-1238.448) [-1240.696] (-1237.478) * (-1239.392) [-1237.536] (-1238.194) (-1240.705) -- 0:00:23 633000 -- [-1239.056] (-1241.687) (-1239.307) (-1237.493) * [-1239.391] (-1238.742) (-1238.304) (-1238.944) -- 0:00:23 633500 -- (-1239.354) (-1237.544) [-1239.285] (-1238.188) * [-1239.284] (-1240.477) (-1238.236) (-1244.290) -- 0:00:23 634000 -- (-1243.351) (-1241.127) [-1240.105] (-1239.833) * (-1239.572) (-1242.586) [-1238.510] (-1246.356) -- 0:00:23 634500 -- (-1242.647) (-1238.505) (-1242.135) [-1242.183] * (-1237.754) (-1239.167) [-1241.043] (-1246.804) -- 0:00:23 635000 -- (-1238.790) [-1238.856] (-1239.781) (-1237.712) * (-1238.764) (-1240.616) [-1239.895] (-1243.652) -- 0:00:23 Average standard deviation of split frequencies: 0.012426 635500 -- (-1240.689) (-1238.337) [-1239.238] (-1240.817) * [-1240.416] (-1239.052) (-1239.145) (-1240.810) -- 0:00:23 636000 -- (-1238.215) [-1238.131] (-1241.486) (-1242.099) * [-1238.794] (-1237.212) (-1237.740) (-1239.847) -- 0:00:23 636500 -- (-1240.576) (-1238.963) [-1239.382] (-1240.723) * (-1239.360) (-1238.216) [-1237.684] (-1240.726) -- 0:00:23 637000 -- [-1243.056] (-1238.927) (-1238.944) (-1238.818) * (-1240.879) (-1239.478) (-1239.634) [-1237.895] -- 0:00:23 637500 -- (-1242.205) (-1240.043) (-1242.924) [-1238.023] * (-1237.851) (-1243.283) [-1240.484] (-1237.963) -- 0:00:23 638000 -- (-1239.338) [-1239.282] (-1240.722) (-1238.338) * (-1239.223) (-1238.925) [-1241.113] (-1239.574) -- 0:00:23 638500 -- (-1240.241) (-1239.928) [-1241.988] (-1240.528) * (-1238.691) (-1238.003) (-1239.786) [-1238.076] -- 0:00:23 639000 -- (-1241.192) (-1239.644) (-1241.549) [-1239.186] * [-1240.937] (-1239.627) (-1241.800) (-1241.500) -- 0:00:23 639500 -- (-1239.572) [-1240.434] (-1239.864) (-1242.879) * (-1241.606) [-1238.404] (-1246.744) (-1239.437) -- 0:00:23 640000 -- (-1239.647) [-1237.943] (-1238.619) (-1241.637) * (-1242.874) (-1242.710) [-1242.491] (-1238.092) -- 0:00:23 Average standard deviation of split frequencies: 0.012552 640500 -- (-1241.142) (-1239.839) (-1239.246) [-1239.124] * (-1238.830) (-1248.231) (-1238.384) [-1241.077] -- 0:00:23 641000 -- (-1239.395) (-1239.773) [-1238.060] (-1237.398) * (-1239.525) [-1240.892] (-1238.347) (-1238.687) -- 0:00:22 641500 -- [-1238.681] (-1238.131) (-1237.639) (-1237.699) * (-1239.285) [-1241.315] (-1237.767) (-1243.634) -- 0:00:22 642000 -- [-1238.692] (-1239.239) (-1238.255) (-1238.278) * [-1238.981] (-1239.969) (-1238.137) (-1240.034) -- 0:00:22 642500 -- (-1240.143) [-1238.399] (-1237.695) (-1237.798) * (-1240.104) (-1238.600) (-1242.507) [-1239.463] -- 0:00:22 643000 -- (-1244.276) [-1242.478] (-1237.770) (-1242.305) * [-1238.704] (-1239.968) (-1238.627) (-1239.812) -- 0:00:22 643500 -- (-1240.427) (-1239.557) (-1239.829) [-1239.360] * (-1240.032) (-1237.016) (-1242.158) [-1238.473] -- 0:00:22 644000 -- (-1239.361) [-1239.626] (-1242.143) (-1243.719) * (-1241.432) (-1237.754) [-1247.668] (-1238.426) -- 0:00:22 644500 -- [-1240.571] (-1240.629) (-1241.654) (-1243.368) * (-1241.107) (-1238.556) (-1239.695) [-1237.678] -- 0:00:22 645000 -- (-1238.405) [-1238.114] (-1241.284) (-1245.730) * (-1239.782) [-1239.273] (-1240.998) (-1244.346) -- 0:00:22 Average standard deviation of split frequencies: 0.012963 645500 -- (-1238.094) [-1237.916] (-1239.001) (-1243.464) * (-1241.145) (-1238.848) (-1238.543) [-1244.093] -- 0:00:22 646000 -- (-1238.750) [-1239.401] (-1238.992) (-1238.938) * (-1240.814) (-1239.296) (-1238.414) [-1237.492] -- 0:00:22 646500 -- [-1240.745] (-1243.733) (-1238.960) (-1241.633) * (-1238.639) (-1239.221) (-1237.632) [-1240.716] -- 0:00:22 647000 -- (-1238.830) (-1242.167) [-1237.699] (-1241.005) * (-1237.682) (-1241.391) [-1238.009] (-1241.856) -- 0:00:22 647500 -- [-1238.965] (-1244.639) (-1240.390) (-1240.758) * [-1239.949] (-1241.128) (-1240.652) (-1240.604) -- 0:00:22 648000 -- (-1239.082) (-1242.574) (-1239.272) [-1240.433] * (-1240.618) (-1241.011) (-1239.343) [-1238.924] -- 0:00:22 648500 -- (-1239.489) (-1246.135) (-1240.074) [-1240.082] * (-1242.140) [-1238.642] (-1238.997) (-1241.435) -- 0:00:22 649000 -- (-1242.241) (-1240.528) [-1239.335] (-1238.498) * [-1239.267] (-1240.999) (-1243.634) (-1242.889) -- 0:00:22 649500 -- (-1239.044) (-1240.057) (-1239.906) [-1238.598] * (-1239.435) [-1239.278] (-1241.139) (-1238.070) -- 0:00:22 650000 -- (-1237.159) (-1243.135) (-1241.130) [-1237.391] * (-1240.529) [-1239.210] (-1239.570) (-1238.220) -- 0:00:22 Average standard deviation of split frequencies: 0.012870 650500 -- (-1237.778) (-1238.150) [-1237.899] (-1240.543) * (-1241.833) (-1237.426) [-1240.880] (-1242.728) -- 0:00:22 651000 -- (-1237.374) (-1238.447) [-1238.025] (-1241.112) * (-1241.830) (-1240.043) [-1237.745] (-1242.083) -- 0:00:22 651500 -- [-1237.330] (-1239.527) (-1241.608) (-1242.881) * (-1241.818) [-1239.902] (-1237.856) (-1239.301) -- 0:00:22 652000 -- [-1238.092] (-1238.552) (-1239.594) (-1239.790) * (-1240.299) (-1237.497) [-1240.009] (-1239.806) -- 0:00:22 652500 -- (-1238.602) [-1237.757] (-1239.816) (-1242.301) * (-1240.580) (-1239.752) (-1245.772) [-1240.215] -- 0:00:22 653000 -- (-1238.857) (-1237.722) [-1237.874] (-1238.397) * (-1242.116) [-1238.721] (-1239.993) (-1239.201) -- 0:00:22 653500 -- (-1239.381) [-1238.610] (-1240.427) (-1239.518) * [-1240.987] (-1241.540) (-1239.251) (-1240.370) -- 0:00:22 654000 -- (-1242.039) [-1238.576] (-1239.498) (-1242.563) * [-1242.109] (-1243.863) (-1238.543) (-1241.920) -- 0:00:22 654500 -- (-1241.107) [-1240.136] (-1242.060) (-1242.881) * (-1238.954) [-1242.295] (-1237.932) (-1239.815) -- 0:00:22 655000 -- [-1238.836] (-1244.417) (-1243.429) (-1239.505) * (-1238.535) (-1242.626) [-1241.774] (-1239.573) -- 0:00:22 Average standard deviation of split frequencies: 0.012512 655500 -- (-1240.922) (-1239.892) (-1237.821) [-1240.352] * [-1237.321] (-1241.167) (-1241.354) (-1238.724) -- 0:00:22 656000 -- (-1238.164) (-1239.695) [-1238.349] (-1240.890) * (-1237.392) (-1241.320) [-1240.495] (-1242.045) -- 0:00:22 656500 -- [-1240.006] (-1239.223) (-1240.415) (-1240.399) * (-1237.320) [-1238.614] (-1238.289) (-1241.640) -- 0:00:21 657000 -- (-1239.398) (-1249.063) (-1241.228) [-1239.871] * (-1238.208) (-1240.630) (-1241.906) [-1239.111] -- 0:00:21 657500 -- (-1245.396) [-1239.346] (-1243.154) (-1241.750) * [-1239.349] (-1239.773) (-1239.803) (-1239.067) -- 0:00:21 658000 -- (-1245.775) (-1239.055) [-1240.469] (-1239.623) * (-1241.432) (-1239.194) (-1239.065) [-1237.308] -- 0:00:21 658500 -- (-1240.762) (-1238.735) [-1244.484] (-1241.861) * (-1240.277) (-1240.858) (-1239.791) [-1237.308] -- 0:00:21 659000 -- (-1239.087) (-1239.471) (-1240.191) [-1240.657] * (-1239.587) (-1238.492) (-1240.224) [-1237.224] -- 0:00:21 659500 -- (-1238.872) (-1240.151) (-1241.150) [-1241.036] * (-1240.573) (-1238.362) [-1239.777] (-1241.736) -- 0:00:21 660000 -- (-1242.345) (-1239.455) (-1239.237) [-1238.226] * (-1240.721) [-1238.435] (-1238.637) (-1240.476) -- 0:00:21 Average standard deviation of split frequencies: 0.012760 660500 -- (-1239.620) (-1239.285) (-1237.710) [-1238.276] * [-1240.075] (-1239.394) (-1237.939) (-1238.184) -- 0:00:21 661000 -- (-1238.305) (-1239.548) (-1237.834) [-1239.482] * [-1238.343] (-1240.281) (-1238.695) (-1238.636) -- 0:00:21 661500 -- (-1238.974) (-1237.794) (-1239.446) [-1240.125] * (-1239.259) [-1238.604] (-1240.876) (-1238.763) -- 0:00:21 662000 -- (-1245.397) (-1239.150) [-1238.433] (-1237.263) * [-1239.784] (-1237.865) (-1239.346) (-1238.608) -- 0:00:21 662500 -- (-1240.072) [-1239.326] (-1240.349) (-1237.264) * (-1244.252) (-1239.954) (-1243.197) [-1239.625] -- 0:00:21 663000 -- (-1240.669) (-1240.871) (-1238.957) [-1240.022] * (-1246.683) (-1241.714) (-1240.475) [-1238.033] -- 0:00:21 663500 -- (-1238.679) (-1238.347) [-1238.616] (-1240.297) * (-1244.321) [-1242.266] (-1240.728) (-1242.943) -- 0:00:21 664000 -- (-1240.152) [-1238.305] (-1238.247) (-1238.856) * [-1243.781] (-1239.629) (-1240.220) (-1244.037) -- 0:00:21 664500 -- [-1237.946] (-1239.071) (-1241.711) (-1239.678) * (-1244.818) (-1241.123) (-1238.178) [-1239.018] -- 0:00:21 665000 -- (-1238.719) (-1239.203) (-1242.864) [-1240.064] * (-1240.119) (-1241.447) [-1237.352] (-1242.030) -- 0:00:21 Average standard deviation of split frequencies: 0.012532 665500 -- (-1239.441) (-1241.014) [-1239.467] (-1241.736) * (-1239.053) (-1238.736) [-1237.633] (-1242.271) -- 0:00:21 666000 -- (-1240.025) (-1238.511) [-1239.879] (-1239.589) * [-1238.871] (-1238.016) (-1239.764) (-1240.449) -- 0:00:21 666500 -- [-1239.893] (-1239.682) (-1238.266) (-1239.424) * (-1239.371) (-1237.891) (-1238.689) [-1237.991] -- 0:00:21 667000 -- (-1237.100) (-1238.662) [-1237.631] (-1238.578) * (-1238.059) [-1240.287] (-1238.748) (-1245.879) -- 0:00:21 667500 -- (-1238.032) (-1238.292) [-1238.671] (-1239.431) * (-1241.731) (-1242.806) [-1237.526] (-1239.398) -- 0:00:21 668000 -- (-1238.125) (-1239.668) (-1239.023) [-1241.550] * (-1239.283) (-1237.935) [-1241.246] (-1239.002) -- 0:00:21 668500 -- [-1238.767] (-1240.056) (-1240.492) (-1239.733) * [-1240.611] (-1239.567) (-1239.284) (-1241.184) -- 0:00:21 669000 -- [-1239.140] (-1242.036) (-1239.209) (-1242.124) * (-1238.888) [-1237.665] (-1241.230) (-1238.695) -- 0:00:21 669500 -- [-1240.410] (-1242.194) (-1238.714) (-1239.100) * [-1240.671] (-1237.831) (-1241.230) (-1238.692) -- 0:00:21 670000 -- (-1238.500) [-1239.137] (-1239.218) (-1238.287) * (-1239.448) (-1238.026) [-1237.383] (-1238.162) -- 0:00:21 Average standard deviation of split frequencies: 0.012528 670500 -- (-1238.012) (-1239.698) (-1239.838) [-1239.320] * (-1237.959) (-1241.564) (-1239.109) [-1238.973] -- 0:00:21 671000 -- (-1239.461) (-1239.849) (-1243.944) [-1240.976] * (-1239.136) (-1241.890) [-1237.964] (-1239.979) -- 0:00:21 671500 -- (-1241.799) (-1240.377) (-1242.367) [-1238.213] * (-1237.788) (-1238.760) (-1242.308) [-1237.427] -- 0:00:21 672000 -- (-1240.508) [-1237.692] (-1241.769) (-1237.500) * (-1238.059) (-1238.535) [-1241.638] (-1242.321) -- 0:00:20 672500 -- (-1246.517) (-1238.026) [-1238.401] (-1238.232) * (-1238.696) (-1242.355) (-1240.458) [-1238.400] -- 0:00:20 673000 -- [-1243.177] (-1242.520) (-1238.210) (-1238.351) * (-1238.209) (-1240.507) [-1240.385] (-1237.612) -- 0:00:20 673500 -- [-1241.183] (-1239.092) (-1239.259) (-1238.947) * [-1237.336] (-1240.041) (-1239.551) (-1239.214) -- 0:00:20 674000 -- (-1239.067) (-1240.331) [-1241.527] (-1241.179) * (-1242.900) (-1239.243) (-1238.826) [-1238.551] -- 0:00:20 674500 -- (-1241.402) [-1239.705] (-1242.270) (-1237.469) * [-1238.654] (-1238.427) (-1238.916) (-1238.936) -- 0:00:20 675000 -- (-1240.299) (-1238.799) [-1237.836] (-1238.253) * [-1242.101] (-1238.433) (-1239.285) (-1239.688) -- 0:00:20 Average standard deviation of split frequencies: 0.013044 675500 -- (-1245.820) (-1238.069) [-1238.387] (-1239.356) * (-1240.799) [-1239.088] (-1239.547) (-1237.343) -- 0:00:20 676000 -- (-1241.323) [-1238.117] (-1238.387) (-1241.059) * [-1239.204] (-1242.766) (-1239.684) (-1239.145) -- 0:00:20 676500 -- (-1239.968) [-1238.747] (-1239.297) (-1238.496) * (-1238.508) (-1239.232) (-1240.799) [-1238.584] -- 0:00:20 677000 -- (-1241.233) [-1238.742] (-1243.092) (-1239.629) * (-1239.085) (-1238.536) (-1240.026) [-1237.755] -- 0:00:20 677500 -- [-1238.419] (-1242.437) (-1238.185) (-1239.274) * (-1237.856) (-1238.097) (-1240.140) [-1237.224] -- 0:00:20 678000 -- (-1239.090) (-1244.662) (-1237.641) [-1238.737] * (-1242.256) [-1238.711] (-1238.543) (-1238.606) -- 0:00:20 678500 -- (-1237.405) [-1239.773] (-1239.165) (-1241.643) * [-1241.962] (-1240.248) (-1238.374) (-1237.641) -- 0:00:20 679000 -- [-1237.665] (-1240.100) (-1238.017) (-1238.458) * (-1242.296) (-1237.928) [-1238.291] (-1237.642) -- 0:00:20 679500 -- (-1241.059) [-1239.232] (-1239.308) (-1242.038) * (-1239.037) [-1238.483] (-1238.451) (-1239.134) -- 0:00:20 680000 -- (-1242.276) (-1238.067) [-1238.503] (-1237.730) * (-1238.601) (-1242.442) (-1241.574) [-1239.879] -- 0:00:20 Average standard deviation of split frequencies: 0.013077 680500 -- (-1240.932) (-1238.724) (-1238.670) [-1237.965] * (-1240.211) (-1239.339) (-1240.028) [-1239.934] -- 0:00:20 681000 -- (-1239.786) [-1238.668] (-1242.166) (-1239.036) * [-1239.492] (-1239.094) (-1240.031) (-1240.224) -- 0:00:20 681500 -- [-1238.573] (-1238.247) (-1242.729) (-1237.706) * (-1239.916) (-1237.058) [-1238.182] (-1242.039) -- 0:00:20 682000 -- (-1237.686) (-1240.047) [-1241.041] (-1239.238) * [-1239.709] (-1245.929) (-1237.603) (-1241.426) -- 0:00:20 682500 -- (-1239.373) (-1237.843) (-1241.208) [-1238.930] * [-1239.498] (-1238.998) (-1238.950) (-1239.426) -- 0:00:20 683000 -- [-1239.637] (-1237.831) (-1239.168) (-1238.275) * (-1238.630) (-1243.423) [-1239.091] (-1241.108) -- 0:00:20 683500 -- [-1241.104] (-1238.429) (-1244.093) (-1239.028) * [-1238.247] (-1240.351) (-1238.765) (-1240.889) -- 0:00:20 684000 -- (-1241.772) [-1240.614] (-1239.840) (-1238.283) * [-1238.975] (-1239.613) (-1239.295) (-1245.492) -- 0:00:20 684500 -- (-1239.704) [-1240.102] (-1239.660) (-1237.570) * [-1240.018] (-1240.561) (-1239.377) (-1246.226) -- 0:00:20 685000 -- (-1240.735) (-1237.377) [-1238.632] (-1238.292) * (-1239.605) (-1239.037) (-1239.718) [-1238.055] -- 0:00:20 Average standard deviation of split frequencies: 0.013097 685500 -- (-1241.851) (-1241.287) [-1237.662] (-1238.765) * (-1238.816) (-1240.714) (-1238.223) [-1238.627] -- 0:00:20 686000 -- (-1238.962) (-1238.332) [-1237.710] (-1238.934) * (-1239.621) (-1241.182) [-1237.886] (-1237.358) -- 0:00:20 686500 -- (-1237.465) [-1238.701] (-1239.254) (-1240.977) * [-1242.821] (-1242.003) (-1245.001) (-1237.774) -- 0:00:20 687000 -- (-1239.906) (-1238.484) [-1237.569] (-1243.435) * [-1237.717] (-1239.531) (-1246.243) (-1239.919) -- 0:00:20 687500 -- [-1238.287] (-1239.449) (-1239.013) (-1242.295) * (-1238.867) (-1238.289) [-1239.140] (-1238.082) -- 0:00:20 688000 -- (-1237.184) (-1239.000) [-1237.579] (-1242.273) * [-1238.788] (-1238.227) (-1238.296) (-1237.707) -- 0:00:19 688500 -- (-1238.314) [-1240.871] (-1238.058) (-1240.716) * (-1240.747) [-1240.431] (-1245.734) (-1239.399) -- 0:00:19 689000 -- (-1239.138) (-1244.440) [-1238.490] (-1239.050) * (-1244.155) (-1241.391) (-1240.533) [-1240.755] -- 0:00:19 689500 -- (-1239.414) (-1244.730) [-1238.083] (-1237.063) * (-1244.215) (-1239.105) [-1240.943] (-1241.944) -- 0:00:19 690000 -- (-1239.407) (-1238.826) (-1239.049) [-1237.986] * [-1239.796] (-1237.995) (-1239.510) (-1238.637) -- 0:00:19 Average standard deviation of split frequencies: 0.013169 690500 -- (-1244.331) (-1239.205) (-1244.651) [-1239.807] * (-1241.972) [-1238.226] (-1238.545) (-1239.547) -- 0:00:19 691000 -- (-1239.959) (-1237.994) [-1240.434] (-1240.406) * (-1241.758) [-1238.338] (-1240.259) (-1240.788) -- 0:00:19 691500 -- (-1238.350) (-1238.104) [-1238.234] (-1238.879) * [-1237.822] (-1237.890) (-1238.773) (-1237.197) -- 0:00:19 692000 -- (-1238.153) (-1238.963) (-1238.679) [-1238.783] * (-1240.035) (-1238.427) (-1239.265) [-1237.508] -- 0:00:19 692500 -- (-1238.361) (-1239.160) (-1237.348) [-1242.319] * [-1239.272] (-1240.103) (-1239.445) (-1237.919) -- 0:00:19 693000 -- [-1238.742] (-1244.647) (-1238.112) (-1237.964) * (-1240.090) (-1237.873) [-1238.950] (-1239.568) -- 0:00:19 693500 -- [-1239.953] (-1238.034) (-1238.859) (-1237.819) * [-1238.564] (-1237.572) (-1240.010) (-1238.113) -- 0:00:19 694000 -- (-1240.937) (-1241.574) [-1239.271] (-1238.718) * [-1238.947] (-1237.830) (-1237.737) (-1241.110) -- 0:00:19 694500 -- [-1240.302] (-1239.273) (-1241.168) (-1238.819) * (-1239.356) (-1238.589) (-1238.004) [-1237.633] -- 0:00:19 695000 -- (-1241.357) (-1243.113) (-1240.898) [-1238.390] * (-1240.496) [-1238.514] (-1239.264) (-1237.584) -- 0:00:19 Average standard deviation of split frequencies: 0.013108 695500 -- (-1244.403) (-1241.366) (-1243.883) [-1239.587] * (-1237.283) (-1239.361) (-1238.521) [-1237.960] -- 0:00:19 696000 -- (-1241.219) (-1241.693) [-1237.987] (-1240.147) * [-1237.654] (-1240.569) (-1238.911) (-1238.614) -- 0:00:19 696500 -- (-1238.869) [-1240.736] (-1237.909) (-1238.395) * (-1238.937) [-1238.024] (-1238.344) (-1239.664) -- 0:00:19 697000 -- [-1239.245] (-1238.768) (-1238.126) (-1240.882) * (-1239.743) (-1238.293) [-1239.793] (-1239.699) -- 0:00:19 697500 -- [-1238.288] (-1238.584) (-1239.017) (-1239.446) * (-1240.546) (-1237.269) (-1238.816) [-1238.203] -- 0:00:19 698000 -- (-1238.557) [-1238.370] (-1237.230) (-1240.619) * (-1238.937) [-1238.089] (-1239.932) (-1239.343) -- 0:00:19 698500 -- [-1240.698] (-1239.863) (-1240.263) (-1238.472) * (-1240.035) [-1237.841] (-1239.398) (-1237.910) -- 0:00:19 699000 -- (-1238.173) [-1239.483] (-1239.147) (-1239.173) * (-1238.801) (-1238.315) (-1242.415) [-1238.401] -- 0:00:19 699500 -- [-1237.452] (-1238.867) (-1239.127) (-1237.526) * (-1241.345) (-1239.967) (-1243.098) [-1237.846] -- 0:00:19 700000 -- [-1241.015] (-1238.870) (-1238.609) (-1241.016) * (-1238.265) (-1240.369) (-1242.918) [-1238.647] -- 0:00:19 Average standard deviation of split frequencies: 0.012704 700500 -- [-1240.313] (-1240.448) (-1243.173) (-1241.350) * (-1238.704) (-1241.856) (-1240.533) [-1240.804] -- 0:00:19 701000 -- [-1238.556] (-1239.843) (-1240.693) (-1243.844) * [-1238.685] (-1241.929) (-1238.679) (-1239.116) -- 0:00:19 701500 -- (-1239.150) (-1238.837) [-1243.850] (-1240.050) * (-1238.616) (-1241.920) [-1244.230] (-1240.818) -- 0:00:19 702000 -- (-1239.915) (-1240.925) (-1241.347) [-1241.036] * (-1238.904) [-1240.679] (-1244.167) (-1238.762) -- 0:00:19 702500 -- (-1239.058) (-1240.434) [-1238.091] (-1240.434) * (-1239.449) [-1240.686] (-1240.494) (-1239.295) -- 0:00:19 703000 -- [-1237.375] (-1243.060) (-1238.811) (-1237.219) * (-1239.073) (-1242.659) (-1238.024) [-1237.892] -- 0:00:19 703500 -- (-1243.204) (-1239.302) (-1240.435) [-1238.685] * (-1238.080) (-1243.158) (-1238.211) [-1237.700] -- 0:00:18 704000 -- (-1242.534) (-1238.493) [-1240.696] (-1239.019) * (-1237.404) (-1241.347) [-1237.972] (-1240.821) -- 0:00:18 704500 -- (-1240.520) (-1238.463) (-1242.132) [-1240.818] * [-1244.715] (-1238.708) (-1237.396) (-1243.120) -- 0:00:18 705000 -- [-1239.048] (-1242.036) (-1246.362) (-1237.466) * (-1244.862) (-1237.908) (-1241.363) [-1239.530] -- 0:00:18 Average standard deviation of split frequencies: 0.012464 705500 -- (-1242.359) (-1237.122) (-1246.757) [-1243.314] * (-1240.313) (-1240.911) (-1241.944) [-1237.393] -- 0:00:18 706000 -- [-1238.473] (-1239.211) (-1243.727) (-1239.134) * [-1241.108] (-1241.263) (-1241.432) (-1239.151) -- 0:00:18 706500 -- (-1238.658) [-1239.231] (-1238.882) (-1241.149) * (-1240.153) [-1238.861] (-1240.594) (-1239.038) -- 0:00:18 707000 -- (-1240.153) (-1238.301) (-1242.229) [-1238.972] * [-1238.973] (-1243.596) (-1239.371) (-1237.735) -- 0:00:18 707500 -- (-1239.563) (-1238.876) (-1240.634) [-1239.869] * (-1239.352) [-1239.268] (-1242.988) (-1240.494) -- 0:00:18 708000 -- [-1240.853] (-1237.918) (-1239.624) (-1241.030) * (-1241.968) [-1239.108] (-1240.372) (-1240.622) -- 0:00:18 708500 -- (-1239.368) (-1238.019) (-1241.605) [-1237.445] * (-1241.080) (-1243.612) [-1237.743] (-1241.791) -- 0:00:18 709000 -- [-1240.117] (-1240.133) (-1240.033) (-1238.001) * (-1239.739) (-1240.754) [-1238.549] (-1238.171) -- 0:00:18 709500 -- (-1238.667) [-1240.477] (-1238.967) (-1238.532) * (-1241.293) [-1243.753] (-1240.261) (-1241.767) -- 0:00:18 710000 -- (-1237.749) (-1240.864) [-1239.318] (-1238.677) * (-1242.135) [-1238.354] (-1239.870) (-1239.636) -- 0:00:18 Average standard deviation of split frequencies: 0.012014 710500 -- (-1237.984) [-1240.156] (-1239.297) (-1242.457) * (-1239.715) [-1238.573] (-1240.704) (-1238.267) -- 0:00:18 711000 -- (-1239.010) (-1239.308) [-1238.849] (-1243.742) * (-1240.565) (-1240.370) (-1240.584) [-1238.621] -- 0:00:18 711500 -- [-1241.415] (-1239.284) (-1239.212) (-1241.619) * (-1243.703) (-1238.842) [-1239.109] (-1239.321) -- 0:00:18 712000 -- [-1241.701] (-1240.670) (-1238.810) (-1238.693) * (-1242.392) (-1238.390) [-1240.394] (-1242.684) -- 0:00:18 712500 -- (-1240.276) (-1240.167) (-1237.761) [-1238.817] * (-1240.357) (-1238.014) (-1238.050) [-1241.349] -- 0:00:18 713000 -- (-1240.300) (-1241.962) [-1241.232] (-1240.900) * [-1242.109] (-1241.471) (-1238.460) (-1240.588) -- 0:00:18 713500 -- [-1240.138] (-1240.380) (-1237.809) (-1238.581) * (-1239.050) (-1237.956) [-1238.029] (-1240.084) -- 0:00:18 714000 -- (-1239.207) [-1237.449] (-1237.653) (-1238.042) * (-1238.700) (-1243.014) (-1238.063) [-1238.663] -- 0:00:18 714500 -- (-1238.775) [-1238.440] (-1242.655) (-1237.820) * [-1238.882] (-1238.329) (-1240.373) (-1237.619) -- 0:00:18 715000 -- (-1240.368) [-1239.333] (-1242.766) (-1238.965) * (-1238.515) (-1240.171) (-1239.666) [-1238.973] -- 0:00:18 Average standard deviation of split frequencies: 0.012107 715500 -- (-1238.371) [-1239.412] (-1243.886) (-1240.182) * (-1238.474) (-1239.086) [-1242.551] (-1238.975) -- 0:00:18 716000 -- [-1237.503] (-1238.142) (-1241.322) (-1239.583) * (-1239.184) (-1241.744) [-1239.512] (-1240.007) -- 0:00:18 716500 -- (-1238.016) [-1241.563] (-1237.829) (-1240.314) * (-1241.807) [-1244.179] (-1240.063) (-1238.879) -- 0:00:18 717000 -- [-1242.322] (-1237.634) (-1237.784) (-1238.672) * (-1240.971) (-1246.052) (-1242.258) [-1238.150] -- 0:00:18 717500 -- [-1241.319] (-1241.103) (-1239.611) (-1245.907) * [-1240.644] (-1238.144) (-1243.692) (-1241.274) -- 0:00:18 718000 -- [-1242.919] (-1241.245) (-1238.642) (-1238.556) * [-1239.514] (-1238.056) (-1243.184) (-1239.545) -- 0:00:18 718500 -- (-1240.621) (-1238.256) [-1238.633] (-1240.291) * (-1238.407) [-1238.083] (-1239.628) (-1241.351) -- 0:00:18 719000 -- (-1238.482) (-1238.785) (-1241.195) [-1238.719] * [-1240.620] (-1239.498) (-1238.707) (-1240.477) -- 0:00:17 719500 -- (-1242.840) (-1239.069) (-1242.173) [-1240.088] * (-1241.637) (-1238.565) (-1237.679) [-1241.670] -- 0:00:17 720000 -- (-1241.990) (-1241.174) (-1240.081) [-1239.241] * (-1237.447) (-1238.891) [-1238.439] (-1239.278) -- 0:00:17 Average standard deviation of split frequencies: 0.010812 720500 -- (-1240.581) (-1240.212) (-1242.207) [-1238.855] * (-1239.155) [-1239.247] (-1239.609) (-1244.211) -- 0:00:17 721000 -- [-1239.279] (-1240.756) (-1239.950) (-1238.534) * [-1240.437] (-1237.107) (-1239.127) (-1238.548) -- 0:00:17 721500 -- (-1237.780) [-1239.555] (-1238.362) (-1239.071) * [-1239.053] (-1237.528) (-1237.855) (-1238.536) -- 0:00:17 722000 -- [-1239.318] (-1238.472) (-1240.357) (-1238.741) * [-1240.612] (-1238.041) (-1239.713) (-1238.418) -- 0:00:17 722500 -- (-1240.334) (-1240.194) (-1240.236) [-1240.477] * (-1239.645) [-1238.634] (-1239.068) (-1239.688) -- 0:00:17 723000 -- (-1238.939) (-1238.269) (-1239.750) [-1239.290] * (-1237.697) (-1240.800) [-1238.327] (-1244.190) -- 0:00:17 723500 -- [-1238.415] (-1243.448) (-1242.360) (-1240.942) * (-1240.210) [-1239.526] (-1238.030) (-1240.002) -- 0:00:17 724000 -- (-1238.427) (-1239.376) [-1241.600] (-1239.671) * (-1241.213) (-1238.993) [-1238.928] (-1240.809) -- 0:00:17 724500 -- (-1241.626) (-1240.482) (-1239.749) [-1239.251] * [-1238.310] (-1237.893) (-1239.092) (-1237.702) -- 0:00:17 725000 -- (-1244.661) (-1241.058) [-1240.228] (-1239.198) * (-1238.983) [-1241.068] (-1241.615) (-1241.208) -- 0:00:17 Average standard deviation of split frequencies: 0.011255 725500 -- [-1239.544] (-1238.008) (-1238.808) (-1237.586) * (-1239.913) [-1239.685] (-1241.283) (-1237.912) -- 0:00:17 726000 -- [-1240.839] (-1242.128) (-1237.900) (-1237.685) * [-1237.345] (-1237.494) (-1239.303) (-1237.776) -- 0:00:17 726500 -- [-1240.037] (-1237.680) (-1238.866) (-1242.745) * (-1237.804) [-1238.318] (-1241.969) (-1240.869) -- 0:00:17 727000 -- (-1242.513) [-1238.002] (-1242.115) (-1240.305) * [-1238.538] (-1238.166) (-1238.459) (-1238.897) -- 0:00:17 727500 -- (-1238.570) (-1237.680) (-1240.596) [-1240.996] * [-1238.972] (-1241.603) (-1243.500) (-1242.217) -- 0:00:17 728000 -- (-1245.299) (-1238.697) (-1239.744) [-1237.319] * (-1239.736) (-1237.864) [-1238.647] (-1244.131) -- 0:00:17 728500 -- [-1241.704] (-1238.528) (-1240.072) (-1240.126) * (-1239.523) (-1240.833) (-1239.525) [-1244.034] -- 0:00:17 729000 -- (-1244.971) (-1240.193) [-1238.463] (-1246.381) * [-1238.285] (-1241.928) (-1239.301) (-1244.665) -- 0:00:17 729500 -- [-1242.831] (-1239.236) (-1237.866) (-1238.286) * (-1239.099) (-1242.205) (-1242.934) [-1240.304] -- 0:00:17 730000 -- (-1238.286) (-1240.194) (-1237.875) [-1238.492] * (-1238.174) [-1239.820] (-1241.831) (-1241.003) -- 0:00:17 Average standard deviation of split frequencies: 0.011347 730500 -- (-1241.585) (-1237.455) [-1239.825] (-1239.797) * (-1238.030) (-1237.380) (-1238.442) [-1237.755] -- 0:00:17 731000 -- (-1239.440) (-1238.007) (-1238.572) [-1239.368] * (-1239.491) [-1238.304] (-1237.175) (-1238.397) -- 0:00:17 731500 -- (-1239.311) (-1238.169) [-1237.483] (-1239.449) * (-1240.721) (-1238.587) [-1239.563] (-1241.381) -- 0:00:17 732000 -- [-1237.848] (-1240.778) (-1240.027) (-1240.475) * [-1238.165] (-1238.596) (-1238.628) (-1241.250) -- 0:00:17 732500 -- (-1245.277) (-1238.696) [-1239.910] (-1238.022) * (-1239.155) (-1237.925) [-1238.082] (-1239.076) -- 0:00:17 733000 -- (-1240.771) [-1239.479] (-1237.129) (-1237.758) * [-1238.799] (-1238.443) (-1239.202) (-1238.747) -- 0:00:17 733500 -- (-1244.416) (-1239.898) (-1243.531) [-1237.821] * [-1240.431] (-1238.247) (-1238.784) (-1239.868) -- 0:00:17 734000 -- [-1241.384] (-1237.429) (-1239.858) (-1237.483) * [-1238.471] (-1239.747) (-1241.592) (-1237.928) -- 0:00:17 734500 -- [-1242.043] (-1238.551) (-1242.834) (-1239.564) * (-1237.466) [-1240.519] (-1239.177) (-1241.076) -- 0:00:16 735000 -- (-1243.918) (-1238.549) [-1239.554] (-1239.643) * [-1237.772] (-1239.040) (-1240.537) (-1238.928) -- 0:00:16 Average standard deviation of split frequencies: 0.010851 735500 -- (-1240.279) (-1240.929) (-1243.549) [-1238.783] * (-1239.462) (-1241.159) (-1239.412) [-1238.480] -- 0:00:16 736000 -- [-1237.140] (-1237.956) (-1239.041) (-1239.822) * (-1239.602) (-1238.138) (-1242.565) [-1238.920] -- 0:00:16 736500 -- (-1237.749) (-1238.435) [-1240.006] (-1238.773) * (-1239.520) (-1238.880) (-1240.480) [-1238.583] -- 0:00:16 737000 -- [-1240.055] (-1240.849) (-1240.890) (-1238.725) * [-1240.064] (-1238.748) (-1238.906) (-1239.505) -- 0:00:16 737500 -- (-1239.588) [-1237.937] (-1237.614) (-1240.395) * (-1238.193) (-1238.991) [-1238.907] (-1241.516) -- 0:00:16 738000 -- (-1239.199) (-1240.018) (-1237.584) [-1239.763] * (-1241.054) [-1238.296] (-1238.552) (-1239.410) -- 0:00:16 738500 -- (-1237.800) (-1240.261) [-1240.287] (-1239.605) * [-1240.624] (-1240.106) (-1239.277) (-1239.174) -- 0:00:16 739000 -- [-1237.685] (-1244.053) (-1238.148) (-1238.445) * (-1239.750) [-1238.819] (-1240.651) (-1239.220) -- 0:00:16 739500 -- (-1240.080) (-1239.230) [-1240.169] (-1238.471) * (-1238.193) (-1238.229) [-1238.304] (-1239.655) -- 0:00:16 740000 -- (-1240.269) [-1238.805] (-1238.979) (-1240.602) * (-1239.325) (-1237.465) [-1238.619] (-1239.683) -- 0:00:16 Average standard deviation of split frequencies: 0.010024 740500 -- [-1237.558] (-1241.451) (-1238.344) (-1238.485) * (-1238.169) (-1237.460) (-1238.215) [-1238.741] -- 0:00:16 741000 -- (-1240.674) [-1240.567] (-1241.270) (-1239.470) * (-1240.616) [-1238.611] (-1240.997) (-1239.664) -- 0:00:16 741500 -- [-1237.924] (-1242.285) (-1240.208) (-1238.491) * [-1238.271] (-1238.538) (-1238.753) (-1237.634) -- 0:00:16 742000 -- [-1238.577] (-1246.191) (-1241.009) (-1238.913) * [-1237.904] (-1238.823) (-1239.225) (-1238.308) -- 0:00:16 742500 -- [-1238.677] (-1243.199) (-1240.493) (-1238.854) * [-1239.003] (-1238.422) (-1239.831) (-1238.705) -- 0:00:16 743000 -- (-1241.616) (-1244.011) (-1244.100) [-1240.076] * (-1237.765) (-1239.163) [-1238.056] (-1238.806) -- 0:00:16 743500 -- (-1242.044) (-1239.261) [-1238.601] (-1240.128) * (-1237.968) [-1239.727] (-1239.554) (-1239.245) -- 0:00:16 744000 -- [-1239.393] (-1238.795) (-1238.368) (-1237.807) * [-1237.968] (-1241.052) (-1239.250) (-1240.282) -- 0:00:16 744500 -- (-1239.803) [-1237.639] (-1245.159) (-1238.144) * (-1239.745) (-1243.641) [-1238.085] (-1239.306) -- 0:00:16 745000 -- (-1240.049) (-1241.190) [-1241.037] (-1238.332) * (-1239.051) [-1246.175] (-1238.777) (-1239.503) -- 0:00:16 Average standard deviation of split frequencies: 0.009813 745500 -- (-1240.872) (-1238.514) (-1239.675) [-1238.709] * (-1241.622) (-1240.745) [-1240.227] (-1240.512) -- 0:00:16 746000 -- (-1239.722) (-1238.091) [-1241.213] (-1239.440) * (-1240.562) [-1239.984] (-1243.983) (-1240.550) -- 0:00:16 746500 -- [-1238.445] (-1239.105) (-1241.865) (-1238.681) * [-1238.865] (-1237.972) (-1239.019) (-1239.306) -- 0:00:16 747000 -- (-1239.949) (-1238.834) [-1237.350] (-1240.946) * [-1240.060] (-1240.485) (-1241.908) (-1240.317) -- 0:00:16 747500 -- (-1239.016) (-1237.492) (-1241.002) [-1238.808] * (-1239.267) (-1238.840) [-1240.968] (-1241.211) -- 0:00:16 748000 -- (-1238.111) [-1245.675] (-1240.503) (-1239.220) * (-1239.300) (-1238.376) [-1238.996] (-1240.656) -- 0:00:16 748500 -- (-1240.190) (-1241.029) (-1239.062) [-1238.326] * [-1240.467] (-1240.524) (-1237.633) (-1242.582) -- 0:00:16 749000 -- (-1237.977) (-1239.686) (-1238.413) [-1237.758] * [-1240.984] (-1238.713) (-1240.075) (-1240.287) -- 0:00:16 749500 -- (-1242.440) (-1240.183) (-1239.571) [-1237.790] * [-1239.989] (-1240.396) (-1244.741) (-1241.081) -- 0:00:16 750000 -- [-1237.398] (-1241.639) (-1239.202) (-1241.483) * [-1240.912] (-1237.474) (-1241.824) (-1240.742) -- 0:00:16 Average standard deviation of split frequencies: 0.009604 750500 -- (-1239.043) [-1238.513] (-1241.977) (-1239.571) * (-1240.337) [-1239.597] (-1243.136) (-1238.286) -- 0:00:15 751000 -- [-1241.643] (-1241.937) (-1240.270) (-1243.740) * [-1240.105] (-1241.393) (-1241.867) (-1240.517) -- 0:00:15 751500 -- (-1237.912) (-1239.696) [-1239.305] (-1240.816) * [-1238.701] (-1237.910) (-1237.600) (-1241.573) -- 0:00:15 752000 -- (-1239.581) (-1237.658) [-1241.973] (-1237.900) * (-1237.228) (-1239.030) [-1238.294] (-1241.638) -- 0:00:15 752500 -- [-1238.936] (-1239.155) (-1238.568) (-1247.185) * (-1240.832) (-1243.032) (-1238.098) [-1238.709] -- 0:00:15 753000 -- [-1237.569] (-1239.882) (-1239.731) (-1245.248) * [-1241.725] (-1241.204) (-1239.172) (-1237.807) -- 0:00:15 753500 -- (-1239.642) (-1239.166) (-1238.621) [-1237.802] * (-1238.984) [-1242.918] (-1240.254) (-1239.981) -- 0:00:15 754000 -- (-1241.339) [-1238.763] (-1239.516) (-1237.191) * [-1240.715] (-1239.777) (-1237.826) (-1239.159) -- 0:00:15 754500 -- (-1238.508) (-1238.022) (-1240.277) [-1243.375] * [-1240.743] (-1239.611) (-1237.566) (-1240.273) -- 0:00:15 755000 -- [-1240.235] (-1240.279) (-1241.275) (-1241.577) * (-1239.824) (-1239.261) (-1238.485) [-1243.081] -- 0:00:15 Average standard deviation of split frequencies: 0.010124 755500 -- [-1238.597] (-1240.547) (-1247.369) (-1238.541) * (-1238.980) (-1242.375) [-1240.905] (-1238.828) -- 0:00:15 756000 -- [-1238.056] (-1241.871) (-1243.968) (-1243.292) * (-1242.896) (-1243.733) (-1242.588) [-1237.863] -- 0:00:15 756500 -- [-1240.522] (-1241.932) (-1244.935) (-1247.153) * (-1239.549) (-1241.810) (-1240.275) [-1237.541] -- 0:00:15 757000 -- [-1238.397] (-1238.306) (-1239.206) (-1242.985) * [-1238.840] (-1239.044) (-1238.430) (-1239.445) -- 0:00:15 757500 -- (-1241.377) (-1238.524) [-1238.103] (-1238.468) * (-1240.306) (-1239.281) (-1238.491) [-1237.714] -- 0:00:15 758000 -- (-1241.469) (-1238.048) (-1240.639) [-1237.976] * [-1241.105] (-1238.033) (-1240.335) (-1239.631) -- 0:00:15 758500 -- (-1239.521) (-1238.975) (-1245.317) [-1240.082] * [-1241.176] (-1238.033) (-1241.263) (-1241.493) -- 0:00:15 759000 -- (-1240.664) [-1239.862] (-1240.646) (-1240.003) * (-1240.301) [-1239.018] (-1239.195) (-1242.902) -- 0:00:15 759500 -- [-1239.618] (-1240.098) (-1238.930) (-1239.152) * (-1239.870) (-1239.408) [-1239.350] (-1240.475) -- 0:00:15 760000 -- (-1239.582) (-1241.897) [-1239.008] (-1241.686) * (-1237.880) (-1241.850) [-1239.163] (-1239.416) -- 0:00:15 Average standard deviation of split frequencies: 0.009799 760500 -- (-1240.316) (-1237.936) (-1240.176) [-1239.730] * [-1244.145] (-1243.039) (-1239.601) (-1240.973) -- 0:00:15 761000 -- [-1239.369] (-1238.474) (-1241.929) (-1238.035) * (-1243.101) (-1237.820) (-1237.970) [-1245.065] -- 0:00:15 761500 -- (-1237.693) (-1238.901) (-1239.589) [-1238.687] * (-1241.758) (-1238.981) [-1237.282] (-1241.637) -- 0:00:15 762000 -- (-1239.899) (-1241.614) (-1238.369) [-1238.680] * [-1238.432] (-1240.336) (-1240.022) (-1239.284) -- 0:00:15 762500 -- (-1238.640) (-1240.256) [-1239.054] (-1241.017) * (-1237.718) (-1238.903) [-1240.248] (-1237.716) -- 0:00:15 763000 -- (-1237.528) (-1238.394) (-1239.414) [-1238.251] * [-1237.002] (-1239.234) (-1237.953) (-1237.716) -- 0:00:15 763500 -- (-1238.747) [-1237.921] (-1240.688) (-1238.116) * [-1241.050] (-1238.701) (-1238.589) (-1237.662) -- 0:00:15 764000 -- (-1239.543) [-1239.506] (-1241.512) (-1238.209) * (-1239.016) (-1238.979) (-1240.217) [-1240.391] -- 0:00:15 764500 -- (-1240.802) [-1238.971] (-1240.979) (-1240.404) * [-1238.637] (-1238.181) (-1238.868) (-1245.150) -- 0:00:15 765000 -- (-1240.322) (-1239.087) (-1240.793) [-1241.754] * (-1238.921) [-1238.547] (-1238.521) (-1241.675) -- 0:00:15 Average standard deviation of split frequencies: 0.010172 765500 -- [-1240.801] (-1238.084) (-1238.727) (-1240.101) * (-1242.584) (-1238.413) (-1238.008) [-1240.621] -- 0:00:15 766000 -- (-1240.238) [-1237.673] (-1240.979) (-1241.269) * [-1241.055] (-1238.808) (-1237.587) (-1238.863) -- 0:00:14 766500 -- (-1240.335) [-1237.641] (-1242.676) (-1243.930) * [-1239.810] (-1240.248) (-1238.256) (-1237.812) -- 0:00:14 767000 -- (-1239.514) (-1238.204) (-1239.215) [-1237.786] * (-1240.876) [-1238.066] (-1238.148) (-1242.723) -- 