--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 17:13:54 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0325/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -357.66 -361.38 2 -357.54 -360.81 -------------------------------------- TOTAL -357.60 -361.13 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896243 0.090088 0.362521 1.486402 0.859692 1304.86 1340.46 1.000 r(A<->C){all} 0.175273 0.020877 0.000072 0.457714 0.138481 99.13 140.99 1.018 r(A<->G){all} 0.181522 0.023705 0.000069 0.499833 0.140704 116.62 170.95 1.000 r(A<->T){all} 0.159703 0.019039 0.000001 0.436356 0.121572 56.92 135.00 1.001 r(C<->G){all} 0.157666 0.017880 0.000022 0.414003 0.121123 239.69 241.98 1.003 r(C<->T){all} 0.165805 0.018743 0.000077 0.431658 0.132110 192.24 219.46 1.001 r(G<->T){all} 0.160031 0.018163 0.000006 0.433201 0.124703 217.10 237.86 1.005 pi(A){all} 0.169932 0.000539 0.127435 0.216924 0.169193 1416.22 1427.68 1.000 pi(C){all} 0.260254 0.000714 0.207450 0.311879 0.259647 1032.67 1241.17 1.000 pi(G){all} 0.313465 0.000816 0.256586 0.366743 0.313187 1301.24 1315.33 1.000 pi(T){all} 0.256349 0.000711 0.207947 0.311414 0.255557 1213.15 1357.07 1.000 alpha{1,2} 0.411468 0.225909 0.000177 1.382476 0.238897 1202.76 1351.88 1.000 alpha{3} 0.435563 0.223610 0.000318 1.381044 0.276053 1333.63 1342.50 1.000 pinvar{all} 0.993478 0.000063 0.977174 0.999998 0.996087 1171.04 1304.09 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -336.442078 Model 2: PositiveSelection -336.442078 Model 0: one-ratio -336.442081 Model 7: beta -336.442084 Model 8: beta&w>1 -336.442072 Model 0 vs 1 5.999999984851456E-6 Model 2 vs 1 0.0 Model 8 vs 7 2.4000000053092663E-5
>C1 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C2 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C3 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C4 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C5 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C6 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=87 C1 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C2 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C3 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C4 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C5 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C6 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV ************************************************** C1 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C2 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C3 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C4 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C5 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C6 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG ************************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2610] Library Relaxation: Multi_proc [96] Relaxation Summary: [2610]--->[2610] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.609 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C2 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C3 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C4 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C5 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV C6 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV ************************************************** C1 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C2 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C3 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C4 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C5 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG C6 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG ************************************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC C2 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC C3 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC C4 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC C5 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC C6 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC ************************************************** C1 CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG C2 CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG C3 CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG C4 CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG C5 CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG C6 CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG ************************************************** C1 CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG C2 CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG C3 CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG C4 CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG C5 CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG C6 CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG ************************************************** C1 CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG C2 CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG C3 CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG C4 CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG C5 CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG C6 CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG ************************************************** C1 CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG C2 CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG C3 CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG C4 CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG C5 CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG C6 CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG ************************************************** C1 GCCTTATGGGA C2 GCCTTATGGGA C3 GCCTTATGGGA C4 GCCTTATGGGA C5 GCCTTATGGGA C6 GCCTTATGGGA *********** >C1 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >C2 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >C3 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >C4 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >C5 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >C6 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >C1 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C2 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C3 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C4 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C5 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >C6 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 261 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579799559 Setting output file names to "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 104194655 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0771709338 Seed = 1254296529 Swapseed = 1579799559 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -584.130510 -- -24.965149 Chain 2 -- -584.130476 -- -24.965149 Chain 3 -- -584.130510 -- -24.965149 Chain 4 -- -584.130476 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -584.130510 -- -24.965149 Chain 2 -- -584.130476 -- -24.965149 Chain 3 -- -584.130510 -- -24.965149 Chain 4 -- -584.130510 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-584.131] (-584.130) (-584.131) (-584.130) * [-584.131] (-584.130) (-584.131) (-584.131) 500 -- (-365.403) [-360.080] (-371.189) (-371.757) * (-367.959) [-370.722] (-366.825) (-365.231) -- 0:00:00 1000 -- (-369.927) (-365.098) (-368.252) [-367.934] * (-369.430) [-372.170] (-368.422) (-366.403) -- 0:00:00 1500 -- (-370.864) (-363.069) (-362.399) [-363.424] * (-363.394) (-365.441) [-364.661] (-374.636) -- 0:00:00 2000 -- (-366.697) (-369.399) [-370.607] (-367.339) * [-362.738] (-365.097) (-372.296) (-367.868) -- 0:00:00 2500 -- (-367.593) (-368.418) (-373.026) [-367.054] * (-366.072) [-369.479] (-373.170) (-363.934) -- 0:00:00 3000 -- (-361.287) (-368.867) [-362.377] (-365.107) * (-366.064) [-367.353] (-366.722) (-367.455) -- 0:00:00 3500 -- (-372.210) (-365.096) [-368.032] (-365.335) * (-371.646) (-365.592) [-365.786] (-365.293) -- 0:04:44 4000 -- (-368.616) [-366.408] (-368.030) (-392.669) * (-368.446) [-365.480] (-368.987) (-366.373) -- 0:04:09 4500 -- [-364.503] (-366.928) (-369.553) (-378.756) * (-374.302) (-364.941) (-368.395) [-367.870] -- 0:03:41 5000 -- (-364.511) (-364.338) (-364.862) [-359.292] * (-368.969) [-364.018] (-367.668) (-365.468) -- 0:03:19 Average standard deviation of split frequencies: 0.088815 5500 -- (-370.624) (-368.540) (-366.253) [-358.225] * (-369.861) (-374.138) (-364.854) [-367.404] -- 0:03:00 6000 -- [-364.676] (-369.568) (-371.482) (-360.818) * [-370.878] (-377.804) (-363.717) (-368.373) -- 0:02:45 6500 -- (-370.276) [-368.442] (-369.492) (-357.974) * (-372.705) (-375.993) (-367.570) [-369.594] -- 0:02:32 7000 -- (-366.596) (-371.683) (-360.512) [-356.432] * [-363.385] (-373.388) (-375.549) (-367.196) -- 