0:00:14 767500 -- (-1238.144) (-1238.778) (-1246.764) [-1242.889] * (-1237.753) (-1238.033) (-1238.519) [-1241.298] -- 0:00:14 768000 -- (-1237.608) (-1239.732) (-1241.271) [-1238.599] * (-1241.426) (-1239.232) (-1238.663) [-1240.193] -- 0:00:14 768500 -- [-1237.949] (-1240.989) (-1238.369) (-1239.023) * [-1240.623] (-1245.576) (-1239.337) (-1239.853) -- 0:00:14 769000 -- [-1239.925] (-1239.664) (-1240.865) (-1238.498) * [-1240.687] (-1246.044) (-1237.941) (-1242.821) -- 0:00:14 769500 -- [-1241.313] (-1240.067) (-1239.572) (-1242.150) * (-1242.111) [-1237.713] (-1239.108) (-1237.718) -- 0:00:14 770000 -- [-1239.719] (-1240.460) (-1241.662) (-1241.805) * (-1238.715) [-1238.719] (-1238.164) (-1240.394) -- 0:00:14 Average standard deviation of split frequencies: 0.010475 770500 -- (-1243.355) (-1238.383) [-1238.401] (-1243.614) * (-1237.834) (-1238.947) [-1238.121] (-1245.255) -- 0:00:14 771000 -- (-1238.087) (-1238.647) [-1237.926] (-1238.905) * (-1237.937) [-1239.956] (-1239.010) (-1246.344) -- 0:00:14 771500 -- (-1238.507) [-1239.354] (-1238.120) (-1241.941) * (-1240.393) [-1241.199] (-1237.955) (-1240.556) -- 0:00:14 772000 -- (-1237.682) (-1242.643) [-1237.290] (-1243.636) * (-1240.455) (-1247.661) (-1240.428) [-1239.230] -- 0:00:14 772500 -- [-1239.404] (-1241.942) (-1240.858) (-1240.878) * (-1239.287) [-1243.545] (-1241.115) (-1242.397) -- 0:00:14 773000 -- (-1240.084) (-1237.978) [-1238.090] (-1239.706) * (-1240.344) (-1243.469) [-1238.341] (-1238.137) -- 0:00:14 773500 -- (-1237.743) (-1238.389) (-1238.408) [-1241.065] * (-1240.364) [-1237.878] (-1241.312) (-1241.070) -- 0:00:14 774000 -- (-1239.436) (-1239.494) (-1239.503) [-1242.724] * (-1242.030) [-1236.998] (-1244.018) (-1239.045) -- 0:00:14 774500 -- (-1239.906) [-1239.233] (-1238.665) (-1238.288) * (-1238.783) [-1237.551] (-1239.106) (-1242.910) -- 0:00:14 775000 -- (-1240.413) [-1239.088] (-1238.282) (-1237.761) * [-1239.756] (-1239.155) (-1239.095) (-1238.549) -- 0:00:14 Average standard deviation of split frequencies: 0.010327 775500 -- (-1242.183) (-1237.752) (-1237.739) [-1238.114] * (-1238.990) (-1239.968) [-1241.543] (-1241.685) -- 0:00:14 776000 -- (-1239.504) (-1240.442) (-1237.044) [-1237.904] * (-1238.290) [-1239.081] (-1241.524) (-1240.838) -- 0:00:14 776500 -- (-1238.154) (-1239.938) [-1237.471] (-1240.578) * (-1237.751) [-1241.268] (-1241.858) (-1239.930) -- 0:00:14 777000 -- [-1238.924] (-1238.733) (-1242.307) (-1241.136) * (-1237.361) (-1239.283) (-1239.839) [-1239.146] -- 0:00:14 777500 -- [-1238.634] (-1239.162) (-1237.736) (-1240.368) * (-1237.703) (-1242.265) (-1237.889) [-1241.747] -- 0:00:14 778000 -- (-1240.621) [-1239.836] (-1238.818) (-1241.892) * [-1239.074] (-1240.088) (-1239.665) (-1240.318) -- 0:00:14 778500 -- (-1241.087) (-1239.973) (-1241.255) [-1238.828] * (-1238.197) [-1238.400] (-1241.049) (-1240.614) -- 0:00:14 779000 -- (-1240.499) [-1240.121] (-1239.990) (-1241.399) * (-1237.961) [-1238.946] (-1238.554) (-1238.304) -- 0:00:14 779500 -- (-1240.723) (-1237.681) [-1238.165] (-1239.917) * (-1238.411) (-1237.608) (-1240.966) [-1237.765] -- 0:00:14 780000 -- (-1240.501) (-1239.013) [-1240.360] (-1238.039) * (-1240.671) (-1238.789) (-1238.284) [-1237.650] -- 0:00:14 Average standard deviation of split frequencies: 0.010708 780500 -- [-1241.158] (-1241.391) (-1239.979) (-1239.892) * [-1237.435] (-1241.034) (-1239.201) (-1237.760) -- 0:00:14 781000 -- (-1238.035) (-1238.695) [-1238.933] (-1240.436) * (-1240.747) (-1238.620) (-1237.639) [-1237.728] -- 0:00:14 781500 -- (-1240.125) (-1241.887) (-1240.673) [-1240.719] * (-1243.807) (-1237.450) [-1238.662] (-1237.926) -- 0:00:13 782000 -- (-1238.252) [-1240.879] (-1242.518) (-1243.934) * (-1238.080) (-1240.050) [-1237.734] (-1240.172) -- 0:00:13 782500 -- (-1238.766) [-1241.034] (-1245.212) (-1241.342) * [-1239.735] (-1239.110) (-1238.345) (-1238.648) -- 0:00:13 783000 -- [-1240.583] (-1242.199) (-1242.849) (-1239.627) * (-1237.405) (-1241.788) [-1240.821] (-1243.805) -- 0:00:13 783500 -- (-1239.366) (-1239.373) [-1240.119] (-1241.271) * [-1238.840] (-1240.106) (-1239.480) (-1237.572) -- 0:00:13 784000 -- [-1239.831] (-1238.886) (-1239.084) (-1239.278) * (-1239.016) (-1240.954) (-1239.345) [-1238.007] -- 0:00:13 784500 -- [-1238.899] (-1237.510) (-1238.480) (-1243.642) * (-1240.251) (-1240.452) [-1238.187] (-1238.008) -- 0:00:13 785000 -- (-1239.132) [-1239.950] (-1240.209) (-1238.828) * (-1241.390) (-1239.615) (-1238.039) [-1239.271] -- 0:00:13 Average standard deviation of split frequencies: 0.010725 785500 -- [-1240.435] (-1246.411) (-1240.190) (-1240.245) * (-1241.468) [-1242.904] (-1243.236) (-1239.239) -- 0:00:13 786000 -- (-1242.151) (-1242.386) [-1238.395] (-1237.795) * [-1243.549] (-1239.374) (-1239.173) (-1237.674) -- 0:00:13 786500 -- (-1238.465) (-1239.845) [-1240.441] (-1237.905) * (-1238.696) (-1241.704) (-1238.810) [-1237.948] -- 0:00:13 787000 -- (-1240.525) [-1237.566] (-1240.329) (-1237.804) * [-1238.507] (-1246.140) (-1239.472) (-1239.911) -- 0:00:13 787500 -- (-1242.042) [-1238.310] (-1237.511) (-1238.186) * (-1240.054) (-1244.193) [-1239.973] (-1240.280) -- 0:00:13 788000 -- (-1239.725) (-1238.704) (-1244.687) [-1238.929] * (-1238.832) [-1240.119] (-1240.935) (-1240.331) -- 0:00:13 788500 -- (-1240.735) [-1239.381] (-1244.932) (-1240.031) * (-1238.662) (-1241.810) (-1242.495) [-1239.556] -- 0:00:13 789000 -- (-1238.626) (-1237.961) (-1241.263) [-1237.456] * (-1238.510) (-1239.212) [-1240.615] (-1239.587) -- 0:00:13 789500 -- (-1239.363) (-1237.981) [-1240.056] (-1238.993) * (-1239.163) [-1240.340] (-1245.040) (-1239.524) -- 0:00:13 790000 -- (-1238.198) (-1240.273) (-1237.757) [-1239.639] * [-1240.463] (-1239.219) (-1240.517) (-1240.275) -- 0:00:13 Average standard deviation of split frequencies: 0.010918 790500 -- [-1237.524] (-1240.624) (-1238.566) (-1242.247) * (-1239.089) (-1237.707) (-1239.031) [-1238.532] -- 0:00:13 791000 -- [-1238.230] (-1238.240) (-1240.594) (-1238.877) * (-1238.149) (-1240.069) [-1237.417] (-1237.823) -- 0:00:13 791500 -- (-1238.354) (-1237.917) (-1240.345) [-1239.172] * (-1239.726) (-1239.138) [-1239.406] (-1237.338) -- 0:00:13 792000 -- (-1243.764) (-1239.580) (-1239.773) [-1241.175] * (-1239.414) (-1240.089) [-1238.636] (-1237.685) -- 0:00:13 792500 -- (-1242.830) (-1240.060) (-1238.527) [-1239.624] * (-1243.240) (-1241.005) (-1240.228) [-1238.323] -- 0:00:13 793000 -- (-1241.079) (-1239.260) [-1237.981] (-1237.617) * [-1238.828] (-1241.542) (-1237.912) (-1243.917) -- 0:00:13 793500 -- (-1239.984) (-1239.454) [-1238.422] (-1237.956) * [-1238.332] (-1244.071) (-1239.276) (-1239.337) -- 0:00:13 794000 -- [-1238.541] (-1240.800) (-1243.557) (-1239.669) * (-1239.684) (-1241.852) (-1237.164) [-1237.549] -- 0:00:13 794500 -- (-1238.810) (-1239.714) (-1240.254) [-1238.961] * [-1238.878] (-1243.128) (-1238.940) (-1237.367) -- 0:00:13 795000 -- (-1237.955) (-1239.144) (-1241.457) [-1238.827] * (-1241.040) [-1239.796] (-1239.177) (-1241.478) -- 0:00:13 Average standard deviation of split frequencies: 0.010475 795500 -- [-1237.309] (-1241.470) (-1239.121) (-1241.211) * [-1240.074] (-1241.537) (-1242.875) (-1241.048) -- 0:00:13 796000 -- (-1237.988) (-1240.275) [-1237.442] (-1242.148) * (-1239.458) (-1239.100) [-1241.661] (-1241.390) -- 0:00:13 796500 -- (-1239.923) [-1240.446] (-1238.786) (-1238.175) * [-1239.345] (-1238.934) (-1247.092) (-1239.768) -- 0:00:13 797000 -- (-1241.261) [-1237.965] (-1238.677) (-1240.818) * [-1239.668] (-1239.836) (-1239.678) (-1239.696) -- 0:00:12 797500 -- (-1241.053) (-1239.021) [-1241.679] (-1238.102) * (-1240.294) [-1238.772] (-1238.816) (-1239.326) -- 0:00:12 798000 -- (-1242.058) [-1238.937] (-1237.620) (-1237.288) * (-1239.938) [-1241.456] (-1238.978) (-1241.021) -- 0:00:12 798500 -- (-1241.396) (-1242.655) (-1239.278) [-1237.999] * [-1239.174] (-1239.969) (-1239.079) (-1238.345) -- 0:00:12 799000 -- (-1238.688) (-1238.182) (-1239.293) [-1238.539] * (-1239.332) (-1240.540) (-1241.545) [-1239.308] -- 0:00:12 799500 -- (-1242.006) [-1237.447] (-1240.557) (-1240.188) * (-1238.854) [-1237.894] (-1237.904) (-1238.973) -- 0:00:12 800000 -- (-1238.352) [-1238.004] (-1241.562) (-1238.601) * (-1238.523) (-1238.214) [-1239.811] (-1238.651) -- 0:00:12 Average standard deviation of split frequencies: 0.010193 800500 -- (-1239.203) [-1238.704] (-1243.434) (-1240.862) * [-1238.733] (-1238.287) (-1241.383) (-1237.691) -- 0:00:12 801000 -- (-1243.872) [-1237.669] (-1239.160) (-1239.461) * (-1244.284) [-1238.363] (-1244.401) (-1243.306) -- 0:00:12 801500 -- (-1238.341) [-1239.151] (-1239.416) (-1243.114) * (-1242.585) (-1237.755) [-1242.001] (-1237.979) -- 0:00:12 802000 -- [-1238.045] (-1238.345) (-1238.304) (-1243.954) * (-1240.032) (-1237.938) [-1239.867] (-1237.790) -- 0:00:12 802500 -- (-1239.137) [-1237.863] (-1237.664) (-1242.065) * (-1240.099) (-1239.416) [-1242.086] (-1237.612) -- 0:00:12 803000 -- (-1238.028) (-1239.358) (-1238.652) [-1237.919] * (-1238.750) [-1238.555] (-1237.750) (-1242.637) -- 0:00:12 803500 -- (-1237.725) [-1238.820] (-1241.640) (-1242.003) * (-1240.219) (-1241.014) [-1238.032] (-1241.608) -- 0:00:12 804000 -- (-1237.725) [-1244.407] (-1243.504) (-1238.887) * (-1241.564) [-1239.269] (-1237.736) (-1241.007) -- 0:00:12 804500 -- [-1238.357] (-1238.565) (-1241.124) (-1239.201) * (-1238.764) [-1239.791] (-1238.244) (-1242.289) -- 0:00:12 805000 -- (-1238.740) [-1238.351] (-1239.196) (-1242.032) * (-1238.710) (-1239.772) [-1237.636] (-1243.159) -- 0:00:12 Average standard deviation of split frequencies: 0.010308 805500 -- [-1238.757] (-1238.819) (-1238.800) (-1241.106) * (-1241.124) (-1240.939) [-1237.362] (-1240.353) -- 0:00:12 806000 -- (-1241.567) (-1239.089) (-1240.495) [-1238.208] * (-1244.064) (-1241.107) (-1238.181) [-1241.360] -- 0:00:12 806500 -- (-1239.186) [-1238.155] (-1240.300) (-1240.448) * (-1242.548) (-1238.505) [-1239.448] (-1240.406) -- 0:00:12 807000 -- (-1239.665) [-1237.747] (-1238.264) (-1241.606) * (-1239.150) (-1239.180) (-1239.309) [-1238.646] -- 0:00:12 807500 -- (-1238.511) (-1237.990) (-1241.696) [-1241.360] * [-1239.201] (-1240.310) (-1239.035) (-1237.901) -- 0:00:12 808000 -- (-1240.911) (-1237.574) (-1246.886) [-1240.152] * [-1239.005] (-1238.495) (-1239.452) (-1240.785) -- 0:00:12 808500 -- (-1238.928) (-1238.475) [-1243.366] (-1237.057) * (-1237.567) (-1241.926) (-1239.122) [-1239.382] -- 0:00:12 809000 -- (-1239.386) (-1239.872) [-1238.272] (-1239.989) * [-1239.739] (-1238.237) (-1242.608) (-1239.258) -- 0:00:12 809500 -- (-1241.584) (-1242.529) [-1238.426] (-1240.673) * (-1238.184) [-1240.109] (-1240.465) (-1239.258) -- 0:00:12 810000 -- (-1243.509) [-1241.520] (-1240.148) (-1241.955) * (-1237.789) (-1237.909) [-1238.513] (-1238.172) -- 0:00:12 Average standard deviation of split frequencies: 0.010540 810500 -- (-1243.717) (-1238.985) (-1239.285) [-1237.809] * (-1238.835) (-1238.564) (-1239.100) [-1241.768] -- 0:00:12 811000 -- [-1240.502] (-1243.071) (-1242.040) (-1242.348) * (-1241.353) (-1239.143) (-1241.895) [-1239.776] -- 0:00:12 811500 -- (-1238.687) [-1240.770] (-1240.487) (-1242.777) * (-1243.751) [-1240.381] (-1238.368) (-1240.417) -- 0:00:12 812000 -- [-1239.242] (-1240.720) (-1238.297) (-1242.347) * (-1238.106) [-1237.391] (-1239.431) (-1238.970) -- 0:00:12 812500 -- (-1239.223) [-1240.644] (-1239.693) (-1243.389) * [-1240.592] (-1237.238) (-1237.998) (-1238.649) -- 0:00:12 813000 -- (-1239.317) [-1239.112] (-1238.925) (-1242.514) * (-1240.214) [-1239.112] (-1237.583) (-1239.228) -- 0:00:11 813500 -- [-1238.920] (-1240.396) (-1238.881) (-1238.777) * (-1239.393) (-1239.482) (-1239.052) [-1238.646] -- 0:00:11 814000 -- (-1238.621) (-1241.323) [-1237.702] (-1237.866) * [-1239.393] (-1238.436) (-1246.555) (-1238.462) -- 0:00:11 814500 -- (-1242.531) [-1238.575] (-1238.143) (-1240.292) * (-1237.781) [-1239.461] (-1246.309) (-1237.706) -- 0:00:11 815000 -- [-1239.398] (-1240.554) (-1238.628) (-1242.707) * (-1239.367) (-1241.051) [-1237.524] (-1240.810) -- 0:00:11 Average standard deviation of split frequencies: 0.010543 815500 -- (-1243.320) (-1239.990) [-1239.522] (-1240.749) * [-1239.408] (-1244.634) (-1241.321) (-1242.223) -- 0:00:11 816000 -- (-1240.384) (-1241.964) [-1237.692] (-1239.748) * (-1238.131) [-1241.860] (-1245.574) (-1242.249) -- 0:00:11 816500 -- (-1237.727) (-1244.964) (-1240.445) [-1240.435] * (-1238.763) (-1240.850) (-1242.095) [-1239.791] -- 0:00:11 817000 -- (-1238.183) (-1240.615) (-1239.993) [-1239.096] * (-1238.783) (-1242.163) (-1240.681) [-1238.013] -- 0:00:11 817500 -- (-1239.400) [-1240.772] (-1240.356) (-1239.327) * [-1238.948] (-1239.943) (-1241.149) (-1242.388) -- 0:00:11 818000 -- (-1241.862) (-1239.426) [-1237.696] (-1240.865) * (-1238.917) [-1238.754] (-1239.732) (-1239.621) -- 0:00:11 818500 -- (-1240.024) [-1241.440] (-1237.917) (-1239.246) * (-1238.773) (-1239.537) (-1238.925) [-1237.139] -- 0:00:11 819000 -- (-1245.553) (-1245.498) [-1239.255] (-1242.731) * [-1238.954] (-1238.900) (-1241.392) (-1238.270) -- 0:00:11 819500 -- (-1240.705) [-1238.447] (-1240.195) (-1239.946) * (-1238.414) (-1238.953) [-1240.208] (-1238.665) -- 0:00:11 820000 -- (-1240.161) (-1239.751) (-1241.547) [-1240.912] * (-1239.724) (-1240.225) [-1237.522] (-1239.818) -- 0:00:11 Average standard deviation of split frequencies: 0.010569 820500 -- (-1241.291) (-1237.801) (-1240.440) [-1241.308] * [-1238.088] (-1237.190) (-1239.624) (-1241.022) -- 0:00:11 821000 -- (-1240.857) (-1240.200) (-1239.179) [-1245.675] * (-1238.278) (-1239.177) (-1240.423) [-1241.345] -- 0:00:11 821500 -- (-1243.300) (-1239.252) [-1238.302] (-1239.181) * (-1238.950) (-1238.631) [-1240.511] (-1242.840) -- 0:00:11 822000 -- (-1237.936) [-1239.538] (-1240.698) (-1238.177) * (-1239.033) (-1238.489) (-1239.692) [-1237.995] -- 0:00:11 822500 -- (-1237.432) (-1238.512) [-1240.559] (-1237.942) * (-1238.660) (-1238.671) (-1241.807) [-1238.136] -- 0:00:11 823000 -- (-1237.949) [-1239.694] (-1242.769) (-1239.382) * [-1244.459] (-1239.116) (-1241.842) (-1242.108) -- 0:00:11 823500 -- (-1237.996) [-1238.266] (-1240.686) (-1239.562) * [-1240.352] (-1238.149) (-1240.812) (-1239.621) -- 0:00:11 824000 -- (-1238.810) (-1239.721) (-1241.226) [-1239.833] * [-1240.482] (-1242.130) (-1239.733) (-1240.617) -- 0:00:11 824500 -- [-1241.668] (-1239.716) (-1240.872) (-1239.152) * (-1246.797) (-1241.565) [-1241.029] (-1240.119) -- 0:00:11 825000 -- (-1240.351) (-1238.064) [-1239.392] (-1240.560) * (-1240.337) (-1243.541) (-1239.657) [-1240.024] -- 0:00:11 Average standard deviation of split frequencies: 0.010425 825500 -- (-1238.863) [-1237.283] (-1239.246) (-1241.911) * [-1241.317] (-1239.917) (-1240.532) (-1239.359) -- 0:00:11 826000 -- (-1239.232) (-1242.819) [-1238.214] (-1241.449) * [-1238.221] (-1238.524) (-1245.492) (-1238.899) -- 0:00:11 826500 -- (-1239.156) (-1241.676) [-1240.011] (-1240.035) * (-1239.022) [-1237.855] (-1239.495) (-1239.445) -- 0:00:11 827000 -- (-1239.196) [-1241.030] (-1240.533) (-1239.997) * (-1239.459) (-1238.359) (-1238.099) [-1239.024] -- 0:00:11 827500 -- (-1242.522) (-1238.786) [-1239.341] (-1237.790) * (-1237.293) [-1240.049] (-1239.603) (-1238.133) -- 0:00:11 828000 -- (-1238.130) (-1240.353) (-1240.787) [-1237.802] * (-1237.797) (-1239.018) (-1242.909) [-1239.471] -- 0:00:11 828500 -- (-1237.959) [-1239.451] (-1240.339) (-1238.147) * (-1239.134) (-1239.548) [-1238.859] (-1240.771) -- 0:00:10 829000 -- (-1237.943) (-1239.640) [-1238.210] (-1240.143) * (-1238.936) (-1240.008) [-1238.694] (-1239.153) -- 0:00:10 829500 -- [-1237.977] (-1240.708) (-1237.979) (-1237.905) * [-1238.242] (-1239.877) (-1240.949) (-1239.200) -- 0:00:10 830000 -- (-1239.035) (-1242.830) (-1238.540) [-1237.693] * (-1240.183) (-1241.835) (-1239.042) [-1243.431] -- 0:00:10 Average standard deviation of split frequencies: 0.010215 830500 -- (-1242.858) (-1239.800) (-1239.276) [-1238.283] * [-1240.431] (-1240.265) (-1238.112) (-1243.744) -- 0:00:10 831000 -- (-1243.870) [-1239.483] (-1237.728) (-1238.747) * (-1239.765) (-1238.532) (-1245.970) [-1238.094] -- 0:00:10 831500 -- (-1239.676) [-1238.611] (-1238.376) (-1240.483) * [-1238.574] (-1239.808) (-1238.887) (-1239.375) -- 0:00:10 832000 -- (-1241.309) (-1239.073) (-1238.818) [-1239.744] * (-1239.742) (-1239.747) [-1237.776] (-1239.547) -- 0:00:10 832500 -- (-1245.108) (-1240.152) (-1240.038) [-1238.407] * (-1241.403) [-1238.327] (-1238.579) (-1237.612) -- 0:00:10 833000 -- (-1245.237) [-1238.514] (-1238.951) (-1238.280) * (-1241.515) (-1246.224) (-1240.116) [-1238.060] -- 0:00:10 833500 -- (-1239.303) (-1239.442) [-1238.664] (-1243.178) * (-1240.860) (-1239.737) (-1240.593) [-1237.633] -- 0:00:10 834000 -- (-1238.552) (-1240.925) [-1238.417] (-1238.028) * (-1239.564) (-1239.147) [-1239.155] (-1239.071) -- 0:00:10 834500 -- (-1237.423) (-1243.707) (-1237.665) [-1238.502] * (-1246.407) [-1240.245] (-1240.602) (-1239.857) -- 0:00:10 835000 -- (-1239.118) [-1240.301] (-1237.186) (-1238.211) * (-1247.044) (-1241.853) [-1239.309] (-1239.125) -- 0:00:10 Average standard deviation of split frequencies: 0.010300 835500 -- (-1240.774) (-1240.881) (-1239.303) [-1238.161] * (-1239.414) (-1239.152) [-1238.652] (-1239.169) -- 0:00:10 836000 -- [-1238.490] (-1243.209) (-1237.888) (-1241.094) * (-1241.296) (-1238.991) [-1240.212] (-1239.757) -- 0:00:10 836500 -- [-1238.801] (-1242.737) (-1242.434) (-1238.484) * (-1242.161) [-1237.705] (-1240.819) (-1238.135) -- 0:00:10 837000 -- (-1240.528) (-1240.001) (-1238.317) [-1240.076] * (-1240.482) (-1237.665) [-1239.423] (-1237.693) -- 0:00:10 837500 -- (-1240.630) (-1239.605) (-1240.350) [-1238.215] * (-1242.536) (-1238.219) [-1238.392] (-1237.800) -- 0:00:10 838000 -- (-1241.320) (-1238.574) (-1240.003) [-1238.074] * (-1242.956) [-1238.168] (-1238.600) (-1240.809) -- 0:00:10 838500 -- (-1239.491) (-1237.872) (-1241.664) [-1238.309] * (-1242.116) (-1238.419) [-1240.574] (-1238.716) -- 0:00:10 839000 -- (-1237.633) [-1240.277] (-1240.436) (-1239.630) * [-1241.095] (-1238.358) (-1238.687) (-1238.478) -- 0:00:10 839500 -- (-1239.723) (-1238.788) (-1240.692) [-1241.402] * (-1238.424) [-1241.966] (-1237.607) (-1239.621) -- 0:00:10 840000 -- (-1237.573) (-1242.526) (-1241.194) [-1243.098] * [-1241.546] (-1241.162) (-1238.327) (-1240.643) -- 0:00:10 Average standard deviation of split frequencies: 0.010094 840500 -- [-1240.093] (-1238.274) (-1240.248) (-1238.927) * (-1242.734) (-1237.464) [-1238.550] (-1238.620) -- 0:00:10 841000 -- [-1238.698] (-1238.513) (-1241.775) (-1237.552) * (-1239.085) (-1240.047) [-1238.302] (-1237.723) -- 0:00:10 841500 -- [-1238.514] (-1242.061) (-1241.007) (-1237.702) * (-1238.777) [-1238.655] (-1239.776) (-1239.401) -- 0:00:10 842000 -- (-1242.711) (-1247.393) (-1237.801) [-1239.570] * (-1237.472) (-1240.333) [-1239.817] (-1243.306) -- 0:00:10 842500 -- (-1239.938) (-1248.366) [-1240.664] (-1239.616) * (-1238.525) (-1241.373) (-1239.537) [-1239.429] -- 0:00:10 843000 -- (-1238.232) (-1245.050) (-1239.120) [-1238.047] * (-1242.413) [-1237.354] (-1241.574) (-1240.539) -- 0:00:10 843500 -- (-1239.166) (-1239.963) [-1237.957] (-1237.849) * [-1238.300] (-1238.169) (-1240.379) (-1241.652) -- 0:00:10 844000 -- (-1239.496) [-1238.556] (-1237.576) (-1238.986) * (-1240.271) (-1237.821) (-1238.388) [-1241.231] -- 0:00:09 844500 -- [-1240.941] (-1238.279) (-1237.657) (-1238.651) * (-1238.451) [-1238.588] (-1241.204) (-1241.057) -- 0:00:09 845000 -- (-1238.273) (-1241.384) [-1238.135] (-1240.889) * (-1238.856) (-1241.887) [-1238.245] (-1238.134) -- 0:00:09 Average standard deviation of split frequencies: 0.010290 845500 -- (-1239.050) (-1242.425) [-1237.739] (-1238.372) * (-1239.705) (-1238.881) [-1238.084] (-1237.705) -- 0:00:09 846000 -- (-1239.396) (-1238.514) (-1237.843) [-1239.297] * (-1241.340) (-1240.800) (-1237.740) [-1237.976] -- 0:00:09 846500 -- (-1242.617) (-1237.940) (-1241.228) [-1240.048] * [-1238.089] (-1240.827) (-1238.007) (-1238.190) -- 0:00:09 847000 -- (-1244.569) [-1239.135] (-1240.815) (-1239.375) * [-1238.485] (-1239.858) (-1238.752) (-1238.021) -- 0:00:09 847500 -- (-1241.159) (-1240.254) [-1239.613] (-1239.560) * [-1238.414] (-1241.076) (-1239.450) (-1240.074) -- 0:00:09 848000 -- (-1239.381) [-1238.924] (-1239.935) (-1239.565) * (-1238.749) (-1238.827) [-1238.126] (-1239.357) -- 0:00:09 848500 -- (-1237.535) (-1238.589) (-1239.223) [-1240.731] * (-1240.629) (-1239.832) [-1238.945] (-1239.951) -- 0:00:09 849000 -- (-1237.918) (-1240.494) (-1240.848) [-1240.500] * (-1245.071) [-1240.116] (-1238.477) (-1239.408) -- 0:00:09 849500 -- (-1238.928) [-1238.125] (-1241.924) (-1238.869) * (-1243.005) (-1239.120) [-1241.581] (-1238.564) -- 0:00:09 850000 -- (-1240.165) (-1240.182) (-1241.473) [-1238.873] * (-1240.789) (-1238.625) [-1241.134] (-1238.715) -- 0:00:09 Average standard deviation of split frequencies: 0.010381 850500 -- [-1239.915] (-1238.142) (-1239.147) (-1238.198) * (-1240.566) (-1239.562) (-1239.127) [-1238.112] -- 0:00:09 851000 -- [-1238.064] (-1240.015) (-1238.377) (-1238.092) * [-1240.220] (-1236.998) (-1239.141) (-1240.807) -- 0:00:09 851500 -- [-1238.563] (-1242.691) (-1238.889) (-1242.223) * (-1239.871) (-1240.278) (-1243.816) [-1238.942] -- 0:00:09 852000 -- (-1240.439) [-1238.442] (-1241.085) (-1238.992) * [-1241.815] (-1246.033) (-1241.360) (-1238.578) -- 0:00:09 852500 -- (-1239.925) [-1238.483] (-1238.161) (-1246.382) * [-1237.929] (-1239.919) (-1239.378) (-1240.150) -- 0:00:09 853000 -- [-1243.493] (-1238.322) (-1238.245) (-1240.029) * [-1238.380] (-1238.712) (-1239.523) (-1238.697) -- 0:00:09 853500 -- [-1241.587] (-1237.445) (-1238.192) (-1239.244) * (-1241.913) [-1239.120] (-1238.858) (-1240.391) -- 0:00:09 854000 -- (-1243.773) [-1240.023] (-1239.319) (-1239.188) * (-1238.620) (-1240.337) [-1238.497] (-1241.205) -- 0:00:09 854500 -- (-1238.911) (-1238.723) (-1241.284) [-1239.690] * (-1241.414) (-1239.591) (-1239.198) [-1238.979] -- 0:00:09 855000 -- [-1239.178] (-1245.448) (-1239.897) (-1239.996) * [-1240.738] (-1238.332) (-1239.988) (-1240.253) -- 0:00:09 Average standard deviation of split frequencies: 0.010463 855500 -- (-1240.656) [-1240.262] (-1239.515) (-1241.502) * (-1239.890) [-1238.332] (-1240.321) (-1240.644) -- 0:00:09 856000 -- (-1239.591) [-1240.440] (-1239.891) (-1239.559) * (-1239.058) (-1238.407) [-1238.129] (-1238.059) -- 0:00:09 856500 -- (-1240.102) (-1243.223) [-1239.041] (-1241.812) * (-1240.856) (-1238.809) (-1243.043) [-1242.724] -- 0:00:09 857000 -- (-1239.223) (-1240.846) [-1237.730] (-1239.910) * [-1247.333] (-1238.865) (-1243.198) (-1237.969) -- 0:00:09 857500 -- (-1239.147) (-1239.057) (-1240.178) [-1241.379] * (-1238.671) (-1238.821) [-1242.663] (-1238.564) -- 0:00:09 858000 -- (-1243.459) (-1239.055) (-1241.017) [-1240.189] * (-1237.867) (-1240.141) (-1238.227) [-1244.304] -- 0:00:09 858500 -- [-1240.167] (-1239.248) (-1240.599) (-1239.928) * (-1238.128) (-1240.001) [-1242.225] (-1237.306) -- 0:00:09 859000 -- [-1240.943] (-1238.249) (-1244.638) (-1241.480) * [-1239.871] (-1238.667) (-1237.616) (-1239.288) -- 0:00:09 859500 -- (-1241.119) [-1240.715] (-1239.121) (-1240.707) * [-1237.531] (-1237.651) (-1241.281) (-1238.808) -- 0:00:08 860000 -- (-1240.141) (-1239.125) [-1240.072] (-1242.016) * (-1240.973) [-1238.503] (-1240.968) (-1238.538) -- 0:00:08 Average standard deviation of split frequencies: 0.010078 860500 -- [-1239.065] (-1241.852) (-1239.644) (-1244.681) * [-1240.704] (-1239.546) (-1242.141) (-1237.671) -- 0:00:08 861000 -- (-1239.562) (-1242.225) (-1241.149) [-1239.978] * (-1240.228) (-1238.189) [-1239.389] (-1238.555) -- 0:00:08 861500 -- (-1238.587) (-1242.359) [-1239.541] (-1242.469) * [-1240.274] (-1240.091) (-1237.648) (-1237.820) -- 0:00:08 862000 -- (-1237.896) [-1238.498] (-1239.252) (-1243.749) * (-1240.410) [-1237.828] (-1237.830) (-1237.741) -- 0:00:08 862500 -- (-1238.817) (-1239.720) [-1237.811] (-1245.409) * (-1243.845) (-1238.916) [-1238.689] (-1237.865) -- 0:00:08 863000 -- (-1241.879) [-1240.312] (-1244.939) (-1244.565) * (-1237.855) (-1238.670) [-1241.237] (-1238.626) -- 0:00:08 863500 -- [-1240.951] (-1241.548) (-1243.016) (-1239.295) * (-1238.783) [-1237.636] (-1237.390) (-1241.068) -- 0:00:08 864000 -- [-1239.616] (-1238.510) (-1242.412) (-1238.281) * (-1241.267) [-1238.473] (-1237.802) (-1244.034) -- 0:00:08 864500 -- (-1238.001) (-1239.040) (-1245.705) [-1239.248] * (-1238.428) [-1239.659] (-1239.741) (-1243.652) -- 0:00:08 865000 -- (-1239.751) (-1238.966) [-1238.546] (-1237.387) * (-1241.394) [-1239.473] (-1238.837) (-1239.341) -- 0:00:08 Average standard deviation of split frequencies: 0.009943 865500 -- (-1242.282) [-1238.859] (-1238.900) (-1239.921) * (-1240.568) (-1239.275) [-1243.579] (-1242.523) -- 0:00:08 866000 -- [-1239.159] (-1237.324) (-1238.588) (-1239.259) * [-1240.737] (-1238.869) (-1241.316) (-1237.726) -- 0:00:08 866500 -- (-1242.077) [-1237.077] (-1238.222) (-1239.950) * (-1239.652) (-1239.329) [-1239.813] (-1241.052) -- 0:00:08 867000 -- [-1241.350] (-1239.358) (-1238.224) (-1239.752) * (-1239.124) (-1238.078) [-1238.991] (-1239.955) -- 0:00:08 867500 -- (-1239.453) (-1239.454) [-1237.527] (-1237.517) * (-1240.042) (-1244.572) (-1238.088) [-1239.845] -- 0:00:08 868000 -- (-1240.479) (-1240.076) [-1240.096] (-1238.291) * [-1241.683] (-1240.931) (-1243.616) (-1237.958) -- 0:00:08 868500 -- (-1241.827) [-1237.890] (-1240.478) (-1239.184) * (-1242.176) (-1243.252) [-1237.957] (-1239.067) -- 0:00:08 869000 -- (-1243.461) (-1239.572) [-1240.669] (-1238.706) * (-1239.030) (-1237.641) [-1238.183] (-1239.578) -- 0:00:08 869500 -- (-1239.624) [-1240.628] (-1240.530) (-1238.008) * (-1238.049) (-1238.589) [-1238.777] (-1239.407) -- 0:00:08 870000 -- (-1241.823) [-1237.978] (-1241.392) (-1237.719) * (-1239.933) [-1239.941] (-1239.484) (-1239.966) -- 0:00:08 Average standard deviation of split frequencies: 0.009890 870500 -- [-1239.009] (-1237.119) (-1241.729) (-1239.467) * [-1237.693] (-1239.939) (-1240.282) (-1239.103) -- 0:00:08 871000 -- [-1237.070] (-1239.103) (-1240.965) (-1239.955) * (-1238.538) [-1237.951] (-1240.342) (-1240.906) -- 0:00:08 871500 -- (-1241.893) (-1241.755) (-1244.670) [-1240.357] * [-1238.796] (-1240.429) (-1239.695) (-1241.357) -- 0:00:08 872000 -- (-1238.185) (-1238.960) (-1240.310) [-1241.262] * (-1238.188) (-1241.519) (-1239.186) [-1237.786] -- 0:00:08 872500 -- (-1238.555) (-1239.209) (-1238.389) [-1240.060] * (-1241.981) (-1242.127) (-1240.892) [-1237.374] -- 0:00:08 873000 -- [-1240.552] (-1237.159) (-1241.817) (-1238.687) * [-1241.716] (-1243.911) (-1241.913) (-1240.211) -- 0:00:08 873500 -- (-1238.512) (-1239.962) [-1239.771] (-1238.629) * [-1237.823] (-1239.915) (-1244.695) (-1242.171) -- 0:00:08 874000 -- [-1240.916] (-1239.710) (-1238.907) (-1240.184) * (-1239.471) (-1242.318) [-1239.486] (-1254.509) -- 0:00:08 874500 -- (-1242.777) (-1238.876) (-1240.089) [-1240.086] * [-1239.172] (-1238.977) (-1248.137) (-1245.881) -- 0:00:08 875000 -- [-1238.342] (-1240.021) (-1239.451) (-1239.208) * [-1239.972] (-1239.170) (-1248.329) (-1244.006) -- 0:00:08 Average standard deviation of split frequencies: 0.009758 875500 -- (-1240.100) (-1241.633) (-1238.973) [-1239.443] * (-1238.040) (-1239.257) [-1240.523] (-1239.925) -- 0:00:07 876000 -- [-1237.414] (-1239.897) (-1238.326) (-1241.675) * (-1239.108) [-1243.633] (-1240.342) (-1239.625) -- 0:00:07 876500 -- (-1242.489) (-1242.219) (-1241.609) [-1238.941] * (-1237.824) (-1244.446) (-1240.620) [-1241.456] -- 0:00:07 877000 -- (-1238.731) (-1249.854) (-1237.463) [-1239.077] * (-1240.207) (-1237.519) [-1244.069] (-1239.185) -- 0:00:07 877500 -- (-1239.744) (-1241.154) [-1238.983] (-1238.523) * [-1239.958] (-1241.075) (-1240.254) (-1242.002) -- 0:00:07 878000 -- (-1242.685) (-1240.496) (-1242.552) [-1238.699] * (-1238.854) [-1238.077] (-1239.574) (-1239.938) -- 0:00:07 878500 -- [-1237.849] (-1237.305) (-1244.709) (-1240.365) * (-1238.846) (-1238.392) [-1240.172] (-1241.703) -- 0:00:07 879000 -- (-1237.787) (-1239.279) (-1239.192) [-1240.009] * (-1239.016) [-1239.225] (-1239.634) (-1239.859) -- 0:00:07 879500 -- (-1239.598) (-1241.306) [-1238.137] (-1238.772) * (-1238.402) (-1237.481) [-1237.428] (-1244.905) -- 0:00:07 880000 -- [-1243.200] (-1240.861) (-1237.514) (-1239.458) * (-1240.845) (-1242.007) (-1240.545) [-1239.443] -- 0:00:07 Average standard deviation of split frequencies: 0.009671 880500 -- [-1240.073] (-1240.905) (-1237.470) (-1241.311) * [-1237.056] (-1241.794) (-1240.935) (-1238.446) -- 0:00:07 881000 -- (-1239.961) (-1241.357) [-1238.462] (-1238.043) * (-1237.208) [-1238.070] (-1239.668) (-1240.646) -- 0:00:07 881500 -- (-1239.590) (-1242.425) (-1240.681) [-1238.340] * (-1242.113) (-1241.901) (-1238.454) [-1238.235] -- 0:00:07 882000 -- (-1239.555) (-1243.540) [-1244.098] (-1238.806) * (-1238.059) (-1241.730) (-1238.496) [-1238.940] -- 0:00:07 882500 -- (-1240.778) [-1243.874] (-1240.267) (-1239.368) * [-1240.229] (-1239.245) (-1238.063) (-1237.992) -- 0:00:07 883000 -- (-1238.299) [-1238.884] (-1239.529) (-1238.847) * [-1240.414] (-1238.065) (-1238.315) (-1241.864) -- 0:00:07 883500 -- (-1238.881) (-1244.371) (-1238.762) [-1239.039] * [-1239.508] (-1239.778) (-1239.269) (-1241.339) -- 0:00:07 884000 -- (-1238.435) (-1238.569) (-1238.421) [-1238.619] * (-1240.684) (-1238.990) [-1237.892] (-1239.740) -- 0:00:07 884500 -- [-1238.812] (-1237.996) (-1240.116) (-1239.040) * (-1243.253) (-1239.318) [-1238.031] (-1243.001) -- 0:00:07 885000 -- [-1239.034] (-1238.640) (-1241.181) (-1239.858) * [-1238.990] (-1239.116) (-1239.858) (-1243.651) -- 0:00:07 Average standard deviation of split frequencies: 0.009861 885500 -- (-1240.001) [-1238.940] (-1238.951) (-1238.588) * (-1239.360) [-1238.720] (-1238.085) (-1239.341) -- 0:00:07 886000 -- (-1240.827) (-1238.214) (-1244.116) [-1238.656] * (-1241.648) (-1238.324) (-1239.293) [-1238.804] -- 0:00:07 886500 -- (-1246.823) (-1239.468) (-1241.523) [-1237.361] * (-1241.452) (-1238.542) (-1238.560) [-1239.824] -- 0:00:07 887000 -- (-1249.911) (-1240.202) (-1241.017) [-1237.787] * (-1240.569) [-1238.083] (-1239.030) (-1243.373) -- 0:00:07 887500 -- (-1241.054) (-1241.175) (-1238.552) [-1243.018] * (-1238.825) (-1242.106) [-1239.640] (-1241.564) -- 0:00:07 888000 -- [-1240.073] (-1242.038) (-1238.812) (-1242.181) * (-1238.188) (-1241.067) (-1241.249) [-1240.941] -- 0:00:07 888500 -- (-1240.895) [-1239.786] (-1241.683) (-1242.602) * (-1239.366) (-1240.532) (-1239.181) [-1237.890] -- 0:00:07 889000 -- (-1241.976) (-1238.155) [-1239.227] (-1242.781) * (-1242.716) (-1239.671) [-1240.554] (-1240.761) -- 0:00:07 889500 -- (-1239.896) (-1237.963) [-1238.863] (-1237.270) * (-1242.449) (-1239.482) [-1239.512] (-1245.651) -- 0:00:07 890000 -- (-1239.041) [-1241.193] (-1239.397) (-1238.415) * [-1239.376] (-1240.777) (-1240.613) (-1240.845) -- 0:00:07 Average standard deviation of split frequencies: 0.009527 890500 -- (-1239.675) (-1240.736) [-1238.244] (-1240.922) * (-1240.243) (-1237.934) (-1241.894) [-1239.623] -- 0:00:07 891000 -- (-1240.324) [-1238.582] (-1240.204) (-1239.635) * (-1243.614) (-1240.011) [-1239.747] (-1239.646) -- 0:00:06 891500 -- (-1241.268) [-1239.021] (-1239.120) (-1240.443) * [-1243.776] (-1243.803) (-1238.986) (-1238.709) -- 0:00:06 892000 -- (-1241.322) (-1238.309) [-1237.794] (-1238.728) * (-1239.780) [-1237.915] (-1241.401) (-1241.015) -- 0:00:06 892500 -- (-1244.572) [-1237.952] (-1238.163) (-1241.656) * [-1239.882] (-1238.612) (-1244.924) (-1239.707) -- 0:00:06 893000 -- (-1239.618) (-1240.965) (-1238.556) [-1238.754] * (-1237.665) (-1241.406) (-1239.110) [-1238.633] -- 0:00:06 893500 -- (-1242.149) [-1243.359] (-1240.629) (-1238.697) * [-1238.720] (-1240.723) (-1238.640) (-1242.796) -- 0:00:06 894000 -- (-1238.840) (-1238.796) [-1237.558] (-1237.823) * (-1241.022) (-1237.364) [-1237.671] (-1239.129) -- 0:00:06 894500 -- [-1239.285] (-1238.228) (-1240.973) (-1239.027) * (-1240.605) (-1238.033) [-1237.288] (-1239.361) -- 0:00:06 895000 -- (-1239.249) [-1237.828] (-1238.423) (-1237.633) * (-1240.312) [-1238.319] (-1237.543) (-1240.807) -- 0:00:06 Average standard deviation of split frequencies: 0.009260 895500 -- (-1239.935) [-1243.091] (-1239.616) (-1241.056) * (-1241.285) (-1241.309) (-1238.905) [-1238.410] -- 0:00:06 896000 -- (-1237.136) (-1240.545) (-1238.016) [-1239.280] * (-1237.399) [-1240.735] (-1239.960) (-1238.186) -- 0:00:06 896500 -- (-1237.136) [-1242.940] (-1243.077) (-1238.304) * [-1239.034] (-1242.909) (-1239.694) (-1240.746) -- 0:00:06 897000 -- (-1238.760) (-1238.110) (-1240.664) [-1238.174] * (-1239.334) (-1240.823) [-1238.144] (-1239.680) -- 0:00:06 897500 -- [-1238.731] (-1241.814) (-1238.676) (-1242.353) * [-1238.331] (-1240.723) (-1239.714) (-1241.561) -- 0:00:06 898000 -- [-1241.018] (-1239.274) (-1238.982) (-1239.875) * [-1238.121] (-1240.817) (-1240.510) (-1238.402) -- 0:00:06 898500 -- (-1239.218) (-1240.977) [-1239.235] (-1242.725) * [-1237.903] (-1239.996) (-1241.770) (-1240.786) -- 0:00:06 899000 -- (-1241.008) [-1238.294] (-1238.368) (-1241.740) * (-1237.443) (-1240.318) (-1238.982) [-1238.775] -- 0:00:06 899500 -- [-1240.448] (-1239.912) (-1239.933) (-1237.642) * (-1237.819) (-1239.678) (-1238.465) [-1238.997] -- 0:00:06 900000 -- (-1240.810) (-1241.631) [-1238.284] (-1239.450) * [-1242.765] (-1238.303) (-1238.601) (-1239.365) -- 0:00:06 Average standard deviation of split frequencies: 0.009212 900500 -- [-1239.645] (-1240.918) (-1240.353) (-1239.041) * (-1238.086) [-1239.881] (-1240.812) (-1239.603) -- 0:00:06 901000 -- (-1238.673) (-1239.286) [-1241.426] (-1238.171) * (-1238.190) (-1237.581) [-1240.396] (-1238.828) -- 0:00:06 901500 -- (-1237.938) (-1239.051) (-1239.624) [-1238.130] * [-1238.636] (-1242.357) (-1241.437) (-1240.071) -- 