0:02:21 7500 -- [-367.628] (-367.800) (-366.405) (-356.465) * (-362.797) (-366.337) (-367.643) [-365.255] -- 0:02:12 8000 -- (-365.897) (-368.206) (-368.262) [-357.915] * [-368.360] (-362.442) (-371.401) (-367.600) -- 0:02:04 8500 -- (-364.592) (-372.994) (-374.255) [-358.869] * [-370.512] (-361.161) (-373.979) (-368.966) -- 0:01:56 9000 -- [-368.639] (-376.698) (-374.572) (-357.801) * (-376.729) (-357.530) [-369.779] (-368.961) -- 0:01:50 9500 -- (-377.373) (-360.554) [-365.006] (-362.354) * (-367.860) (-359.651) [-365.522] (-367.490) -- 0:01:44 10000 -- (-372.938) (-364.882) (-366.655) [-356.487] * (-373.997) (-358.470) [-358.549] (-371.135) -- 0:01:39 Average standard deviation of split frequencies: 0.078344 10500 -- (-369.420) [-364.145] (-379.084) (-356.646) * (-372.603) (-362.023) (-360.579) [-362.828] -- 0:01:34 11000 -- (-363.665) [-366.971] (-369.525) (-363.243) * (-374.778) (-358.470) [-356.869] (-370.737) -- 0:01:29 11500 -- (-367.168) [-367.879] (-370.477) (-358.628) * (-374.030) (-356.326) [-357.069] (-377.707) -- 0:01:25 12000 -- (-370.414) (-371.235) (-373.964) [-358.545] * (-363.415) (-360.984) [-357.154] (-372.893) -- 0:01:22 12500 -- (-375.739) (-365.651) (-376.454) [-357.914] * (-369.924) (-358.569) [-357.539] (-371.594) -- 0:01:19 13000 -- (-367.070) [-362.351] (-364.178) (-357.938) * (-369.209) (-361.299) (-358.694) [-367.533] -- 0:01:15 13500 -- (-370.290) (-367.755) [-367.609] (-356.948) * (-373.251) (-357.283) [-360.991] (-370.964) -- 0:01:13 14000 -- (-365.583) (-367.693) (-365.096) [-358.567] * (-363.848) (-357.663) [-360.472] (-367.615) -- 0:01:10 14500 -- [-360.174] (-363.897) (-367.095) (-357.902) * (-368.372) (-357.997) [-356.725] (-370.868) -- 0:01:07 15000 -- (-369.373) (-373.427) (-375.917) [-360.328] * (-364.655) (-358.169) [-356.606] (-365.587) -- 0:01:05 Average standard deviation of split frequencies: 0.060329 15500 -- (-379.498) (-372.362) (-378.482) [-356.627] * (-365.288) (-358.347) (-357.202) [-366.987] -- 0:01:03 16000 -- [-364.963] (-374.494) (-359.926) (-356.494) * (-376.024) (-361.194) [-359.260] (-374.688) -- 0:01:01 16500 -- (-364.704) (-379.471) [-357.913] (-358.496) * (-368.917) (-357.229) (-357.911) [-363.452] -- 0:00:59 17000 -- (-358.549) (-364.115) [-357.247] (-357.021) * (-370.611) (-361.050) (-357.519) [-370.086] -- 0:00:57 17500 -- (-357.662) [-356.815] (-356.882) (-357.649) * (-366.106) (-357.052) (-357.362) [-366.147] -- 0:00:56 18000 -- (-357.216) (-356.991) (-358.173) [-357.213] * (-372.376) [-356.830] (-358.268) (-366.906) -- 0:00:54 18500 -- (-364.852) (-360.620) (-357.466) [-356.796] * [-366.507] (-356.966) (-359.223) (-366.672) -- 0:00:53 19000 -- (-364.223) (-356.627) [-359.432] (-356.840) * (-376.895) (-360.771) [-361.224] (-371.021) -- 0:00:51 19500 -- [-357.624] (-358.197) (-364.055) (-362.201) * (-358.082) (-361.819) [-359.370] (-375.833) -- 0:00:50 20000 -- (-358.922) (-360.024) [-358.866] (-360.885) * (-357.969) [-360.675] (-357.757) (-365.126) -- 0:00:49 Average standard deviation of split frequencies: 0.051622 20500 -- (-357.503) [-357.642] (-357.449) (-357.590) * [-358.141] (-356.859) (-357.826) (-377.079) -- 0:01:35 21000 -- (-359.358) (-357.204) [-359.279] (-360.149) * (-362.196) (-356.523) (-358.012) [-358.440] -- 0:01:33 21500 -- [-359.840] (-359.614) (-358.011) (-357.421) * (-356.622) [-360.113] (-361.194) (-359.234) -- 0:01:31 22000 -- (-357.178) (-360.273) [-357.277] (-359.999) * (-357.262) [-357.903] (-364.513) (-358.641) -- 0:01:28 22500 -- (-361.835) [-359.037] (-357.996) (-357.414) * (-364.309) [-357.730] (-356.320) (-365.686) -- 0:01:26 23000 -- [-357.820] (-358.484) (-358.095) (-359.141) * (-357.355) [-363.378] (-356.763) (-362.048) -- 0:01:24 23500 -- [-360.300] (-359.926) (-360.708) (-361.586) * (-358.075) (-358.739) [-358.131] (-359.398) -- 0:01:23 24000 -- (-361.283) (-357.193) (-357.457) [-358.336] * (-357.617) (-364.967) [-359.131] (-358.781) -- 0:01:21 24500 -- (-360.155) [-357.916] (-359.481) (-360.612) * (-359.303) (-359.217) [-361.936] (-360.211) -- 0:01:19 25000 -- (-358.922) [-357.095] (-358.047) (-357.375) * [-358.282] (-357.013) (-362.256) (-358.038) -- 0:01:18 Average standard deviation of split frequencies: 0.045759 25500 -- (-361.096) (-358.991) (-359.755) [-358.429] * (-357.039) (-357.917) [-362.128] (-360.945) -- 0:01:16 26000 -- (-361.579) (-360.109) [-356.912] (-361.431) * (-357.750) [-357.206] (-359.186) (-364.039) -- 0:01:14 26500 -- (-364.031) (-357.589) (-357.470) [-359.090] * (-356.499) (-359.580) [-357.621] (-356.852) -- 0:01:13 27000 -- [-359.352] (-356.924) (-356.484) (-363.104) * (-359.442) (-359.358) (-357.450) [-359.072] -- 0:01:12 27500 -- (-356.935) [-357.232] (-357.165) (-358.708) * [-357.926] (-358.867) (-357.418) (-357.571) -- 0:01:10 28000 -- (-357.058) [-356.805] (-357.967) (-358.351) * (-356.463) (-361.196) (-355.953) [-358.550] -- 0:01:09 28500 -- (-358.585) (-357.194) (-360.407) [-358.287] * (-358.918) (-357.865) (-357.297) [-358.986] -- 0:01:08 29000 -- (-359.066) [-359.285] (-357.990) (-356.753) * (-358.543) (-358.187) [-358.385] (-358.165) -- 0:01:06 29500 -- (-358.527) [-357.917] (-357.241) (-357.048) * [-359.151] (-363.835) (-358.819) (-359.517) -- 0:01:05 30000 -- (-361.392) [-356.092] (-359.126) (-359.171) * [-356.995] (-358.332) (-361.192) (-359.627) -- 0:01:04 Average standard deviation of split frequencies: 0.043689 30500 -- (-357.711) (-357.299) [-356.678] (-361.088) * (-356.480) (-358.675) [-358.570] (-360.099) -- 0:01:03 31000 -- (-356.235) (-356.553) (-358.691) [-356.414] * [-357.579] (-358.571) (-360.051) (-356.748) -- 0:01:02 31500 -- (-357.730) [-357.412] (-357.419) (-356.580) * (-357.893) [-361.797] (-359.563) (-356.883) -- 0:01:01 32000 -- (-361.147) (-357.575) (-358.566) [-357.878] * (-357.334) (-358.039) (-363.345) [-357.821] -- 0:01:00 32500 -- (-360.971) (-360.254) (-359.029) [-358.472] * (-358.695) [-358.812] (-357.801) (-358.596) -- 0:00:59 33000 -- (-359.152) [-356.769] (-361.192) (-359.463) * [-357.468] (-360.498) (-357.804) (-358.679) -- 0:00:58 33500 -- [-357.742] (-359.466) (-361.575) (-359.912) * (-361.249) (-357.431) (-356.101) [-360.330] -- 0:00:57 34000 -- (-359.158) (-360.769) [-358.190] (-356.849) * (-358.456) (-358.395) (-357.669) [-358.671] -- 0:00:56 34500 -- [-360.600] (-358.522) (-358.482) (-358.963) * (-356.986) (-356.852) (-358.169) [-358.620] -- 0:00:55 35000 -- (-360.441) (-358.811) (-359.477) [-358.326] * (-358.936) (-361.159) [-359.378] (-356.943) -- 0:00:55 Average standard deviation of split frequencies: 0.039284 35500 -- [-359.053] (-357.932) (-356.931) (-362.233) * (-361.783) (-360.766) [-360.839] (-357.893) -- 0:00:54 36000 -- (-362.956) [-356.925] (-357.405) (-358.960) * (-356.171) [-358.548] (-359.645) (-357.952) -- 0:00:53 36500 -- (-356.692) (-359.506) (-357.430) [-358.548] * (-357.602) (-360.244) [-357.796] (-361.246) -- 0:00:52 37000 -- (-358.390) (-357.473) (-358.363) [-356.885] * (-357.497) (-359.660) (-359.339) [-359.359] -- 0:00:52 37500 -- (-357.830) (-359.466) (-358.693) [-357.891] * [-358.385] (-361.669) (-358.822) (-358.834) -- 0:01:17 38000 -- (-357.771) (-361.339) [-357.094] (-356.708) * (-360.363) (-360.475) [-358.834] (-357.012) -- 0:01:15 38500 -- (-359.770) (-360.045) [-357.270] (-358.319) * (-359.597) (-360.453) (-358.215) [-356.728] -- 0:01:14 39000 -- [-357.016] (-359.173) (-357.557) (-357.323) * (-358.157) (-357.518) [-356.809] (-356.982) -- 0:01:13 39500 -- (-360.246) (-362.569) [-357.684] (-356.926) * (-359.205) (-365.515) (-356.049) [-356.372] -- 0:01:12 40000 -- (-359.989) (-364.312) [-360.528] (-357.880) * [-359.697] (-359.734) (-360.120) (-357.575) -- 0:01:12 Average standard deviation of split frequencies: 0.034776 40500 -- (-356.578) (-359.036) [-359.167] (-356.343) * (-357.644) (-359.783) (-357.961) [-356.606] -- 0:01:11 41000 -- (-358.032) [-358.271] (-358.337) (-356.949) * (-360.723) (-356.873) [-359.277] (-359.240) -- 0:01:10 41500 -- (-357.052) (-357.497) [-358.652] (-358.031) * (-358.530) [-360.083] (-363.083) (-356.927) -- 0:01:09 42000 -- (-358.399) [-358.055] (-359.416) (-358.064) * (-358.003) (-360.328) [-358.069] (-358.362) -- 0:01:08 42500 -- (-358.586) (-357.450) [-357.912] (-359.413) * (-358.458) (-358.947) (-356.491) [-356.614] -- 0:01:07 43000 -- (-359.497) [-357.789] (-356.944) (-358.176) * [-359.473] (-356.471) (-358.210) (-358.811) -- 0:01:06 43500 -- (-359.276) [-359.499] (-358.521) (-358.811) * (-357.177) [-356.572] (-356.224) (-361.775) -- 0:01:05 44000 -- (-359.180) [-357.742] (-359.954) (-359.768) * [-357.787] (-358.889) (-360.308) (-358.471) -- 0:01:05 44500 -- (-358.158) (-357.684) [-358.022] (-357.591) * (-356.695) (-357.223) (-362.803) [-357.043] -- 0:01:04 45000 -- (-361.644) [-358.299] (-357.550) (-359.637) * [-357.430] (-358.780) (-360.317) (-361.538) -- 0:01:03 Average standard deviation of split frequencies: 0.025620 45500 -- [-359.593] (-357.277) (-356.937) (-358.077) * [-358.231] (-360.409) (-356.281) (-359.157) -- 0:01:02 46000 -- [-362.115] (-358.561) (-357.852) (-357.483) * (-359.465) (-359.746) [-356.607] (-357.605) -- 0:01:02 46500 -- (-356.738) (-357.346) (-361.855) [-356.867] * (-357.824) [-357.289] (-358.746) (-360.459) -- 0:01:01 47000 -- (-358.360) (-360.251) (-356.552) [-356.533] * [-359.561] (-357.415) (-360.012) (-356.920) -- 0:01:00 47500 -- [-357.033] (-361.352) (-360.120) (-356.484) * (-359.027) (-357.724) (-356.802) [-357.236] -- 0:01:00 48000 -- [-358.987] (-358.882) (-359.339) (-357.008) * (-358.181) (-357.306) [-358.284] (-358.310) -- 0:00:59 48500 -- [-359.779] (-358.133) (-359.799) (-357.799) * (-358.209) (-358.150) [-358.597] (-358.421) -- 0:00:58 49000 -- (-358.990) (-359.688) (-362.087) [-358.067] * (-359.408) [-360.710] (-357.956) (-360.799) -- 0:00:58 49500 -- [-357.976] (-357.016) (-359.805) (-358.991) * (-358.420) [-360.439] (-360.682) (-361.553) -- 0:00:57 50000 -- (-360.492) (-359.528) [-356.506] (-357.957) * (-357.351) (-361.462) (-362.731) [-357.579] -- 0:00:57 Average standard deviation of split frequencies: 0.029684 50500 -- [-361.813] (-358.587) (-356.870) (-362.426) * [-360.396] (-362.143) (-360.727) (-358.131) -- 0:00:56 51000 -- (-358.426) [-359.666] (-357.617) (-357.548) * (-357.458) [-360.883] (-358.540) (-358.998) -- 0:00:55 51500 -- [-358.113] (-357.433) (-356.720) (-357.485) * (-359.488) (-359.449) [-357.208] (-357.764) -- 0:00:55 52000 -- [-358.174] (-356.853) (-359.245) (-363.153) * (-362.479) (-359.392) (-357.231) [-360.058] -- 0:00:54 52500 -- (-360.663) [-357.719] (-357.896) (-359.561) * [-357.602] (-361.944) (-358.807) (-358.093) -- 0:00:54 53000 -- (-356.614) (-360.453) (-356.580) [-358.307] * (-358.730) (-356.390) (-359.417) [-359.500] -- 0:00:53 53500 -- (-359.029) (-361.406) (-361.638) [-357.504] * (-357.124) (-357.527) (-358.811) [-357.378] -- 0:00:53 54000 -- (-361.326) [-357.739] (-356.430) (-358.406) * [-356.473] (-356.605) (-359.161) (-359.669) -- 0:00:52 54500 -- (-357.435) [-359.697] (-357.533) (-357.926) * (-364.223) [-357.854] (-361.776) (-357.133) -- 0:00:52 55000 -- (-359.091) (-357.385) (-357.191) [-358.613] * [-356.414] (-356.565) (-363.034) (-356.432) -- 0:01:08 Average standard deviation of split frequencies: 0.030064 55500 -- (-357.552) [-358.627] (-358.123) (-360.271) * (-362.030) [-356.358] (-363.110) (-356.577) -- 0:01:08 56000 -- [-356.439] (-357.669) (-361.319) (-359.383) * (-359.294) [-357.140] (-362.640) (-356.939) -- 0:01:07 56500 -- (-358.481) [-357.780] (-357.973) (-359.691) * (-359.711) [-357.608] (-362.436) (-358.038) -- 0:01:06 57000 -- (-360.754) (-358.376) (-357.863) [-359.687] * (-359.292) (-358.007) (-356.467) [-359.465] -- 0:01:06 57500 -- (-359.389) (-357.136) [-359.008] (-365.063) * [-357.331] (-358.903) (-357.429) (-358.487) -- 0:01:05 58000 -- (-359.337) (-357.915) [-357.001] (-362.953) * (-357.695) (-357.654) [-357.579] (-357.033) -- 0:01:04 58500 -- (-359.799) (-360.683) [-358.110] (-358.633) * (-358.221) (-358.233) [-357.686] (-358.945) -- 0:01:04 59000 -- [-360.526] (-359.780) (-364.384) (-359.017) * (-356.555) (-357.217) [-358.048] (-358.386) -- 0:01:03 59500 -- (-359.493) (-358.344) (-360.620) [-357.000] * (-357.866) [-359.513] (-357.635) (-358.240) -- 0:01:03 60000 -- (-358.231) (-357.975) [-360.273] (-359.531) * [-359.091] (-357.540) (-357.335) (-362.476) -- 0:01:02 Average standard deviation of split frequencies: 0.024088 60500 -- (-357.460) [-357.308] (-359.939) (-357.680) * (-357.966) (-357.485) [-356.827] (-358.026) -- 0:01:02 61000 -- (-359.349) [-357.118] (-358.731) (-359.452) * (-361.351) (-357.619) (-360.275) [-363.501] -- 0:01:01 61500 -- (-357.970) (-358.908) (-357.893) [-357.616] * (-358.877) (-359.457) [-359.864] (-358.604) -- 0:01:01 62000 -- (-357.677) (-357.890) (-361.691) [-358.051] * (-360.809) (-359.796) [-357.322] (-359.276) -- 0:01:00 62500 -- (-358.641) [-356.779] (-357.152) (-357.595) * (-357.956) (-357.824) [-356.441] (-358.599) -- 0:01:00 63000 -- [-357.084] (-356.739) (-365.198) (-360.320) * [-357.326] (-358.106) (-359.797) (-360.385) -- 0:00:59 63500 -- (-357.773) [-356.672] (-360.314) (-360.386) * (-359.783) (-356.231) [-360.470] (-359.315) -- 0:00:58 64000 -- (-358.041) [-358.992] (-359.282) (-356.736) * (-357.296) [-356.575] (-361.996) (-357.272) -- 0:00:58 64500 -- (-358.241) (-356.843) [-357.553] (-356.521) * [-358.210] (-358.536) (-361.476) (-358.007) -- 