0:00:06 902000 -- (-1238.687) (-1240.816) [-1239.595] (-1238.074) * [-1239.351] (-1239.415) (-1243.578) (-1238.018) -- 0:00:06 902500 -- (-1242.632) [-1238.526] (-1242.985) (-1239.239) * (-1242.618) (-1240.093) (-1241.491) [-1238.948] -- 0:00:06 903000 -- (-1240.275) (-1238.603) [-1238.153] (-1239.191) * (-1239.604) [-1238.191] (-1237.764) (-1241.802) -- 0:00:06 903500 -- (-1243.527) (-1241.828) [-1240.964] (-1238.328) * (-1241.565) [-1239.290] (-1238.408) (-1238.188) -- 0:00:06 904000 -- (-1240.627) (-1238.148) [-1238.935] (-1239.229) * (-1241.979) (-1240.812) [-1238.172] (-1237.818) -- 0:00:06 904500 -- [-1241.253] (-1238.428) (-1238.750) (-1241.522) * (-1242.434) (-1239.616) (-1239.276) [-1239.211] -- 0:00:06 905000 -- (-1237.483) (-1238.899) [-1242.400] (-1240.091) * [-1238.423] (-1238.532) (-1239.416) (-1240.986) -- 0:00:06 Average standard deviation of split frequencies: 0.009227 905500 -- (-1238.132) (-1241.026) (-1241.224) [-1238.055] * (-1239.241) [-1238.577] (-1240.457) (-1239.506) -- 0:00:06 906000 -- (-1242.707) (-1240.755) [-1240.399] (-1242.872) * [-1239.818] (-1238.231) (-1239.188) (-1239.694) -- 0:00:06 906500 -- (-1240.014) (-1237.537) (-1240.794) [-1240.595] * (-1241.239) [-1238.294] (-1239.333) (-1241.438) -- 0:00:05 907000 -- (-1238.030) (-1240.595) [-1238.189] (-1239.133) * (-1237.974) [-1244.481] (-1238.348) (-1239.538) -- 0:00:05 907500 -- (-1238.987) (-1239.488) (-1239.800) [-1239.274] * (-1237.698) (-1240.311) [-1238.565] (-1238.599) -- 0:00:05 908000 -- (-1237.457) [-1240.386] (-1238.312) (-1238.954) * (-1241.988) [-1238.582] (-1238.706) (-1240.713) -- 0:00:05 908500 -- (-1240.542) [-1243.008] (-1238.555) (-1238.939) * [-1239.728] (-1243.437) (-1242.077) (-1242.032) -- 0:00:05 909000 -- (-1243.972) (-1238.086) (-1239.490) [-1239.687] * [-1237.942] (-1239.078) (-1241.947) (-1242.568) -- 0:00:05 909500 -- (-1241.702) (-1237.363) [-1237.982] (-1239.622) * (-1238.191) (-1240.838) (-1240.655) [-1239.706] -- 0:00:05 910000 -- (-1242.580) (-1240.574) [-1241.969] (-1241.161) * (-1238.650) (-1242.573) (-1237.290) [-1238.123] -- 0:00:05 Average standard deviation of split frequencies: 0.008766 910500 -- [-1238.976] (-1245.523) (-1239.696) (-1243.848) * (-1239.607) (-1238.886) [-1237.883] (-1238.080) -- 0:00:05 911000 -- (-1240.185) [-1239.147] (-1238.774) (-1241.505) * (-1240.240) (-1237.714) (-1237.884) [-1238.032] -- 0:00:05 911500 -- (-1238.425) (-1239.158) [-1238.103] (-1240.591) * (-1240.003) (-1238.618) (-1237.922) [-1238.733] -- 0:00:05 912000 -- (-1239.519) (-1238.945) (-1239.470) [-1239.139] * (-1240.437) (-1243.413) (-1240.380) [-1238.013] -- 0:00:05 912500 -- (-1241.640) (-1239.547) (-1240.776) [-1240.244] * [-1241.275] (-1238.090) (-1244.386) (-1241.867) -- 0:00:05 913000 -- (-1238.819) [-1238.394] (-1241.648) (-1244.178) * (-1237.093) (-1238.480) (-1242.600) [-1239.047] -- 0:00:05 913500 -- (-1241.302) (-1238.827) [-1237.947] (-1247.033) * (-1238.119) (-1237.611) [-1238.328] (-1243.021) -- 0:00:05 914000 -- (-1244.257) (-1240.270) [-1239.029] (-1241.194) * (-1239.776) [-1238.007] (-1238.078) (-1242.244) -- 0:00:05 914500 -- [-1238.057] (-1241.941) (-1239.484) (-1241.091) * (-1238.002) (-1238.498) [-1237.524] (-1239.138) -- 0:00:05 915000 -- (-1238.443) [-1239.864] (-1239.027) (-1241.306) * (-1238.867) (-1237.895) (-1239.531) [-1240.195] -- 0:00:05 Average standard deviation of split frequencies: 0.008886 915500 -- (-1241.473) (-1239.377) [-1237.695] (-1239.719) * (-1238.494) [-1237.421] (-1239.475) (-1237.908) -- 0:00:05 916000 -- (-1240.528) (-1240.685) (-1239.268) [-1238.950] * (-1240.913) (-1243.095) [-1238.215] (-1238.479) -- 0:00:05 916500 -- [-1238.736] (-1242.709) (-1243.965) (-1238.461) * (-1239.393) (-1238.370) [-1240.585] (-1239.875) -- 0:00:05 917000 -- (-1238.194) (-1238.560) [-1238.735] (-1238.323) * (-1241.160) (-1239.295) [-1239.019] (-1239.646) -- 0:00:05 917500 -- (-1246.742) (-1238.679) [-1238.994] (-1239.982) * [-1238.481] (-1239.397) (-1241.813) (-1240.849) -- 0:00:05 918000 -- (-1237.378) (-1238.670) (-1238.699) [-1237.865] * (-1238.752) [-1238.403] (-1243.293) (-1239.538) -- 0:00:05 918500 -- [-1237.398] (-1238.483) (-1239.920) (-1237.879) * (-1240.428) (-1239.801) [-1238.781] (-1239.025) -- 0:00:05 919000 -- [-1239.509] (-1237.916) (-1241.264) (-1239.152) * [-1242.548] (-1238.817) (-1238.781) (-1244.351) -- 0:00:05 919500 -- (-1247.184) [-1238.480] (-1238.872) (-1238.076) * (-1242.485) (-1242.526) (-1238.024) [-1239.026] -- 0:00:05 920000 -- (-1241.204) (-1238.411) [-1238.504] (-1239.297) * (-1238.433) (-1240.680) [-1238.839] (-1239.145) -- 0:00:05 Average standard deviation of split frequencies: 0.008978 920500 -- (-1240.606) (-1238.140) (-1240.324) [-1238.109] * (-1244.351) [-1241.526] (-1239.138) (-1241.912) -- 0:00:05 921000 -- [-1238.405] (-1238.042) (-1238.940) (-1237.984) * [-1240.096] (-1238.862) (-1241.720) (-1239.158) -- 0:00:05 921500 -- [-1240.620] (-1238.188) (-1238.930) (-1240.738) * (-1242.404) (-1240.844) [-1238.946] (-1240.813) -- 0:00:05 922000 -- (-1240.010) (-1246.178) [-1237.896] (-1241.089) * (-1239.783) (-1240.406) [-1238.597] (-1241.140) -- 0:00:04 922500 -- (-1241.619) (-1242.812) (-1240.879) [-1240.976] * (-1238.840) [-1240.177] (-1240.025) (-1240.411) -- 0:00:04 923000 -- (-1240.286) (-1237.890) (-1238.860) [-1239.364] * [-1238.381] (-1244.802) (-1241.297) (-1239.822) -- 0:00:04 923500 -- [-1237.838] (-1239.500) (-1238.993) (-1239.299) * [-1238.232] (-1237.567) (-1238.360) (-1238.078) -- 0:00:04 924000 -- [-1239.588] (-1238.515) (-1238.012) (-1238.321) * (-1238.459) [-1237.781] (-1238.706) (-1238.511) -- 0:00:04 924500 -- [-1241.236] (-1239.573) (-1241.773) (-1239.408) * (-1238.778) (-1240.562) (-1241.616) [-1238.351] -- 0:00:04 925000 -- (-1239.321) (-1238.366) [-1240.301] (-1240.231) * (-1238.120) (-1238.679) [-1238.747] (-1239.161) -- 0:00:04 Average standard deviation of split frequencies: 0.008722 925500 -- (-1240.143) (-1238.602) (-1242.509) [-1239.235] * [-1241.664] (-1239.768) (-1239.548) (-1240.029) -- 0:00:04 926000 -- (-1240.734) [-1239.206] (-1244.296) (-1238.088) * (-1239.696) (-1238.578) (-1238.497) [-1237.703] -- 0:00:04 926500 -- (-1245.855) (-1241.919) (-1239.426) [-1238.105] * (-1238.288) (-1238.497) [-1239.464] (-1237.410) -- 0:00:04 927000 -- (-1243.456) (-1239.627) [-1237.507] (-1239.384) * [-1242.124] (-1242.068) (-1239.521) (-1238.440) -- 0:00:04 927500 -- (-1240.401) (-1239.489) (-1240.948) [-1240.232] * (-1239.471) (-1238.899) (-1241.373) [-1238.722] -- 0:00:04 928000 -- (-1238.930) (-1241.856) (-1238.630) [-1238.319] * (-1238.423) (-1239.903) (-1240.068) [-1240.087] -- 0:00:04 928500 -- [-1238.306] (-1238.424) (-1239.539) (-1239.156) * (-1241.904) (-1239.247) (-1239.789) [-1238.966] -- 0:00:04 929000 -- (-1239.845) [-1241.193] (-1239.802) (-1238.526) * [-1237.131] (-1240.631) (-1238.863) (-1241.261) -- 0:00:04 929500 -- [-1240.291] (-1243.627) (-1238.582) (-1238.661) * (-1238.018) (-1245.148) [-1237.606] (-1238.103) -- 0:00:04 930000 -- (-1240.953) (-1237.364) (-1238.368) [-1238.397] * (-1239.121) [-1240.722] (-1240.224) (-1238.443) -- 0:00:04 Average standard deviation of split frequencies: 0.008307 930500 -- (-1242.645) [-1237.505] (-1241.345) (-1239.532) * (-1239.529) (-1239.225) (-1238.483) [-1242.189] -- 0:00:04 931000 -- [-1237.784] (-1238.205) (-1240.235) (-1242.123) * (-1240.827) (-1239.029) [-1238.252] (-1241.932) -- 0:00:04 931500 -- (-1237.721) (-1237.593) [-1238.845] (-1242.478) * [-1244.958] (-1238.574) (-1239.664) (-1244.242) -- 0:00:04 932000 -- (-1238.944) (-1241.846) [-1239.358] (-1238.741) * (-1238.259) (-1245.771) (-1238.639) [-1238.324] -- 0:00:04 932500 -- (-1241.915) (-1239.962) (-1241.108) [-1239.414] * (-1238.832) (-1240.261) [-1238.263] (-1238.410) -- 0:00:04 933000 -- (-1238.793) (-1239.138) [-1239.530] (-1240.156) * (-1238.042) (-1239.369) [-1238.388] (-1243.003) -- 0:00:04 933500 -- (-1237.780) [-1238.588] (-1244.710) (-1237.992) * [-1238.721] (-1239.008) (-1238.216) (-1245.968) -- 0:00:04 934000 -- (-1239.350) [-1238.544] (-1246.263) (-1238.801) * [-1237.211] (-1238.500) (-1239.494) (-1243.831) -- 0:00:04 934500 -- (-1237.323) (-1239.393) [-1239.389] (-1242.022) * (-1237.834) [-1239.658] (-1242.931) (-1238.920) -- 0:00:04 935000 -- [-1238.564] (-1242.241) (-1239.077) (-1240.030) * [-1239.062] (-1239.821) (-1239.874) (-1238.968) -- 0:00:04 Average standard deviation of split frequencies: 0.008562 935500 -- [-1237.499] (-1240.877) (-1239.659) (-1238.367) * (-1243.840) (-1239.637) [-1242.183] (-1237.923) -- 0:00:04 936000 -- (-1237.793) [-1239.764] (-1241.449) (-1237.214) * (-1243.728) (-1239.206) [-1238.408] (-1238.102) -- 0:00:04 936500 -- (-1238.689) [-1238.598] (-1242.439) (-1240.303) * (-1240.316) (-1240.357) [-1239.020] (-1239.465) -- 0:00:04 937000 -- (-1243.713) (-1238.069) (-1241.745) [-1239.164] * (-1239.304) [-1237.811] (-1241.023) (-1241.690) -- 0:00:04 937500 -- (-1240.793) (-1237.497) (-1238.417) [-1243.444] * (-1239.432) (-1239.468) [-1238.500] (-1243.102) -- 0:00:04 938000 -- (-1238.147) (-1238.865) (-1245.182) [-1238.022] * (-1239.511) (-1245.210) (-1240.255) [-1242.255] -- 0:00:03 938500 -- (-1239.048) (-1238.416) (-1238.870) [-1238.588] * (-1241.244) (-1240.606) (-1239.786) [-1242.239] -- 0:00:03 939000 -- (-1242.280) (-1238.061) [-1241.527] (-1242.048) * (-1237.334) [-1240.514] (-1241.626) (-1242.089) -- 0:00:03 939500 -- (-1239.493) [-1237.464] (-1246.279) (-1241.207) * (-1238.305) [-1241.857] (-1243.116) (-1240.578) -- 0:00:03 940000 -- (-1242.686) (-1237.547) [-1238.674] (-1241.084) * (-1238.272) (-1237.954) [-1241.445] (-1240.170) -- 0:00:03 Average standard deviation of split frequencies: 0.008954 940500 -- (-1241.910) (-1239.384) [-1239.614] (-1240.635) * [-1237.521] (-1241.122) (-1240.318) (-1241.970) -- 0:00:03 941000 -- (-1241.488) [-1239.996] (-1238.916) (-1241.755) * [-1242.049] (-1240.657) (-1237.704) (-1243.319) -- 0:00:03 941500 -- [-1238.772] (-1239.823) (-1239.528) (-1241.280) * (-1242.255) [-1238.636] (-1240.005) (-1241.726) -- 0:00:03 942000 -- (-1243.396) (-1238.819) (-1241.916) [-1241.218] * (-1242.486) (-1242.040) (-1239.413) [-1240.899] -- 0:00:03 942500 -- (-1238.063) (-1241.284) (-1240.101) [-1238.111] * [-1242.853] (-1243.559) (-1240.283) (-1242.350) -- 0:00:03 943000 -- (-1237.643) [-1239.881] (-1239.955) (-1243.419) * [-1237.801] (-1242.782) (-1240.162) (-1245.060) -- 0:00:03 943500 -- (-1239.122) [-1241.333] (-1240.119) (-1242.512) * (-1240.319) [-1239.490] (-1239.693) (-1241.209) -- 0:00:03 944000 -- (-1240.982) (-1239.941) (-1240.688) [-1240.650] * (-1239.539) (-1242.274) [-1237.477] (-1241.158) -- 0:00:03 944500 -- (-1239.353) (-1239.217) [-1238.790] (-1241.798) * (-1238.133) (-1238.351) (-1238.332) [-1244.796] -- 0:00:03 945000 -- [-1241.242] (-1240.346) (-1246.791) (-1240.338) * (-1241.547) (-1240.921) [-1239.736] (-1241.126) -- 0:00:03 Average standard deviation of split frequencies: 0.008936 945500 -- (-1240.399) (-1239.858) (-1243.091) [-1241.218] * (-1240.221) (-1241.096) [-1239.935] (-1243.794) -- 0:00:03 946000 -- [-1237.590] (-1239.851) (-1240.893) (-1238.970) * (-1241.828) (-1242.796) [-1238.184] (-1240.630) -- 0:00:03 946500 -- [-1239.958] (-1239.023) (-1239.106) (-1240.046) * (-1238.627) (-1245.093) [-1238.434] (-1238.013) -- 0:00:03 947000 -- (-1239.492) (-1246.460) (-1243.279) [-1240.448] * (-1239.937) (-1244.469) (-1238.266) [-1238.357] -- 0:00:03 947500 -- (-1241.360) (-1240.750) [-1237.783] (-1242.093) * [-1240.645] (-1243.305) (-1239.321) (-1237.294) -- 0:00:03 948000 -- (-1240.256) (-1238.349) (-1239.174) [-1238.522] * (-1244.241) (-1238.962) (-1242.169) [-1237.920] -- 0:00:03 948500 -- (-1239.431) (-1239.803) [-1241.142] (-1239.735) * [-1241.702] (-1241.349) (-1240.464) (-1240.461) -- 0:00:03 949000 -- (-1238.020) [-1242.186] (-1244.566) (-1238.848) * [-1237.286] (-1243.565) (-1239.520) (-1238.771) -- 0:00:03 949500 -- [-1239.495] (-1241.400) (-1241.613) (-1239.046) * [-1237.639] (-1242.695) (-1237.671) (-1238.365) -- 0:00:03 950000 -- [-1239.541] (-1241.115) (-1238.640) (-1241.215) * (-1237.449) (-1238.909) [-1242.759] (-1242.315) -- 0:00:03 Average standard deviation of split frequencies: 0.009091 950500 -- [-1238.906] (-1241.241) (-1240.571) (-1237.546) * (-1240.189) (-1237.232) [-1239.081] (-1241.487) -- 0:00:03 951000 -- (-1240.733) (-1240.214) (-1241.117) [-1242.100] * [-1239.807] (-1239.010) (-1238.998) (-1238.397) -- 0:00:03 951500 -- [-1238.566] (-1244.389) (-1239.198) (-1240.239) * (-1239.415) [-1237.372] (-1243.149) (-1239.415) -- 0:00:03 952000 -- [-1237.206] (-1243.153) (-1237.879) (-1240.010) * (-1239.983) (-1240.720) (-1240.600) [-1242.154] -- 0:00:03 952500 -- (-1237.777) [-1237.944] (-1237.930) (-1238.176) * (-1241.839) (-1240.468) [-1240.998] (-1239.934) -- 0:00:03 953000 -- (-1243.227) (-1241.649) (-1238.617) [-1239.567] * (-1238.351) [-1239.924] (-1238.134) (-1240.610) -- 0:00:03 953500 -- [-1241.107] (-1243.241) (-1237.620) (-1239.158) * (-1239.477) [-1242.534] (-1240.335) (-1242.643) -- 0:00:02 954000 -- [-1238.779] (-1241.642) (-1239.664) (-1238.323) * (-1247.895) (-1242.358) [-1238.102] (-1238.939) -- 0:00:02 954500 -- [-1239.754] (-1237.659) (-1239.670) (-1240.727) * (-1239.432) (-1238.449) (-1238.138) [-1238.861] -- 0:00:02 955000 -- (-1239.504) [-1239.281] (-1238.939) (-1241.560) * (-1241.171) (-1238.049) (-1239.165) [-1241.532] -- 0:00:02 Average standard deviation of split frequencies: 0.009040 955500 -- (-1239.676) (-1240.542) [-1239.118] (-1238.176) * (-1241.097) [-1241.262] (-1237.659) (-1240.289) -- 0:00:02 956000 -- (-1239.307) (-1238.903) [-1238.612] (-1238.676) * (-1238.863) (-1241.550) [-1238.827] (-1239.699) -- 0:00:02 956500 -- (-1239.018) (-1238.162) (-1238.980) [-1239.871] * (-1238.534) [-1238.806] (-1242.416) (-1238.209) -- 0:00:02 957000 -- (-1241.673) (-1238.132) (-1238.583) [-1238.907] * (-1238.364) (-1240.289) (-1239.074) [-1241.342] -- 0:00:02 957500 -- [-1241.923] (-1237.613) (-1238.892) (-1244.196) * (-1243.102) (-1241.510) [-1244.422] (-1239.005) -- 0:00:02 958000 -- [-1240.088] (-1239.960) (-1238.960) (-1238.971) * (-1244.132) [-1238.519] (-1241.454) (-1237.527) -- 0:00:02 958500 -- (-1239.291) [-1240.035] (-1238.703) (-1238.543) * (-1239.702) (-1238.338) [-1238.972] (-1239.409) -- 0:00:02 959000 -- (-1242.041) (-1242.216) (-1241.625) [-1238.177] * (-1241.026) (-1238.197) (-1238.972) [-1239.059] -- 0:00:02 959500 -- (-1242.023) [-1241.126] (-1244.588) (-1241.272) * (-1241.722) [-1239.152] (-1241.920) (-1239.350) -- 0:00:02 960000 -- (-1237.756) (-1241.617) (-1239.133) [-1238.779] * (-1239.283) (-1237.755) [-1237.597] (-1239.912) -- 0:00:02 Average standard deviation of split frequencies: 0.008375 960500 -- [-1238.064] (-1240.370) (-1242.377) (-1237.571) * (-1238.335) [-1237.767] (-1237.673) (-1243.215) -- 0:00:02 961000 -- (-1239.562) [-1241.080] (-1238.670) (-1238.223) * (-1238.771) (-1237.758) [-1238.522] (-1240.920) -- 0:00:02 961500 -- [-1237.707] (-1245.555) (-1241.667) (-1238.214) * (-1238.548) (-1237.977) [-1238.356] (-1241.249) -- 0:00:02 962000 -- [-1239.707] (-1240.089) (-1239.906) (-1238.536) * (-1241.542) (-1237.960) (-1237.461) [-1242.745] -- 0:00:02 962500 -- (-1239.622) (-1238.799) [-1238.286] (-1239.913) * [-1240.202] (-1239.670) (-1238.030) (-1238.856) -- 0:00:02 963000 -- (-1237.575) [-1237.926] (-1238.549) (-1240.071) * (-1238.126) (-1238.879) [-1237.554] (-1241.420) -- 0:00:02 963500 -- (-1239.988) (-1240.760) (-1238.110) [-1239.771] * (-1240.783) [-1238.567] (-1237.552) (-1241.970) -- 0:00:02 964000 -- [-1242.921] (-1239.701) (-1238.346) (-1240.466) * (-1237.997) (-1241.003) (-1240.122) [-1241.923] -- 0:00:02 964500 -- (-1239.197) (-1242.199) [-1239.625] (-1239.037) * (-1238.187) (-1238.081) [-1237.112] (-1245.350) -- 0:00:02 965000 -- (-1239.314) (-1241.224) [-1240.357] (-1239.804) * (-1237.664) (-1237.817) (-1239.438) [-1240.036] -- 0:00:02 Average standard deviation of split frequencies: 0.008263 965500 -- (-1238.103) (-1239.921) (-1239.395) [-1241.272] * (-1240.120) (-1238.928) [-1238.240] (-1240.439) -- 0:00:02 966000 -- (-1241.345) [-1242.315] (-1238.873) (-1239.620) * (-1241.495) (-1238.974) (-1244.780) [-1239.749] -- 0:00:02 966500 -- (-1242.560) [-1238.739] (-1237.925) (-1240.093) * (-1246.456) (-1239.471) [-1239.060] (-1242.255) -- 0:00:02 967000 -- (-1238.576) [-1237.547] (-1237.838) (-1239.119) * (-1245.410) (-1239.517) (-1242.631) [-1239.625] -- 0:00:02 967500 -- (-1244.758) (-1237.412) [-1241.117] (-1238.797) * (-1243.721) (-1239.342) [-1239.215] (-1239.904) -- 0:00:02 968000 -- (-1244.328) [-1239.192] (-1240.335) (-1241.825) * [-1241.493] (-1245.453) (-1239.400) (-1237.913) -- 0:00:02 968500 -- (-1241.452) [-1237.480] (-1238.163) (-1240.074) * (-1239.067) (-1241.379) (-1237.852) [-1238.089] -- 0:00:02 969000 -- [-1242.951] (-1238.313) (-1238.443) (-1238.222) * (-1240.574) (-1241.788) (-1239.037) [-1238.314] -- 0:00:01 969500 -- [-1240.207] (-1237.104) (-1240.143) (-1240.068) * (-1239.019) (-1240.444) [-1238.217] (-1239.103) -- 0:00:01 970000 -- [-1239.283] (-1240.551) (-1238.631) (-1241.578) * (-1237.298) (-1240.074) [-1240.770] (-1237.849) -- 0:00:01 Average standard deviation of split frequencies: 0.008127 970500 -- (-1240.328) (-1240.965) [-1237.373] (-1241.218) * (-1239.950) (-1238.812) [-1243.507] (-1238.727) -- 0:00:01 971000 -- [-1240.602] (-1244.168) (-1239.992) (-1240.897) * (-1242.892) (-1237.517) [-1247.915] (-1240.637) -- 0:00:01 971500 -- (-1239.090) (-1241.072) [-1238.001] (-1239.497) * [-1239.590] (-1238.431) (-1243.287) (-1247.197) -- 0:00:01 972000 -- [-1238.341] (-1239.001) (-1238.937) (-1238.663) * [-1237.251] (-1238.166) (-1243.419) (-1239.769) -- 0:00:01 972500 -- (-1243.305) (-1239.841) (-1237.761) [-1238.639] * (-1239.427) (-1239.045) (-1243.889) [-1238.121] -- 0:00:01 973000 -- (-1239.047) (-1238.208) (-1238.761) [-1240.134] * (-1238.000) (-1238.832) (-1240.516) [-1237.770] -- 0:00:01 973500 -- [-1237.613] (-1244.642) (-1239.012) (-1237.747) * (-1240.477) (-1241.659) [-1239.006] (-1240.912) -- 0:00:01 974000 -- (-1240.590) [-1239.022] (-1239.842) (-1238.230) * (-1241.264) (-1241.766) (-1238.804) [-1240.892] -- 0:00:01 974500 -- (-1239.371) [-1241.582] (-1237.325) (-1239.101) * (-1239.240) (-1239.345) (-1239.532) [-1240.434] -- 0:00:01 975000 -- (-1239.730) (-1238.063) (-1240.840) [-1241.182] * [-1237.947] (-1240.453) (-1238.782) (-1244.165) -- 0:00:01 Average standard deviation of split frequencies: 0.008050 975500 -- (-1238.160) (-1242.758) [-1238.336] (-1243.863) * (-1238.167) (-1238.859) [-1238.506] (-1239.885) -- 0:00:01 976000 -- (-1241.093) (-1239.173) [-1237.714] (-1243.869) * (-1244.177) (-1238.375) [-1239.192] (-1237.946) -- 0:00:01 976500 -- (-1238.314) [-1240.503] (-1239.607) (-1238.607) * [-1239.881] (-1238.248) (-1241.070) (-1237.955) -- 0:00:01 977000 -- (-1238.456) (-1237.560) (-1237.256) [-1240.362] * (-1239.553) (-1237.971) [-1239.037] (-1243.838) -- 0:00:01 977500 -- (-1240.079) [-1237.284] (-1237.986) (-1240.049) * (-1238.261) (-1237.264) (-1240.454) [-1239.477] -- 0:00:01 978000 -- (-1239.626) [-1239.491] (-1242.725) (-1243.534) * (-1242.734) (-1237.266) [-1238.313] (-1239.564) -- 0:00:01 978500 -- (-1244.714) [-1237.237] (-1237.996) (-1244.988) * (-1242.166) (-1237.515) (-1238.514) [-1238.280] -- 0:00:01 979000 -- (-1241.171) (-1237.353) [-1238.456] (-1244.577) * (-1240.651) (-1237.243) (-1238.404) [-1239.478] -- 0:00:01 979500 -- (-1243.176) [-1242.469] (-1239.941) (-1240.684) * (-1240.058) (-1247.113) (-1239.656) [-1238.675] -- 0:00:01 980000 -- [-1239.718] (-1239.143) (-1239.401) (-1239.669) * (-1239.636) (-1238.718) [-1238.974] (-1238.983) -- 0:00:01 Average standard deviation of split frequencies: 0.008108 980500 -- (-1239.603) (-1240.330) [-1239.307] (-1241.986) * (-1242.453) (-1238.370) (-1239.826) [-1238.378] -- 0:00:01 981000 -- (-1239.957) [-1239.208] (-1240.750) (-1243.232) * (-1240.833) (-1238.052) (-1245.407) [-1238.207] -- 0:00:01 981500 -- [-1240.546] (-1239.524) (-1239.157) (-1240.071) * (-1240.443) [-1238.732] (-1242.340) (-1238.696) -- 0:00:01 982000 -- (-1238.383) [-1239.680] (-1239.459) (-1241.764) * (-1241.374) (-1239.638) (-1238.909) [-1239.319] -- 0:00:01 982500 -- (-1240.390) [-1237.891] (-1238.715) (-1244.580) * (-1239.842) (-1239.186) (-1239.517) [-1237.888] -- 0:00:01 983000 -- (-1238.280) (-1238.870) (-1242.690) [-1239.239] * (-1247.532) (-1238.762) (-1241.800) [-1239.532] -- 0:00:01 983500 -- (-1240.422) [-1240.121] (-1238.472) (-1244.614) * (-1238.851) [-1239.023] (-1238.963) (-1239.571) -- 0:00:01 984000 -- (-1238.042) (-1240.053) [-1238.423] (-1242.335) * (-1238.873) (-1239.863) (-1240.847) [-1239.054] -- 0:00:01 984500 -- [-1237.865] (-1240.937) (-1237.753) (-1240.567) * [-1242.856] (-1239.027) (-1240.904) (-1241.269) -- 0:00:00 985000 -- [-1238.297] (-1237.727) (-1239.793) (-1240.683) * (-1237.917) (-1239.619) [-1239.575] (-1240.095) -- 0:00:00 Average standard deviation of split frequencies: 0.008096 985500 -- (-1238.832) (-1239.294) (-1240.246) [-1240.853] * [-1240.377] (-1242.366) (-1239.353) (-1239.276) -- 0:00:00 986000 -- (-1238.402) [-1238.395] (-1241.190) (-1241.947) * (-1245.088) (-1239.884) (-1244.303) [-1238.223] -- 0:00:00 986500 -- (-1238.039) (-1238.309) (-1240.278) [-1240.583] * [-1239.716] (-1241.288) (-1242.955) (-1238.671) -- 0:00:00 987000 -- (-1238.747) [-1239.105] (-1239.199) (-1239.049) * (-1239.079) [-1242.696] (-1240.996) (-1241.103) -- 0:00:00 987500 -- (-1237.723) (-1237.903) [-1238.431] (-1238.860) * (-1238.157) (-1239.724) [-1237.532] (-1237.517) -- 0:00:00 988000 -- (-1237.149) (-1242.132) (-1242.247) [-1240.098] * (-1237.903) (-1238.354) (-1237.631) [-1241.015] -- 0:00:00 988500 -- (-1237.331) (-1238.573) [-1239.222] (-1237.845) * (-1238.863) [-1238.138] (-1240.036) (-1240.173) -- 0:00:00 989000 -- (-1237.331) [-1239.006] (-1239.419) (-1238.247) * (-1240.060) (-1238.134) (-1240.938) [-1242.588] -- 0:00:00 989500 -- [-1240.507] (-1237.612) (-1239.194) (-1238.081) * (-1238.080) [-1237.716] (-1240.049) (-1244.278) -- 0:00:00 990000 -- (-1239.195) (-1237.515) (-1239.994) [-1238.215] * (-1238.740) (-1242.888) [-1239.027] (-1239.678) -- 0:00:00 Average standard deviation of split frequencies: 0.008280 990500 -- (-1238.043) (-1241.427) [-1241.680] (-1238.335) * (-1243.336) (-1240.339) [-1241.347] (-1239.278) -- 0:00:00 991000 -- (-1238.034) (-1239.830) (-1238.259) [-1239.180] * (-1238.275) (-1238.752) [-1240.244] (-1238.362) -- 0:00:00 991500 -- (-1239.545) (-1238.982) (-1238.702) [-1239.191] * [-1238.334] (-1240.919) (-1238.049) (-1238.870) -- 0:00:00 992000 -- (-1240.615) (-1239.236) [-1239.831] (-1238.399) * (-1239.376) [-1238.501] (-1237.796) (-1239.202) -- 0:00:00 992500 -- [-1238.961] (-1238.575) (-1240.915) (-1238.669) * [-1238.982] (-1237.773) (-1237.568) (-1240.607) -- 0:00:00 993000 -- (-1240.929) (-1239.302) [-1241.256] (-1240.291) * (-1241.821) (-1237.836) (-1238.183) [-1240.249] -- 0:00:00 993500 -- (-1237.674) [-1239.794] (-1238.679) (-1240.186) * (-1238.252) (-1238.588) [-1243.421] (-1240.679) -- 0:00:00 994000 -- (-1239.370) [-1241.076] (-1243.315) (-1241.096) * (-1237.526) (-1241.784) (-1242.650) [-1240.500] -- 0:00:00 994500 -- [-1239.729] (-1239.691) (-1238.362) (-1242.611) * (-1238.125) [-1239.354] (-1239.757) (-1243.581) -- 0:00:00 995000 -- (-1238.056) [-1238.857] (-1241.340) (-1248.260) * (-1238.239) (-1240.263) (-1237.936) [-1242.863] -- 0:00:00 Average standard deviation of split frequencies: 0.008362 995500 -- (-1241.668) (-1237.788) (-1241.052) [-1240.225] * (-1243.120) [-1239.456] (-1241.668) (-1239.285) -- 0:00:00 996000 -- (-1239.370) (-1239.954) (-1237.266) [-1241.925] * (-1242.050) (-1245.368) (-1238.461) [-1242.865] -- 0:00:00 996500 -- (-1239.005) (-1239.287) (-1239.328) [-1242.288] * (-1240.244) (-1237.829) [-1240.533] (-1241.574) -- 0:00:00 997000 -- (-1237.316) (-1242.227) (-1240.766) [-1241.010] * (-1239.853) (-1242.209) (-1241.639) [-1239.229] -- 0:00:00 997500 -- [-1239.097] (-1242.621) (-1239.541) (-1238.155) * (-1238.165) (-1241.963) [-1238.372] (-1237.911) -- 0:00:00 998000 -- (-1240.633) (-1242.285) (-1239.360) [-1239.394] * (-1240.526) (-1244.806) (-1237.635) [-1237.613] -- 0:00:00 998500 -- (-1239.105) (-1239.531) [-1238.988] (-1237.780) * (-1239.645) [-1240.143] (-1241.123) (-1239.117) -- 0:00:00 999000 -- (-1239.337) (-1239.599) (-1238.836) [-1241.311] * (-1242.079) (-1238.678) [-1238.555] (-1238.751) -- 0:00:00 999500 -- (-1238.417) (-1243.438) (-1239.315) [-1238.247] * [-1240.305] (-1238.061) (-1237.666) (-1242.035) -- 0:00:00 1000000 -- (-1242.171) (-1241.771) (-1239.718) [-1238.072] * (-1239.880) (-1241.078) (-1239.116) [-1239.174] -- 0:00:00 Average standard deviation of split frequencies: 0.008605 Analysis completed in 1 mins 4 seconds Analysis used 62.10 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1236.98 Likelihood of best state for "cold" chain of run 2 was -1236.98 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.0 % ( 72 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.7 % ( 19 %) Dirichlet(Pi{all}) 28.3 % ( 27 %) Slider(Pi{all}) 78.8 % ( 53 %) Multiplier(Alpha{1,2}) 78.0 % ( 53 %) Multiplier(Alpha{3}) 17.7 % ( 32 %) Slider(Pinvar{all}) 98.7 % ( 97 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 75 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 87 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 32 %) Multiplier(V{all}) 97.4 % ( 98 %) Nodeslider(V{all}) 30.5 % ( 30 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.4 % ( 84 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.6 % ( 22 %) Dirichlet(Pi{all}) 27.8 % ( 26 %) Slider(Pi{all}) 78.9 % ( 48 %) Multiplier(Alpha{1,2}) 77.7 % ( 47 %) Multiplier(Alpha{3}) 17.9 % ( 22 %) Slider(Pinvar{all}) 98.7 % (100 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 71 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 93 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 32 %) Multiplier(V{all}) 97.4 % ( 99 %) Nodeslider(V{all}) 30.3 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166187 0.82 0.67 3 | 166787 166768 0.84 4 | 166888 167100 166270 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166787 0.82 0.67 3 | 166939 166109 0.84 4 | 167153 166479 166533 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1238.70 | 2 | | 1 1 1 1 | | 1 1 11 | | 222 2 | | 1 * 1 12 1 1 2 1 21 2 2 2 | | 1 21 12 1 2 1 2 2 2 | | 2 2 2 2 2 1 1122 21 1 | | 1 22 12 1 1 1 2 2 2 2 1 2 1 2 2 1 | |122 121 2 1 1 1 2 2 1 | |2 1 2 1 2 1 | | 1 2 2 1 1 1 11 2 | | 2 11 2 1 1 1 *| | 1 2 2 1 22 | | 2 1 1 | | 2 2 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1240.15 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1238.71 -1241.08 2 -1238.69 -1242.14 -------------------------------------- TOTAL -1238.70 -1241.74 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.894817 0.087918 0.362040 1.477361 0.866666 1501.00 1501.00 1.000 r(A<->C){all} 0.175453 0.021622 0.000023 0.472558 0.135992 209.80 271.58 1.001 r(A<->G){all} 0.167245 0.021206 0.000114 0.462683 0.124889 138.38 167.18 1.000 r(A<->T){all} 0.164169 0.019934 0.000084 0.456381 0.124230 206.09 235.89 1.000 r(C<->G){all} 0.168677 0.019672 0.000248 0.441496 0.133887 162.07 190.09 1.001 r(C<->T){all} 0.154638 0.017251 0.000009 0.423770 0.123429 165.08 218.94 1.003 r(G<->T){all} 0.169818 0.021015 0.000089 0.470421 0.132173 199.06 202.46 1.007 pi(A){all} 0.199853 0.000172 0.175039 0.226740 0.199793 1202.69 1265.72 1.000 pi(C){all} 0.328794 0.000235 0.296947 0.356225 0.328433 1011.24 1138.98 1.000 pi(G){all} 0.289173 0.000220 0.262174 0.319923 0.289134 1205.27 1277.88 1.000 pi(T){all} 0.182179 0.000162 0.158004 0.207276 0.181839 1056.03 1095.77 1.000 alpha{1,2} 0.423703 0.224410 0.000165 1.354298 0.254537 1300.23 1315.49 1.000 alpha{3} 0.460566 0.226767 0.000147 1.428153 0.300641 936.63 1218.82 1.000 pinvar{all} 0.998379 0.000004 0.994770 0.999999 0.998952 1339.08 1388.56 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .*.*** 8 -- ..**.. 9 -- .****. 10 -- .*..*. 11 -- .*...* 12 -- .*.*.. 13 -- ....** 14 -- ..*.*. 15 -- ..**** 16 -- .**... 17 -- .**.** 18 -- .***.* 19 -- ...*.* 20 -- ...**. 21 -- ..*..* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 464 0.154564 0.016959 0.142572 0.166556 2 8 460 0.153231 0.007537 0.147901 0.158561 2 9 454 0.151233 0.004711 0.147901 0.154564 2 10 451 0.150233 0.001413 0.149234 0.151233 2 11 440 0.146569 0.003769 0.143904 0.149234 2 12 432 0.143904 0.007537 0.138574 0.149234 2 13 428 0.142572 0.014133 0.132578 0.152565 2 14 426 0.141905 0.003769 0.139241 0.144570 2 15 423 0.140906 0.015546 0.129913 0.151899 2 16 422 0.140573 0.001884 0.139241 0.141905 2 17 421 0.140240 0.002355 0.138574 0.141905 2 18 410 0.136576 0.010364 0.129247 0.143904 2 19 409 0.136243 0.004240 0.133245 0.139241 2 20 407 0.135576 0.020257 0.121252 0.149900 2 21 383 0.127582 0.014604 0.117255 0.137908 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.103694 0.010587 0.000019 0.318418 0.070348 1.000 2 length{all}[2] 0.098384 0.009889 0.000078 0.298688 0.067385 1.000 2 length{all}[3] 0.097556 0.009028 0.000072 0.284385 0.067704 1.000 2 length{all}[4] 0.098506 0.009747 0.000022 0.299613 0.068661 1.000 2 length{all}[5] 0.096364 0.009574 0.000006 0.285446 0.066797 1.000 2 length{all}[6] 0.100233 0.009651 0.000026 0.292119 0.071211 1.000 2 length{all}[7] 0.095594 0.008548 0.000082 0.291815 0.066929 0.998 2 length{all}[8] 0.100342 0.008690 0.000097 0.279914 0.073848 1.000 2 length{all}[9] 0.104019 0.010907 0.000088 0.302265 0.075514 1.008 2 length{all}[10] 0.098112 0.009236 0.000354 0.275400 0.067123 0.998 2 length{all}[11] 0.102003 0.009663 0.000039 0.293122 0.068707 1.001 2 length{all}[12] 0.098871 0.008880 0.000107 0.318297 0.072262 0.998 2 length{all}[13] 0.101638 0.011217 0.000262 0.292511 0.070068 0.998 2 length{all}[14] 0.110991 0.014408 0.000028 0.376725 0.069846 1.001 2 length{all}[15] 0.092899 0.008271 0.000733 0.261929 0.069677 0.998 2 length{all}[16] 0.095903 0.008627 0.000213 0.295096 0.067821 0.998 2 length{all}[17] 0.094284 0.008563 0.000098 0.268904 0.068446 0.999 2 length{all}[18] 0.091902 0.007515 0.000063 0.255907 0.067034 0.998 2 length{all}[19] 0.104713 0.009168 0.000320 0.313877 0.076108 1.006 2 length{all}[20] 0.108315 0.011860 0.001060 0.339343 0.072586 0.998 2 length{all}[21] 0.100659 0.010695 0.000082 0.327315 0.071231 1.003 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008605 Maximum standard deviation of split frequencies = 0.020257 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.008 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------------- C1 (1) | |-------------------------------------------------------------------- C2 (2) | |-------------------------------------------------------------------- C3 (3) + |--------------------------------------------------------------------- C4 (4) | |-------------------------------------------------------------------- C5 (5) | \------------------------------------------------------------------------ C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 912 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 56 patterns at 304 / 304 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 56 patterns at 304 / 304 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 54656 bytes for conP 4928 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.037633 0.101465 0.031442 0.063946 0.095302 0.066884 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1310.182672 Iterating by ming2 Initial: fx= 1310.182672 x= 0.03763 0.10147 0.03144 0.06395 0.09530 0.06688 0.30000 1.30000 1 h-m-p 0.0000 0.0001 727.9335 ++ 1254.323026 m 0.0001 13 | 1/8 2 h-m-p 0.0012 0.0059 57.4200 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 667.4890 ++ 1245.083743 m 0.0000 44 | 2/8 4 h-m-p 0.0003 0.0089 39.7778 ----------.. | 2/8 5 h-m-p 0.0000 0.0001 596.7215 ++ 1213.492293 m 0.0001 74 | 3/8 6 h-m-p 0.0016 0.0135 28.1557 -----------.. | 3/8 7 h-m-p 0.0000 0.0000 518.7045 ++ 1210.831107 m 0.0000 105 | 4/8 8 h-m-p 0.0002 0.0240 18.0941 ----------.. | 4/8 9 h-m-p 0.0000 0.0001 422.9281 ++ 1193.587909 m 0.0001 135 | 5/8 10 h-m-p 0.0026 0.0450 11.0945 ------------.. | 5/8 11 h-m-p 0.0000 0.0000 300.4526 ++ 1191.702325 m 0.0000 167 | 6/8 12 h-m-p 0.0512 8.0000 0.0000 -Y 1191.702325 0 0.0032 179 | 6/8 13 h-m-p 0.2330 8.0000 0.0000 Y 1191.702325 0 0.0583 192 Out.. lnL = -1191.702325 193 lfun, 193 eigenQcodon, 1158 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.023696 0.051797 0.076003 0.102488 0.056114 0.071309 0.299928 0.600970 0.513684 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.404728 np = 9 lnL0 = -1304.411901 Iterating by ming2 Initial: fx= 1304.411901 x= 0.02370 0.05180 0.07600 0.10249 0.05611 0.07131 0.29993 0.60097 0.51368 1 h-m-p 0.0000 0.0001 711.3435 ++ 1263.172882 m 0.0001 14 | 1/9 2 h-m-p 0.0001 0.0004 384.6959 ++ 1221.254974 m 0.0004 26 | 2/9 3 h-m-p 0.0000 0.0000 30857.7993 ++ 1215.998160 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0001 1396.4007 ++ 1201.686119 m 0.0001 50 | 4/9 5 h-m-p 0.0000 0.0000 81942.4422 ++ 1198.890629 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 23211.9184 ++ 1193.501176 m 0.0000 74 | 6/9 7 h-m-p 0.0083 0.1496 3.1316 -------------.. | 6/9 8 h-m-p 0.0000 0.0000 300.2675 ++ 1191.702353 m 0.0000 109 | 7/9 9 h-m-p 0.0160 8.0000 0.0000 +++++ 1191.702353 m 8.0000 124 | 7/9 10 h-m-p 0.0160 8.0000 0.0221 +++++ 1191.702347 m 8.0000 141 | 7/9 11 h-m-p 0.1128 0.5638 1.0177 ++ 1191.702333 m 0.5638 155 | 8/9 12 h-m-p 1.6000 8.0000 0.1250 ----------C 1191.702333 0 0.0000 177 | 8/9 13 h-m-p 0.0629 8.0000 0.0000 C 1191.702333 0 0.0157 190 | 8/9 14 h-m-p 0.0160 8.0000 0.0000 +++++ 1191.702333 m 8.0000 206 | 8/9 15 h-m-p 0.0030 1.4960 0.4782 +++++ 1191.702327 m 1.4960 222 | 9/9 16 h-m-p 0.0160 8.0000 0.0000 N 1191.702327 0 0.0160 235 | 9/9 17 h-m-p 0.0160 8.0000 0.0000 N 1191.702327 0 0.0160 247 Out.. lnL = -1191.702327 248 lfun, 744 eigenQcodon, 2976 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.059948 0.099541 0.097781 0.073890 0.051399 0.016461 0.000100 1.071458 0.272989 0.238691 1.351380 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 11.536473 np = 11 lnL0 = -1303.646409 Iterating by ming2 Initial: fx= 1303.646409 x= 0.05995 0.09954 0.09778 0.07389 0.05140 0.01646 0.00011 1.07146 0.27299 0.23869 1.35138 1 h-m-p 0.0000 0.0000 643.3169 ++ 1302.797628 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0002 433.4877 +++ 1275.734668 m 0.0002 31 | 2/11 3 h-m-p 0.0001 0.0004 202.3006 ++ 1233.205945 m 0.0004 45 | 3/11 4 h-m-p 0.0003 0.0017 60.0659 ++ 1220.699932 m 0.0017 59 | 4/11 5 h-m-p 0.0000 0.0000 8216781.4311 ++ 1211.177675 m 0.0000 73 | 5/11 6 h-m-p 0.0009 0.0046 28.0282 ++ 1210.695215 m 0.0046 87 | 6/11 7 h-m-p 0.0000 0.0000 179.5042 ++ 1209.157898 m 0.0000 101 | 7/11 8 h-m-p 0.0001 0.0479 35.3315 +++++ 1191.702347 m 0.0479 118 | 8/11 9 h-m-p 1.6000 8.0000 0.0000 ++ 1191.702347 m 8.0000 132 | 8/11 10 h-m-p 0.0160 8.0000 0.0305 -------Y 1191.702347 0 0.0000 156 | 8/11 11 h-m-p 0.0160 8.0000 0.0001 +++++ 1191.702347 m 8.0000 176 | 8/11 12 h-m-p 0.0160 8.0000 9.6360 ++Y 1191.702326 0 0.2560 195 | 8/11 13 h-m-p 1.6000 8.0000 0.3361 Y 1191.702325 0 3.5276 209 | 8/11 14 h-m-p 1.6000 8.0000 0.1356 C 1191.702325 0 1.6000 226 | 8/11 15 h-m-p 1.6000 8.0000 0.0073 C 1191.702325 0 1.7784 243 | 8/11 16 h-m-p 1.6000 8.0000 0.0074 -C 1191.702325 0 0.1540 261 | 8/11 17 h-m-p 1.6000 8.0000 0.0004 ++ 1191.702325 m 8.0000 278 | 8/11 18 h-m-p 0.1228 8.0000 0.0245 ++C 1191.702325 0 2.1482 297 | 8/11 19 h-m-p 1.6000 8.0000 0.0019 ++ 1191.702325 m 8.0000 314 | 8/11 20 h-m-p 0.0566 8.0000 0.2746 ++C 1191.702325 0 1.3879 333 | 8/11 21 h-m-p 1.6000 8.0000 0.1424 ++ 1191.702324 m 8.0000 350 | 8/11 22 h-m-p 0.7343 8.0000 1.5516 +Y 1191.702320 0 2.9370 368 | 8/11 23 h-m-p 1.6000 8.0000 2.1186 ++ 1191.702311 m 8.0000 382 | 8/11 24 h-m-p 1.6000 8.0000 0.6278 -----------C 1191.702311 0 0.0000 407 | 8/11 25 h-m-p 0.0160 8.0000 0.0020 C 1191.702311 0 0.0160 424 | 8/11 26 h-m-p 1.6000 8.0000 0.0000 -----Y 1191.702311 0 0.0004 446 Out.. lnL = -1191.702311 447 lfun, 1788 eigenQcodon, 8046 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1191.695978 S = -1191.695205 -0.000295 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:03 did 20 / 56 patterns 0:03 did 30 / 56 patterns 0:03 did 40 / 56 patterns 0:03 did 50 / 56 patterns 0:03 did 56 / 56 patterns 0:03 Time used: 0:03 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.089025 0.098265 0.104392 0.042436 0.028242 0.063137 0.000100 0.645479 1.769463 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 19.809153 np = 9 lnL0 = -1312.481298 Iterating by ming2 Initial: fx= 1312.481298 x= 0.08903 0.09827 0.10439 0.04244 0.02824 0.06314 0.00011 0.64548 1.76946 1 h-m-p 0.0000 0.0000 657.5010 ++ 1311.956622 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0097 68.0879 +++++ 1280.584448 m 0.0097 29 | 2/9 3 h-m-p 0.0001 0.0006 372.0588 ++ 1245.683553 m 0.0006 41 | 3/9 4 h-m-p 0.0001 0.0003 136.5134 ++ 1235.933220 m 0.0003 53 | 4/9 5 h-m-p 0.0001 0.0003 58.6867 ++ 1235.434164 m 0.0003 65 | 5/9 6 h-m-p 0.0000 0.0001 343.8586 ++ 1224.059359 m 0.0001 77 | 6/9 7 h-m-p 0.0001 0.0007 554.7233 ++ 1206.157917 m 0.0007 89 | 7/9 8 h-m-p 0.0060 1.6276 59.6830 QuantileBeta(0.15, 0.00500, 2.22912) = 1.174542e-160 2000 rounds ------------.. | 7/9 9 h-m-p 0.0000 0.0002 287.5136 +++ 1191.702393 m 0.0002 124 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 N 1191.702393 0 1.6000 136 | 7/9 11 h-m-p 0.0160 8.0000 0.0000 Y 1191.702393 0 0.0160 149 | 7/9 12 h-m-p 1.1962 8.0000 0.0000 -Y 1191.702393 0 0.0748 164 Out.. lnL = -1191.702393 165 lfun, 1815 eigenQcodon, 9900 P(t) Time used: 0:06 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.013986 0.011031 0.036189 0.023757 0.082996 0.070661 0.000100 0.900000 0.910169 1.683380 1.300048 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 14.771650 np = 11 lnL0 = -1260.443284 Iterating by ming2 Initial: fx= 1260.443284 x= 0.01399 0.01103 0.03619 0.02376 0.08300 0.07066 0.00011 0.90000 0.91017 1.68338 1.30005 1 h-m-p 0.0000 0.0000 679.5055 ++ 1258.807662 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0007 165.7738 +++ 1240.180540 m 0.0007 31 | 2/11 3 h-m-p 0.0000 0.0000 382.2267 ++ 1235.786537 m 0.0000 45 | 3/11 4 h-m-p 0.0001 0.0014 112.8982 ++ 1225.932896 m 0.0014 59 | 4/11 5 h-m-p 0.0000 0.0001 1008.3261 ++ 1216.797544 m 0.0001 73 | 5/11 6 h-m-p 0.0001 0.0006 1014.6377 ++ 1196.528702 m 0.0006 87 | 6/11 7 h-m-p 0.0000 0.0000 48954.9284 ++ 1191.702325 m 0.0000 101 | 7/11 8 h-m-p 1.6000 8.0000 0.0006 ++ 1191.702325 m 8.0000 115 | 7/11 9 h-m-p 0.0175 0.7958 0.2553 +++ 1191.702324 m 0.7958 134 | 7/11 10 h-m-p 0.0000 0.0000 8.0719 h-m-p: 1.77549608e-19 8.87748039e-19 8.07194160e+00 1191.702324 .. | 7/11 11 h-m-p 0.0160 8.0000 0.0000 +++++ 1191.702324 m 8.0000 166 | 7/11 12 h-m-p 0.0160 8.0000 0.0106 +++++ 1191.702322 m 8.0000 187 | 7/11 13 h-m-p 0.1882 0.9409 0.3544 ++ 1191.702318 m 0.9409 205 QuantileBeta(0.15, 0.00497, 2.01340) = 9.998264e-162 2000 rounds | 8/11 14 h-m-p 0.4433 8.0000 0.2136 +++ 1191.702315 m 8.0000 224 | 8/11 15 h-m-p 1.6000 8.0000 1.0199 ++ 1191.702312 m 8.0000 241 | 8/11 16 h-m-p 1.6000 8.0000 3.5587 ++ 1191.702311 m 8.0000 255 | 8/11 17 h-m-p 1.5443 7.7215 4.9804 ---------N 1191.702311 0 0.0000 278 | 8/11 18 h-m-p 0.5000 8.0000 0.0000 --Y 1191.702311 0 0.0078 294 | 8/11 19 h-m-p 1.6000 8.0000 0.0000 ------Y 1191.702311 0 0.0001 317 Out.. lnL = -1191.702311 318 lfun, 3816 eigenQcodon, 20988 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1191.695723 S = -1191.695161 -0.000246 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:11 did 20 / 56 patterns 0:11 did 30 / 56 patterns 0:11 did 40 / 56 patterns 0:12 did 50 / 56 patterns 0:12 did 56 / 56 patterns 0:12 Time used: 0:12 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=304 NC_011896_1_WP_010907667_1_326_MLBR_RS01590 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK NC_002677_1_NP_301343_1_215_ML0315 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK ************************************************** NC_011896_1_WP_010907667_1_326_MLBR_RS01590 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN NC_002677_1_NP_301343_1_215_ML0315 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN ************************************************** NC_011896_1_WP_010907667_1_326_MLBR_RS01590 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS NC_002677_1_NP_301343_1_215_ML0315 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS ************************************************** NC_011896_1_WP_010907667_1_326_MLBR_RS01590 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT NC_002677_1_NP_301343_1_215_ML0315 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT ************************************************** NC_011896_1_WP_010907667_1_326_MLBR_RS01590 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD NC_002677_1_NP_301343_1_215_ML0315 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD ************************************************** NC_011896_1_WP_010907667_1_326_MLBR_RS01590 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV NC_002677_1_NP_301343_1_215_ML0315 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV ************************************************** NC_011896_1_WP_010907667_1_326_MLBR_RS01590 YPVG NC_002677_1_NP_301343_1_215_ML0315 YPVG NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 YPVG NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 YPVG NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 YPVG NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 YPVG ****
>NC_011896_1_WP_010907667_1_326_MLBR_RS01590 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >NC_002677_1_NP_301343_1_215_ML0315 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC >NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 ATGGCCAAGTGGACCACCGCGGACATTCCCGACCAGACGGGTCGTGTCGC CGTCATTACCGGCGCCAACACCGGCCTCGGCTATCAGACCGCGCTGGCAC TCGCCGAGCATGGTGCCCATGTGGTGTTGGCGGTGCGCAATCTCGACAAG GGCAAGGACGCTGCCGCACGCATCACGGCCACTAGCGCACAGAACAACGT TGCGCTGCAAGAGCTCGACTTAGCGTCGTTGGAGTCTGTGCGCGCCGCAG CAAAGCAACTACGGTCCGACTACGACCACATCGACTTGCTGATCAACAAC GCCGGGGTGATGTGGACACCGAAGTCGACCACCAAGGACGGTTTCGAGTT GCAGTTCGGCACCAACCACTTAGGTCACTTTGCCTTCACCGGCTTGCTGC TGGATCGGCTGCTGCCGATCGTCGGTTCGCGGGTGATAACTGTCAGCAGC CTCAGTCACCGCCTGTTCGCTGACATTCATTTCAACGATCTGCAGTGGGA ATGCAACTACAACCGGGTCGCCGCCTATGGGCAATCCAAGCTAGCCAACC TACTGTTCACTTACGAACTGCAGCGACGACTGGCCACCCGACAAACGACG ATCGCTGTGGCCGCCCATCCCGGTGGCTCACGCACCGAACTGACCAGGAC TCTGCCCGCGCTGATTGCGCCCATTTTTTCGGTGGCCGAACTGTTCCTCA CCCAGGATGCAGCAACCGGCGCACTACCGACCCTGCGGGCTGCCACCGAT GCGGCAGTGCTCGGCGGGCAGTATTTCGGACCAGACGGGTTCGCAGAAAT ACGGGGCCACCCCAAAGTTGTGGCGTCCAACGGCAAGTCCCACGACGTTG ACCGGCAGCTCCGGCTGTGGGCGGTCTCCGAAGAACTCACCGGGGTGGTC TATCCGGTCGGC
>NC_011896_1_WP_010907667_1_326_MLBR_RS01590 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >NC_002677_1_NP_301343_1_215_ML0315 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG >NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 MAKWTTADIPDQTGRVAVITGANTGLGYQTALALAEHGAHVVLAVRNLDK GKDAAARITATSAQNNVALQELDLASLESVRAAAKQLRSDYDHIDLLINN AGVMWTPKSTTKDGFELQFGTNHLGHFAFTGLLLDRLLPIVGSRVITVSS LSHRLFADIHFNDLQWECNYNRVAAYGQSKLANLLFTYELQRRLATRQTT IAVAAHPGGSRTELTRTLPALIAPIFSVAELFLTQDAATGALPTLRAATD AAVLGGQYFGPDGFAEIRGHPKVVASNGKSHDVDRQLRLWAVSEELTGVV YPVG
#NEXUS [ID: 0021594110] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907667_1_326_MLBR_RS01590 NC_002677_1_NP_301343_1_215_ML0315 NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 ; end; begin trees; translate 1 NC_011896_1_WP_010907667_1_326_MLBR_RS01590, 2 NC_002677_1_NP_301343_1_215_ML0315, 3 NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290, 4 NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935, 5 NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690, 6 NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07034753,2:0.06738477,3:0.06770428,4:0.06866073,5:0.0667972,6:0.07121135); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07034753,2:0.06738477,3:0.06770428,4:0.06866073,5:0.0667972,6:0.07121135); end;
Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1238.71 -1241.08 2 -1238.69 -1242.14 -------------------------------------- TOTAL -1238.70 -1241.74 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0315/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.894817 0.087918 0.362040 1.477361 0.866666 1501.00 1501.00 1.000 r(A<->C){all} 0.175453 0.021622 0.000023 0.472558 0.135992 209.80 271.58 1.001 r(A<->G){all} 0.167245 0.021206 0.000114 0.462683 0.124889 138.38 167.18 1.000 r(A<->T){all} 0.164169 0.019934 0.000084 0.456381 0.124230 206.09 235.89 1.000 r(C<->G){all} 0.168677 0.019672 0.000248 0.441496 0.133887 162.07 190.09 1.001 r(C<->T){all} 0.154638 0.017251 0.000009 0.423770 0.123429 165.08 218.94 1.003 r(G<->T){all} 0.169818 0.021015 0.000089 0.470421 0.132173 199.06 202.46 1.007 pi(A){all} 0.199853 0.000172 0.175039 0.226740 0.199793 1202.69 1265.72 1.000 pi(C){all} 0.328794 0.000235 0.296947 0.356225 0.328433 1011.24 1138.98 1.000 pi(G){all} 0.289173 0.000220 0.262174 0.319923 0.289134 1205.27 1277.88 1.000 pi(T){all} 0.182179 0.000162 0.158004 0.207276 0.181839 1056.03 1095.77 1.000 alpha{1,2} 0.423703 0.224410 0.000165 1.354298 0.254537 1300.23 1315.49 1.000 alpha{3} 0.460566 0.226767 0.000147 1.428153 0.300641 936.63 1218.82 1.000 pinvar{all} 0.998379 0.000004 0.994770 0.999999 0.998952 1339.08 1388.56 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0315/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 304 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 0 0 0 0 0 0 TTC 9 9 9 9 9 9 | TCC 5 5 5 5 5 5 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1 Leu TTA 2 2 2 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 5 5 5 5 5 5 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 4 4 4 4 4 4 | Arg CGT 1 1 1 1 1 1 CTC 9 9 9 9 9 9 | CCC 5 5 5 5 5 5 | CAC 6 6 6 6 6 6 | CGC 5 5 5 5 5 5 CTA 4 4 4 4 4 4 | CCA 1 1 1 1 1 1 | Gln CAA 4 4 4 4 4 4 | CGA 3 3 3 3 3 3 CTG 18 18 18 18 18 18 | CCG 4 4 4 4 4 4 | CAG 9 9 9 9 9 9 | CGG 8 8 8 8 8 8 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 5 5 5 5 5 | Thr ACT 4 4 4 4 4 4 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1 ATC 5 5 5 5 5 5 | ACC 17 17 17 17 17 17 | AAC 11 11 11 11 11 11 | AGC 3 3 3 3 3 3 ATA 2 2 2 2 2 2 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0 Met ATG 2 2 2 2 2 2 | ACG 4 4 4 4 4 4 | AAG 8 8 8 8 8 8 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 3 3 3 3 3 | Ala GCT 4 4 4 4 4 4 | Asp GAT 4 4 4 4 4 4 | Gly GGT 6 6 6 6 6 6 GTC 8 8 8 8 8 8 | GCC 18 18 18 18 18 18 | GAC 13 13 13 13 13 13 | GGC 12 12 12 12 12 12 GTA 0 0 0 0 0 0 | GCA 10 10 10 10 10 10 | Glu GAA 7 7 7 7 7 7 | GGA 1 1 1 1 1 1 GTG 11 11 11 11 11 11 | GCG 10 10 10 10 10 10 | GAG 4 4 4 4 4 4 | GGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907667_1_326_MLBR_RS01590 position 1: T:0.13487 C:0.26645 A:0.21711 G:0.38158 position 2: T:0.27961 C:0.29276 A:0.25987 G:0.16776 position 3: T:0.13158 C:0.42763 A:0.12171 G:0.31908 Average T:0.18202 C:0.32895 A:0.19956 G:0.28947 #2: NC_002677_1_NP_301343_1_215_ML0315 position 1: T:0.13487 C:0.26645 A:0.21711 G:0.38158 position 2: T:0.27961 C:0.29276 A:0.25987 G:0.16776 position 3: T:0.13158 C:0.42763 A:0.12171 G:0.31908 Average T:0.18202 C:0.32895 A:0.19956 G:0.28947 #3: NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290 position 1: T:0.13487 C:0.26645 A:0.21711 G:0.38158 position 2: T:0.27961 C:0.29276 A:0.25987 G:0.16776 position 3: T:0.13158 C:0.42763 A:0.12171 G:0.31908 Average T:0.18202 C:0.32895 A:0.19956 G:0.28947 #4: NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935 position 1: T:0.13487 C:0.26645 A:0.21711 G:0.38158 position 2: T:0.27961 C:0.29276 A:0.25987 G:0.16776 position 3: T:0.13158 C:0.42763 A:0.12171 G:0.31908 Average T:0.18202 C:0.32895 A:0.19956 G:0.28947 #5: NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690 position 1: T:0.13487 C:0.26645 A:0.21711 G:0.38158 position 2: T:0.27961 C:0.29276 A:0.25987 G:0.16776 position 3: T:0.13158 C:0.42763 A:0.12171 G:0.31908 Average T:0.18202 C:0.32895 A:0.19956 G:0.28947 #6: NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760 position 1: T:0.13487 C:0.26645 A:0.21711 G:0.38158 position 2: T:0.27961 C:0.29276 A:0.25987 G:0.16776 position 3: T:0.13158 C:0.42763 A:0.12171 G:0.31908 Average T:0.18202 C:0.32895 A:0.19956 G:0.28947 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 24 | Cys C TGT 0 TTC 54 | TCC 30 | TAC 18 | TGC 6 Leu L TTA 12 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 30 | TCG 24 | TAG 0 | Trp W TGG 24 ------------------------------------------------------------------------------ Leu L CTT 0 | Pro P CCT 0 | His H CAT 24 | Arg R CGT 6 CTC 54 | CCC 30 | CAC 36 | CGC 30 CTA 24 | CCA 6 | Gln Q CAA 24 | CGA 18 CTG 108 | CCG 24 | CAG 54 | CGG 48 ------------------------------------------------------------------------------ Ile I ATT 30 | Thr T ACT 24 | Asn N AAT 6 | Ser S AGT 6 ATC 30 | ACC 102 | AAC 66 | AGC 18 ATA 12 | ACA 6 | Lys K AAA 6 | Arg R AGA 0 Met M ATG 12 | ACG 24 | AAG 48 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 18 | Ala A GCT 24 | Asp D GAT 24 | Gly G GGT 36 GTC 48 | GCC 108 | GAC 78 | GGC 72 GTA 0 | GCA 60 | Glu E GAA 42 | GGA 6 GTG 66 | GCG 60 | GAG 24 | GGG 30 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.13487 C:0.26645 A:0.21711 G:0.38158 position 2: T:0.27961 C:0.29276 A:0.25987 G:0.16776 position 3: T:0.13158 C:0.42763 A:0.12171 G:0.31908 Average T:0.18202 C:0.32895 A:0.19956 G:0.28947 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1191.702325 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299928 1.300048 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907667_1_326_MLBR_RS01590: 0.000004, NC_002677_1_NP_301343_1_215_ML0315: 0.000004, NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290: 0.000004, NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935: 0.000004, NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690: 0.000004, NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29993 omega (dN/dS) = 1.30005 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 717.5 194.5 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 717.5 194.5 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 717.5 194.5 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 717.5 194.5 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 717.5 194.5 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 717.5 194.5 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1191.702327 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907667_1_326_MLBR_RS01590: 0.000004, NC_002677_1_NP_301343_1_215_ML0315: 0.000004, NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290: 0.000004, NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935: 0.000004, NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690: 0.000004, NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.00001 0.99999 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 723.2 188.8 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 723.2 188.8 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 723.2 188.8 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 723.2 188.8 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 723.2 188.8 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 723.2 188.8 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1191.702311 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.008000 0.012885 0.000001 23.044375 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907667_1_326_MLBR_RS01590: 0.000004, NC_002677_1_NP_301343_1_215_ML0315: 0.000004, NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290: 0.000004, NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935: 0.000004, NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690: 0.000004, NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.00800 0.01289 0.97911 w: 0.00000 1.00000 23.04438 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 723.2 188.8 22.5760 0.0000 0.0000 0.0 0.0 7..2 0.000 723.2 188.8 22.5760 0.0000 0.0000 0.0 0.0 7..3 0.000 723.2 188.8 22.5760 0.0000 0.0000 0.0 0.0 7..4 0.000 723.2 188.8 22.5760 0.0000 0.0000 0.0 0.0 7..5 0.000 723.2 188.8 22.5760 0.0000 0.0000 0.0 0.0 7..6 0.000 723.2 188.8 22.5760 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907667_1_326_MLBR_RS01590) Pr(w>1) post mean +- SE for w 1 M 0.979* 22.576 2 A 0.979* 22.576 3 K 0.979* 22.576 4 W 0.979* 22.576 5 T 0.979* 22.576 6 T 0.979* 22.576 7 A 0.979* 22.576 8 D 0.979* 22.576 9 I 0.979* 22.576 10 P 0.979* 22.576 11 D 0.979* 22.576 12 Q 0.979* 22.576 13 T 0.979* 22.576 14 G 0.979* 22.576 15 R 0.979* 22.576 16 V 0.979* 22.576 17 A 0.979* 22.576 18 V 0.979* 22.576 19 I 0.979* 22.576 20 T 0.979* 22.576 21 G 0.979* 22.576 22 A 0.979* 22.576 23 N 0.979* 22.576 24 T 0.979* 22.576 25 G 0.979* 22.576 26 L 0.979* 22.576 27 G 0.979* 22.576 28 Y 0.979* 22.576 29 Q 0.979* 22.576 30 T 0.979* 22.576 31 A 0.979* 22.576 32 L 0.979* 22.576 33 A 0.979* 22.576 34 L 0.979* 22.576 35 A 0.979* 22.576 36 E 0.979* 22.576 37 H 0.979* 22.576 38 G 0.979* 22.576 39 A 0.979* 22.576 40 H 0.979* 22.576 41 V 0.979* 22.576 42 V 0.979* 22.576 43 L 0.979* 22.576 44 A 0.979* 22.576 45 V 0.979* 22.576 46 R 0.979* 22.576 47 N 0.979* 22.576 48 L 0.979* 22.576 49 D 0.979* 22.576 50 K 0.979* 22.576 51 G 0.979* 22.576 52 K 0.979* 22.576 53 D 0.979* 22.576 54 A 0.979* 22.576 55 A 0.979* 22.576 56 A 0.979* 22.576 57 R 0.979* 22.576 58 I 0.979* 22.576 59 T 0.979* 22.576 60 A 0.979* 22.576 61 T 0.979* 22.576 62 S 0.979* 22.576 63 A 0.979* 22.576 64 Q 0.979* 22.576 65 N 0.979* 22.576 66 N 0.979* 22.576 67 V 0.979* 22.576 68 A 0.979* 22.576 69 L 0.979* 22.576 70 Q 0.979* 22.576 71 E 0.979* 22.576 72 L 0.979* 22.576 73 D 0.979* 22.576 74 L 0.979* 22.576 75 A 0.979* 22.576 76 S 0.979* 22.576 77 L 0.979* 22.576 78 E 0.979* 22.576 79 S 0.979* 22.576 80 V 0.979* 22.576 81 R 0.979* 22.576 82 A 0.979* 22.576 83 A 0.979* 22.576 84 A 0.979* 22.576 85 K 0.979* 22.576 86 Q 0.979* 22.576 87 L 0.979* 22.576 88 R 0.979* 22.576 89 S 0.979* 22.576 90 D 0.979* 22.576 91 Y 0.979* 22.576 92 D 0.979* 22.576 93 H 0.979* 22.576 94 I 0.979* 22.576 95 D 0.979* 22.576 96 L 0.979* 22.576 97 L 0.979* 22.576 98 I 0.979* 22.576 99 N 0.979* 22.576 100 N 0.979* 22.576 101 A 0.979* 22.576 102 G 0.979* 22.576 103 V 0.979* 22.576 104 M 0.979* 22.576 105 W 0.979* 22.576 106 T 0.979* 22.576 107 P 0.979* 22.576 108 K 0.979* 22.576 109 S 0.979* 22.576 110 T 0.979* 22.576 111 T 0.979* 22.576 112 K 0.979* 22.576 113 D 0.979* 22.576 114 G 0.979* 22.576 115 F 0.979* 22.576 116 E 0.979* 22.576 117 L 0.979* 22.576 118 Q 0.979* 22.576 119 F 0.979* 22.576 120 G 0.979* 22.576 121 T 0.979* 22.576 122 N 0.979* 22.576 123 H 0.979* 22.576 124 L 0.979* 22.576 125 G 0.979* 22.576 126 H 0.979* 22.576 127 F 0.979* 22.576 128 A 0.979* 22.576 129 F 0.979* 22.576 130 T 0.979* 22.576 131 G 0.979* 22.576 132 L 0.979* 22.576 133 L 0.979* 22.576 134 L 0.979* 22.576 135 D 0.979* 22.576 136 R 0.979* 22.576 137 L 0.979* 22.576 138 L 0.979* 22.576 139 P 0.979* 22.576 140 I 0.979* 22.576 141 V 0.979* 22.576 142 G 0.979* 22.576 143 S 0.979* 22.576 144 R 0.979* 22.576 145 V 0.979* 22.576 146 I 0.979* 22.576 147 T 0.979* 22.576 148 V 0.979* 22.576 149 S 0.979* 22.576 150 S 0.979* 22.576 151 L 0.979* 22.576 152 S 0.979* 22.576 153 H 0.979* 22.576 154 R 0.979* 22.576 155 L 0.979* 22.576 156 F 0.979* 22.576 157 A 0.979* 22.576 158 D 0.979* 22.576 159 I 0.979* 22.576 160 H 0.979* 22.576 161 F 0.979* 22.576 162 N 0.979* 22.576 163 D 0.979* 22.576 164 L 0.979* 22.576 165 Q 0.979* 22.576 166 W 0.979* 22.576 167 E 0.979* 22.576 168 C 0.979* 22.576 169 N 0.979* 22.576 170 Y 0.979* 22.576 171 N 0.979* 22.576 172 R 0.979* 22.576 173 V 0.979* 22.576 174 A 0.979* 22.576 175 A 0.979* 22.576 176 Y 0.979* 22.576 177 G 0.979* 22.576 178 Q 0.979* 22.576 179 S 0.979* 22.576 180 K 0.979* 22.576 181 L 0.979* 22.576 182 A 0.979* 22.576 183 N 0.979* 22.576 184 L 0.979* 22.576 185 L 0.979* 22.576 186 F 0.979* 22.576 187 T 0.979* 22.576 188 Y 0.979* 22.576 189 E 0.979* 22.576 190 L 0.979* 22.576 191 Q 0.979* 22.576 192 R 0.979* 22.576 193 R 0.979* 22.576 194 L 0.979* 22.576 195 A 0.979* 22.576 196 T 0.979* 22.576 197 R 0.979* 22.576 198 Q 0.979* 22.576 199 T 0.979* 22.576 200 T 0.979* 22.576 201 I 0.979* 22.576 202 A 0.979* 22.576 203 V 0.979* 22.576 204 A 0.979* 22.576 205 A 0.979* 22.576 206 H 0.979* 22.576 207 P 0.979* 22.576 208 G 0.979* 22.576 209 G 0.979* 22.576 210 S 0.979* 22.576 211 R 0.979* 22.576 212 T 0.979* 22.576 213 E 0.979* 22.576 214 L 0.979* 22.576 215 T 0.979* 22.576 216 R 0.979* 22.576 217 T 0.979* 22.576 218 L 0.979* 22.576 219 P 0.979* 22.576 220 A 0.979* 22.576 221 L 0.979* 22.576 222 I 0.979* 22.576 223 A 0.979* 22.576 224 P 0.979* 22.576 225 I 0.979* 22.576 226 F 0.979* 22.576 227 S 0.979* 22.576 228 V 0.979* 22.576 229 A 0.979* 22.576 230 E 0.979* 22.576 231 L 0.979* 22.576 232 F 0.979* 22.576 233 L 0.979* 22.576 234 T 0.979* 22.576 235 Q 0.979* 22.576 236 D 0.979* 22.576 237 A 0.979* 22.576 238 A 0.979* 22.576 239 T 0.979* 22.576 240 G 0.979* 22.576 241 A 0.979* 22.576 242 L 0.979* 22.576 243 P 0.979* 22.576 244 T 0.979* 22.576 245 L 0.979* 22.576 246 R 0.979* 22.576 247 A 0.979* 22.576 248 A 0.979* 22.576 249 T 0.979* 22.576 250 D 0.979* 22.576 251 A 0.979* 22.576 252 A 0.979* 22.576 253 V 0.979* 22.576 254 L 0.979* 22.576 255 G 0.979* 22.576 256 G 0.979* 22.576 257 Q 0.979* 22.576 258 Y 0.979* 22.576 259 F 0.979* 22.576 260 G 0.979* 22.576 261 P 0.979* 22.576 262 D 0.979* 22.576 263 G 0.979* 22.576 264 F 0.979* 22.576 265 A 0.979* 22.576 266 E 0.979* 22.576 267 I 0.979* 22.576 268 R 0.979* 22.576 269 G 0.979* 22.576 270 H 0.979* 22.576 271 P 0.979* 22.576 272 K 0.979* 22.576 273 V 0.979* 22.576 274 V 0.979* 22.576 275 A 0.979* 22.576 276 S 0.979* 22.576 277 N 0.979* 22.576 278 G 0.979* 22.576 279 K 0.979* 22.576 280 S 0.979* 22.576 281 H 0.979* 22.576 282 D 0.979* 22.576 283 V 0.979* 22.576 284 D 0.979* 22.576 285 R 0.979* 22.576 286 Q 0.979* 22.576 287 L 0.979* 22.576 288 R 0.979* 22.576 289 L 0.979* 22.576 290 W 0.979* 22.576 291 A 0.979* 22.576 292 V 0.979* 22.576 293 S 0.979* 22.576 294 E 0.979* 22.576 295 E 0.979* 22.576 296 L 0.979* 22.576 297 T 0.979* 22.576 298 G 0.979* 22.576 299 V 0.979* 22.576 300 V 0.979* 22.576 301 Y 0.979* 22.576 302 P 0.979* 22.576 303 V 0.979* 22.576 304 G 0.979* 22.576 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907667_1_326_MLBR_RS01590) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:03 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1191.702393 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.871636 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907667_1_326_MLBR_RS01590: 0.000004, NC_002677_1_NP_301343_1_215_ML0315: 0.000004, NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290: 0.000004, NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935: 0.000004, NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690: 0.000004, NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.87164 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 723.2 188.8 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 723.2 188.8 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 723.2 188.8 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 723.2 188.8 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 723.2 188.8 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 723.2 188.8 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:06 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1191.702311 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.012165 0.982739 40.731937 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907667_1_326_MLBR_RS01590: 0.000004, NC_002677_1_NP_301343_1_215_ML0315: 0.000004, NZ_LVXE01000060_1_WP_010907667_1_2363_A3216_RS12290: 0.000004, NZ_LYPH01000065_1_WP_010907667_1_2285_A8144_RS10935: 0.000004, NZ_CP029543_1_WP_010907667_1_328_DIJ64_RS01690: 0.000004, NZ_AP014567_1_WP_010907667_1_342_JK2ML_RS01760: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.00001 p = 0.01216 q = 0.98274 (p1 = 0.99999) w = 40.73194 MLEs of dN/dS (w) for site classes (K=11) p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.01517 40.73194 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 723.2 188.8 40.7315 0.0000 0.0000 0.0 0.0 7..2 0.000 723.2 188.8 40.7315 0.0000 0.0000 0.0 0.0 7..3 0.000 723.2 188.8 40.7315 0.0000 0.0000 0.0 0.0 7..4 0.000 723.2 188.8 40.7315 0.0000 0.0000 0.0 0.0 7..5 0.000 723.2 188.8 40.7315 0.0000 0.0000 0.0 0.0 7..6 0.000 723.2 188.8 40.7315 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907667_1_326_MLBR_RS01590) Pr(w>1) post mean +- SE for w 1 M 1.000** 40.732 2 A 1.000** 40.732 3 K 1.000** 40.732 4 W 1.000** 40.732 5 T 1.000** 40.732 6 T 1.000** 40.732 7 A 1.000** 40.732 8 D 1.000** 40.732 9 I 1.000** 40.732 10 P 1.000** 40.732 11 D 1.000** 40.732 12 Q 1.000** 40.732 13 T 1.000** 40.732 14 G 1.000** 40.732 15 R 1.000** 40.732 16 V 1.000** 40.732 17 A 1.000** 40.732 18 V 1.000** 40.732 19 I 1.000** 40.732 20 T 1.000** 40.732 21 G 1.000** 40.732 22 A 1.000** 40.732 23 N 1.000** 40.732 24 T 1.000** 40.732 25 G 1.000** 40.732 26 L 1.000** 40.732 27 G 1.000** 40.732 28 Y 1.000** 40.732 29 Q 1.000** 40.732 30 T 1.000** 40.732 31 A 1.000** 40.732 32 L 1.000** 40.732 33 A 1.000** 40.732 34 L 1.000** 40.732 35 A 1.000** 40.732 36 E 1.000** 40.732 37 H 1.000** 40.732 38 G 1.000** 40.732 39 A 1.000** 40.732 40 H 1.000** 40.732 41 V 1.000** 40.732 42 V 1.000** 40.732 43 L 1.000** 40.732 44 A 1.000** 40.732 45 V 1.000** 40.732 46 R 1.000** 40.732 47 N 1.000** 40.732 48 L 1.000** 40.732 49 D 1.000** 40.732 50 K 1.000** 40.732 51 G 1.000** 40.732 52 K 1.000** 40.732 53 D 1.000** 40.732 54 A 1.000** 40.732 55 A 1.000** 40.732 56 A 1.000** 40.732 57 R 1.000** 40.732 58 I 1.000** 40.732 59 T 1.000** 40.732 60 A 1.000** 40.732 61 T 1.000** 40.732 62 S 1.000** 40.732 63 A 1.000** 40.732 64 Q 1.000** 40.732 65 N 1.000** 40.732 66 N 1.000** 40.732 67 V 1.000** 40.732 68 A 1.000** 40.732 69 L 1.000** 40.732 70 Q 1.000** 40.732 71 E 1.000** 40.732 72 L 1.000** 40.732 73 D 1.000** 40.732 74 L 1.000** 40.732 75 A 1.000** 40.732 76 S 1.000** 40.732 77 L 1.000** 40.732 78 E 1.000** 40.732 79 S 1.000** 40.732 80 V 1.000** 40.732 81 R 1.000** 40.732 82 A 1.000** 40.732 83 A 1.000** 40.732 84 A 1.000** 40.732 85 K 1.000** 40.732 86 Q 1.000** 40.732 87 L 1.000** 40.732 88 R 1.000** 40.732 89 S 1.000** 40.732 90 D 1.000** 40.732 91 Y 1.000** 40.732 92 D 1.000** 40.732 93 H 1.000** 40.732 94 I 1.000** 40.732 95 D 1.000** 40.732 96 L 1.000** 40.732 97 L 1.000** 40.732 98 I 1.000** 40.732 99 N 1.000** 40.732 100 N 1.000** 40.732 101 A 1.000** 40.732 102 G 1.000** 40.732 103 V 1.000** 40.732 104 M 1.000** 40.732 105 W 1.000** 40.732 106 T 1.000** 40.732 107 P 1.000** 40.732 108 K 1.000** 40.732 109 S 1.000** 40.732 110 T 1.000** 40.732 111 T 1.000** 40.732 112 K 1.000** 40.732 113 D 1.000** 40.732 114 G 1.000** 40.732 115 F 1.000** 40.732 116 E 1.000** 40.732 117 L 1.000** 40.732 118 Q 1.000** 40.732 119 F 1.000** 40.732 120 G 1.000** 40.732 121 T 1.000** 40.732 122 N 1.000** 40.732 123 H 1.000** 40.732 124 L 1.000** 40.732 125 G 1.000** 40.732 126 H 1.000** 40.732 127 F 1.000** 40.732 128 A 1.000** 40.732 129 F 1.000** 40.732 130 T 1.000** 40.732 131 G 1.000** 40.732 132 L 1.000** 40.732 133 L 1.000** 40.732 134 L 1.000** 40.732 135 D 1.000** 40.732 136 R 1.000** 40.732 137 L 1.000** 40.732 138 L 1.000** 40.732 139 P 1.000** 40.732 140 I 1.000** 40.732 141 V 1.000** 40.732 142 G 1.000** 40.732 143 S 1.000** 40.732 144 R 1.000** 40.732 145 V 1.000** 40.732 146 I 1.000** 40.732 147 T 1.000** 40.732 148 V 1.000** 40.732 149 S 1.000** 40.732 150 S 1.000** 40.732 151 L 1.000** 40.732 152 S 1.000** 40.732 153 H 1.000** 40.732 154 R 1.000** 40.732 155 L 1.000** 40.732 156 F 1.000** 40.732 157 A 1.000** 40.732 158 D 1.000** 40.732 159 I 1.000** 40.732 160 H 1.000** 40.732 161 F 1.000** 40.732 162 N 1.000** 40.732 163 D 1.000** 40.732 164 L 1.000** 40.732 165 Q 1.000** 40.732 166 W 1.000** 40.732 167 E 1.000** 40.732 168 C 1.000** 40.732 169 N 1.000** 40.732 170 Y 1.000** 40.732 171 N 1.000** 40.732 172 R 1.000** 40.732 173 V 1.000** 40.732 174 A 1.000** 40.732 175 A 1.000** 40.732 176 Y 1.000** 40.732 177 G 1.000** 40.732 178 Q 1.000** 40.732 179 S 1.000** 40.732 180 K 1.000** 40.732 181 L 1.000** 40.732 182 A 1.000** 40.732 183 N 1.000** 40.732 184 L 1.000** 40.732 185 L 1.000** 40.732 186 F 1.000** 40.732 187 T 1.000** 40.732 188 Y 1.000** 40.732 189 E 1.000** 40.732 190 L 1.000** 40.732 191 Q 1.000** 40.732 192 R 1.000** 40.732 193 R 1.000** 40.732 194 L 1.000** 40.732 195 A 1.000** 40.732 196 T 1.000** 40.732 197 R 1.000** 40.732 198 Q 1.000** 40.732 199 T 1.000** 40.732 200 T 1.000** 40.732 201 I 1.000** 40.732 202 A 1.000** 40.732 203 V 1.000** 40.732 204 A 1.000** 40.732 205 A 1.000** 40.732 206 H 1.000** 40.732 207 P 1.000** 40.732 208 G 1.000** 40.732 209 G 1.000** 40.732 210 S 1.000** 40.732 211 R 1.000** 40.732 212 T 1.000** 40.732 213 E 1.000** 40.732 214 L 1.000** 40.732 215 T 1.000** 40.732 216 R 1.000** 40.732 217 T 1.000** 40.732 218 L 1.000** 40.732 219 P 1.000** 40.732 220 A 1.000** 40.732 221 L 1.000** 40.732 222 I 1.000** 40.732 223 A 1.000** 40.732 224 P 1.000** 40.732 225 I 1.000** 40.732 226 F 1.000** 40.732 227 S 1.000** 40.732 228 V 1.000** 40.732 229 A 1.000** 40.732 230 E 1.000** 40.732 231 L 1.000** 40.732 232 F 1.000** 40.732 233 L 1.000** 40.732 234 T 1.000** 40.732 235 Q 1.000** 40.732 236 D 1.000** 40.732 237 A 1.000** 40.732 238 A 1.000** 40.732 239 T 1.000** 40.732 240 G 1.000** 40.732 241 A 1.000** 40.732 242 L 1.000** 40.732 243 P 1.000** 40.732 244 T 1.000** 40.732 245 L 1.000** 40.732 246 R 1.000** 40.732 247 A 1.000** 40.732 248 A 1.000** 40.732 249 T 1.000** 40.732 250 D 1.000** 40.732 251 A 1.000** 40.732 252 A 1.000** 40.732 253 V 1.000** 40.732 254 L 1.000** 40.732 255 G 1.000** 40.732 256 G 1.000** 40.732 257 Q 1.000** 40.732 258 Y 1.000** 40.732 259 F 1.000** 40.732 260 G 1.000** 40.732 261 P 1.000** 40.732 262 D 1.000** 40.732 263 G 1.000** 40.732 264 F 1.000** 40.732 265 A 1.000** 40.732 266 E 1.000** 40.732 267 I 1.000** 40.732 268 R 1.000** 40.732 269 G 1.000** 40.732 270 H 1.000** 40.732 271 P 1.000** 40.732 272 K 1.000** 40.732 273 V 1.000** 40.732 274 V 1.000** 40.732 275 A 1.000** 40.732 276 S 1.000** 40.732 277 N 1.000** 40.732 278 G 1.000** 40.732 279 K 1.000** 40.732 280 S 1.000** 40.732 281 H 1.000** 40.732 282 D 1.000** 40.732 283 V 1.000** 40.732 284 D 1.000** 40.732 285 R 1.000** 40.732 286 Q 1.000** 40.732 287 L 1.000** 40.732 288 R 1.000** 40.732 289 L 1.000** 40.732 290 W 1.000** 40.732 291 A 1.000** 40.732 292 V 1.000** 40.732 293 S 1.000** 40.732 294 E 1.000** 40.732 295 E 1.000** 40.732 296 L 1.000** 40.732 297 T 1.000** 40.732 298 G 1.000** 40.732 299 V 1.000** 40.732 300 V 1.000** 40.732 301 Y 1.000** 40.732 302 P 1.000** 40.732 303 V 1.000** 40.732 304 G 1.000** 40.732 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907667_1_326_MLBR_RS01590) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Time used: 0:12
Model 1: NearlyNeutral -1191.702327 Model 2: PositiveSelection -1191.702311 Model 0: one-ratio -1191.702325 Model 7: beta -1191.702393 Model 8: beta&w>1 -1191.702311 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 3.199999991920777E-5 Model 8 vs 7 1.6400000004068715E-4