0:00:58 65000 -- (-357.897) [-359.140] (-357.802) (-358.328) * (-360.320) (-357.915) [-357.194] (-361.801) -- 0:00:57 Average standard deviation of split frequencies: 0.028245 65500 -- (-359.723) (-358.047) [-361.212] (-359.672) * (-357.059) (-357.476) [-356.359] (-356.966) -- 0:00:57 66000 -- (-360.588) (-358.140) (-358.537) [-358.298] * (-360.947) (-357.436) (-359.068) [-359.598] -- 0:00:56 66500 -- (-359.398) [-358.031] (-358.397) (-360.526) * (-359.061) [-356.321] (-359.867) (-358.863) -- 0:00:56 67000 -- (-356.560) (-358.506) [-360.812] (-359.155) * (-358.215) [-356.413] (-358.541) (-363.415) -- 0:00:55 67500 -- (-357.605) (-361.179) [-360.692] (-357.363) * (-358.386) (-356.421) [-361.082] (-357.223) -- 0:00:55 68000 -- (-357.723) (-356.566) [-363.057] (-362.851) * (-359.281) (-357.834) [-356.427] (-360.210) -- 0:00:54 68500 -- (-360.282) [-356.737] (-357.880) (-360.526) * [-358.249] (-357.066) (-358.864) (-356.686) -- 0:00:54 69000 -- (-359.311) [-357.351] (-363.161) (-360.067) * (-358.173) [-358.487] (-366.543) (-358.380) -- 0:00:53 69500 -- (-363.144) [-358.036] (-357.652) (-365.728) * (-358.214) (-358.599) (-358.557) [-356.371] -- 0:00:53 70000 -- (-362.857) [-357.371] (-357.982) (-362.840) * [-356.789] (-360.218) (-356.936) (-356.813) -- 0:00:53 Average standard deviation of split frequencies: 0.030019 70500 -- (-357.409) (-356.424) (-357.891) [-358.664] * [-356.293] (-360.136) (-357.944) (-360.592) -- 0:00:52 71000 -- (-357.360) [-359.240] (-360.244) (-357.577) * (-356.703) (-358.856) [-358.823] (-359.469) -- 0:00:52 71500 -- (-363.133) (-359.628) (-359.514) [-358.739] * (-358.997) (-356.701) (-358.494) [-359.176] -- 0:01:04 72000 -- (-357.357) (-359.329) [-358.167] (-360.988) * (-359.741) (-359.633) (-358.987) [-361.019] -- 0:01:04 72500 -- [-358.421] (-359.082) (-358.420) (-360.974) * (-360.253) (-361.655) (-358.401) [-362.841] -- 0:01:03 73000 -- (-359.119) (-358.257) (-364.088) [-356.684] * (-357.833) (-361.405) [-356.474] (-359.912) -- 0:01:03 73500 -- (-359.112) (-363.696) (-360.737) [-359.952] * (-356.866) (-356.918) (-357.729) [-361.911] -- 0:01:03 74000 -- (-357.969) (-359.991) [-359.471] (-358.107) * (-356.401) (-358.234) [-356.706] (-357.423) -- 0:01:02 74500 -- (-357.678) (-359.090) (-357.860) [-357.397] * (-356.832) [-362.014] (-357.331) (-361.270) -- 0:01:02 75000 -- (-361.465) [-358.922] (-359.149) (-357.295) * (-361.783) (-360.034) (-360.528) [-356.942] -- 0:01:01 Average standard deviation of split frequencies: 0.034604 75500 -- [-357.537] (-356.466) (-357.870) (-358.728) * (-358.615) (-359.337) (-359.391) [-356.827] -- 0:01:01 76000 -- [-356.872] (-360.564) (-356.273) (-359.411) * (-359.328) (-357.801) (-358.223) [-358.738] -- 0:01:00 76500 -- (-356.521) [-357.294] (-357.939) (-359.904) * (-359.422) [-357.307] (-357.903) (-356.914) -- 0:01:00 77000 -- [-357.886] (-362.149) (-357.034) (-362.895) * (-360.792) (-359.339) (-361.387) [-360.852] -- 0:00:59 77500 -- (-358.049) (-360.366) (-357.679) [-360.556] * (-360.994) (-356.812) (-356.635) [-358.819] -- 0:00:59 78000 -- (-360.641) [-357.032] (-356.857) (-361.917) * (-358.796) [-358.332] (-360.043) (-359.690) -- 0:00:59 78500 -- (-360.163) (-358.487) (-356.166) [-359.580] * (-358.128) [-356.839] (-358.064) (-358.221) -- 0:00:58 79000 -- [-358.012] (-356.475) (-357.185) (-357.576) * (-358.838) (-357.009) [-357.781] (-360.721) -- 0:00:58 79500 -- [-362.251] (-358.984) (-358.799) (-356.894) * (-361.838) (-357.203) (-357.164) [-360.240] -- 0:00:57 80000 -- (-359.001) (-359.318) (-359.541) [-357.911] * (-362.019) (-356.577) [-358.354] (-357.800) -- 0:00:57 Average standard deviation of split frequencies: 0.033018 80500 -- (-356.332) [-357.579] (-357.480) (-358.247) * (-358.523) [-356.366] (-359.746) (-360.526) -- 0:00:57 81000 -- (-357.206) (-357.225) [-357.236] (-356.256) * (-361.350) [-356.906] (-356.021) (-357.680) -- 0:00:56 81500 -- [-357.924] (-359.729) (-357.826) (-357.381) * (-359.123) [-357.156] (-363.524) (-360.542) -- 0:00:56 82000 -- (-356.832) (-356.933) (-361.958) [-357.166] * [-358.339] (-356.213) (-365.118) (-357.431) -- 0:00:55 82500 -- (-357.727) (-356.766) (-358.338) [-360.778] * (-357.873) [-358.304] (-358.196) (-360.971) -- 0:00:55 83000 -- [-358.580] (-358.477) (-357.815) (-357.890) * (-360.997) (-358.455) (-356.537) [-356.736] -- 0:00:55 83500 -- (-356.999) (-359.445) (-361.871) [-357.154] * (-356.611) [-357.481] (-358.449) (-356.888) -- 0:00:54 84000 -- (-356.775) (-360.333) (-357.358) [-358.869] * [-357.001] (-358.158) (-363.021) (-356.604) -- 0:00:54 84500 -- (-358.950) (-359.952) [-358.483] (-358.685) * [-357.807] (-356.339) (-362.277) (-357.667) -- 0:00:54 85000 -- (-357.374) [-357.894] (-362.262) (-357.784) * [-357.321] (-356.884) (-361.436) (-357.722) -- 0:00:53 Average standard deviation of split frequencies: 0.029756 85500 -- [-362.592] (-358.961) (-357.012) (-360.605) * (-362.981) (-361.498) [-360.001] (-358.435) -- 0:00:53 86000 -- (-362.286) (-361.054) (-358.894) [-356.512] * (-360.331) (-361.275) [-360.420] (-362.790) -- 0:00:53 86500 -- (-360.852) (-359.886) (-359.662) [-357.783] * [-357.378] (-361.613) (-359.504) (-362.823) -- 0:00:52 87000 -- (-363.836) (-360.970) (-357.557) [-357.187] * (-357.350) (-359.477) [-357.041] (-358.526) -- 0:00:52 87500 -- (-357.520) (-358.976) [-357.450] (-358.012) * [-358.418] (-356.857) (-356.626) (-359.746) -- 0:00:52 88000 -- (-357.730) [-358.386] (-356.818) (-357.994) * (-358.281) [-361.212] (-362.577) (-359.724) -- 0:00:51 88500 -- (-359.050) (-358.579) [-358.974] (-359.407) * [-357.156] (-358.986) (-358.758) (-357.405) -- 0:01:01 89000 -- (-360.408) (-358.851) [-361.287] (-361.022) * [-358.613] (-362.703) (-357.455) (-357.452) -- 0:01:01 89500 -- (-361.752) (-362.637) (-360.078) [-357.627] * [-358.959] (-360.900) (-359.145) (-357.436) -- 0:01:01 90000 -- (-363.581) [-361.042] (-359.271) (-358.817) * [-356.699] (-362.480) (-360.431) (-356.991) -- 0:01:00 Average standard deviation of split frequencies: 0.030156 90500 -- (-360.124) [-358.112] (-358.439) (-357.237) * (-355.919) (-358.770) [-357.272] (-356.963) -- 0:01:00 91000 -- (-360.823) (-356.336) [-357.097] (-356.666) * (-357.482) (-358.328) [-357.995] (-359.240) -- 0:00:59 91500 -- (-358.712) [-359.296] (-356.958) (-358.802) * [-358.157] (-359.603) (-359.770) (-357.711) -- 0:00:59 92000 -- (-357.310) (-357.423) (-358.794) [-357.428] * (-360.938) (-361.130) (-358.659) [-359.228] -- 0:00:59 92500 -- (-358.574) (-357.918) [-358.018] (-358.541) * (-359.192) [-357.314] (-356.919) (-358.339) -- 0:00:58 93000 -- (-358.187) (-356.641) (-357.199) [-357.144] * (-358.167) [-357.607] (-356.481) (-357.150) -- 0:00:58 93500 -- (-359.242) (-356.879) (-360.292) [-357.127] * [-359.176] (-357.713) (-356.690) (-357.168) -- 0:00:58 94000 -- (-357.505) [-358.676] (-356.517) (-358.328) * (-357.277) [-358.179] (-357.465) (-358.873) -- 0:00:57 94500 -- [-359.877] (-360.429) (-358.264) (-357.470) * [-360.858] (-358.442) (-357.543) (-359.963) -- 0:00:57 95000 -- (-359.814) [-359.715] (-361.486) (-357.180) * [-357.321] (-357.491) (-356.646) (-358.551) -- 0:00:57 Average standard deviation of split frequencies: 0.036092 95500 -- (-357.189) [-360.030] (-360.782) (-357.004) * [-358.184] (-359.383) (-356.695) (-358.485) -- 0:00:56 96000 -- (-358.262) [-362.059] (-358.460) (-358.390) * [-357.752] (-358.402) (-358.413) (-361.407) -- 0:00:56 96500 -- [-357.060] (-361.295) (-358.686) (-359.407) * (-363.491) [-359.948] (-360.351) (-358.609) -- 0:00:56 97000 -- (-357.014) [-357.354] (-362.553) (-358.236) * (-359.273) [-357.744] (-357.988) (-357.441) -- 0:00:55 97500 -- (-359.399) (-358.182) (-360.635) [-358.593] * (-357.965) (-357.174) (-359.058) [-357.966] -- 0:00:55 98000 -- (-357.235) (-359.568) [-357.327] (-361.008) * (-360.846) (-357.639) [-362.495] (-357.258) -- 0:00:55 98500 -- (-357.058) (-357.996) [-359.587] (-359.540) * (-357.566) (-357.700) [-359.345] (-359.965) -- 0:00:54 99000 -- (-357.689) (-360.945) (-356.326) [-357.680] * (-362.132) (-357.466) (-360.335) [-359.443] -- 0:00:54 99500 -- (-357.589) [-358.122] (-356.943) (-358.148) * (-362.101) (-356.444) [-359.774] (-358.281) -- 0:00:54 100000 -- (-356.972) (-357.126) [-357.073] (-361.145) * (-358.055) (-358.014) (-358.858) [-359.981] -- 0:00:54 Average standard deviation of split frequencies: 0.034341 100500 -- (-359.517) (-359.060) (-358.217) [-357.832] * (-357.557) (-360.127) (-358.177) [-359.403] -- 0:00:53 101000 -- (-359.516) (-358.433) (-358.713) [-358.398] * [-359.848] (-357.788) (-357.869) (-356.699) -- 0:00:53 101500 -- (-360.267) (-355.927) (-357.755) [-358.926] * [-360.697] (-357.179) (-357.762) (-360.167) -- 0:00:53 102000 -- (-359.327) [-359.422] (-359.496) (-359.500) * (-356.450) (-359.113) [-357.715] (-358.124) -- 0:00:52 102500 -- [-357.995] (-358.295) (-358.172) (-360.623) * (-357.398) [-359.178] (-366.943) (-359.317) -- 0:00:52 103000 -- (-358.042) (-357.820) [-359.868] (-356.476) * (-356.392) (-357.223) (-361.429) [-359.088] -- 0:00:52 103500 -- (-358.386) [-356.859] (-357.547) (-356.554) * (-357.746) [-358.828] (-359.808) (-359.524) -- 0:00:51 104000 -- (-358.782) [-357.611] (-357.395) (-361.546) * (-358.020) [-359.572] (-356.948) (-359.145) -- 0:00:51 104500 -- (-357.576) (-357.377) (-359.157) [-357.576] * (-358.358) (-357.615) [-359.725] (-357.416) -- 0:00:51 105000 -- (-356.828) (-359.613) (-360.087) [-361.103] * (-357.881) (-358.082) (-357.647) [-358.524] -- 0:00:51 Average standard deviation of split frequencies: 0.028907 105500 -- (-362.583) (-361.226) (-358.540) [-357.836] * (-359.955) (-361.851) (-360.542) [-357.391] -- 0:00:59 106000 -- (-360.552) (-363.863) [-356.859] (-356.973) * (-357.878) [-359.054] (-358.205) (-359.530) -- 0:00:59 106500 -- (-358.876) (-360.150) [-356.262] (-360.924) * [-361.678] (-357.587) (-358.198) (-359.640) -- 0:00:58 107000 -- [-356.947] (-357.008) (-360.022) (-358.427) * [-356.407] (-359.401) (-363.490) (-358.256) -- 0:00:58 107500 -- (-356.405) [-362.239] (-359.144) (-360.438) * (-356.590) [-357.794] (-357.226) (-357.098) -- 0:00:58 108000 -- (-356.889) (-357.022) [-361.908] (-357.246) * (-358.298) [-357.756] (-357.625) (-359.281) -- 0:00:57 108500 -- (-358.621) (-359.021) (-359.940) [-358.479] * (-358.902) (-361.524) (-356.301) [-358.839] -- 0:00:57 109000 -- (-358.058) (-363.614) [-357.880] (-357.600) * (-359.046) (-357.955) (-358.732) [-357.121] -- 0:00:57 109500 -- [-360.466] (-359.853) (-357.181) (-356.271) * (-357.721) (-360.480) [-359.535] (-357.107) -- 0:00:56 110000 -- (-361.991) [-359.645] (-359.304) (-357.117) * (-357.308) (-361.803) [-359.373] (-357.619) -- 0:00:56 Average standard deviation of split frequencies: 0.025558 110500 -- (-359.205) (-356.848) [-357.248] (-357.259) * (-357.341) (-358.411) [-358.907] (-361.263) -- 0:00:56 111000 -- (-364.949) (-358.754) (-358.488) [-357.289] * (-358.544) [-356.139] (-360.166) (-362.303) -- 0:00:56 111500 -- (-361.613) [-358.947] (-358.322) (-356.673) * (-359.061) [-358.561] (-357.723) (-362.771) -- 0:00:55 112000 -- (-361.573) (-360.368) (-361.509) [-356.544] * [-356.113] (-360.898) (-359.771) (-362.704) -- 0:00:55 112500 -- (-358.924) [-358.961] (-357.381) (-356.894) * (-361.311) [-357.765] (-360.114) (-356.245) -- 0:00:55 113000 -- (-359.148) (-362.820) [-357.555] (-357.698) * (-359.028) (-357.751) (-359.635) [-360.816] -- 0:00:54 113500 -- (-359.592) [-356.209] (-360.203) (-358.333) * [-362.389] (-360.172) (-358.882) (-357.082) -- 0:00:54 114000 -- [-359.438] (-356.458) (-361.543) (-361.366) * [-361.674] (-362.611) (-357.307) (-358.973) -- 0:00:54 114500 -- (-359.331) (-356.132) (-357.450) [-361.168] * (-358.669) [-362.587] (-357.445) (-360.950) -- 0:00:54 115000 -- (-356.802) [-356.627] (-357.832) (-359.999) * (-361.444) (-360.738) (-358.891) [-357.818] -- 0:00:53 Average standard deviation of split frequencies: 0.022448 115500 -- (-360.231) (-360.891) (-362.903) [-359.649] * (-361.438) (-363.940) (-358.892) [-357.315] -- 0:00:53 116000 -- (-361.430) (-358.843) (-358.814) [-357.843] * [-357.413] (-357.800) (-358.711) (-357.540) -- 0:00:53 116500 -- [-357.397] (-361.797) (-358.973) (-362.626) * (-360.595) (-356.732) [-359.374] (-356.970) -- 0:00:53 117000 -- [-356.381] (-358.230) (-358.860) (-360.992) * (-357.994) [-359.937] (-357.001) (-356.759) -- 0:00:52 117500 -- (-360.129) (-360.730) [-360.644] (-364.969) * [-356.889] (-356.878) (-357.286) (-358.890) -- 0:00:52 118000 -- (-360.447) (-357.432) [-358.554] (-360.962) * (-357.986) (-361.772) [-360.968] (-357.787) -- 0:00:52 118500 -- (-357.737) (-356.880) (-357.243) [-357.035] * (-360.132) (-358.474) (-357.895) [-357.990] -- 0:00:52 119000 -- [-357.396] (-357.550) (-356.604) (-358.907) * [-357.111] (-357.892) (-356.660) (-356.526) -- 0:00:51 119500 -- (-358.000) (-357.103) [-357.541] (-358.491) * (-359.313) [-357.682] (-356.796) (-357.623) -- 0:00:51 120000 -- [-357.253] (-358.130) (-357.103) (-356.426) * [-357.497] (-357.821) (-359.464) (-359.098) -- 0:00:51 Average standard deviation of split frequencies: 0.024184 120500 -- (-356.403) (-356.643) (-360.651) [-356.530] * (-356.993) (-358.411) (-356.942) [-357.931] -- 0:00:51 121000 -- (-358.413) (-356.886) [-358.212] (-358.012) * (-356.714) (-365.687) (-356.694) [-356.777] -- 0:00:50 121500 -- (-360.131) (-358.511) (-360.077) [-356.976] * (-358.543) (-360.958) (-359.704) [-357.783] -- 0:00:50 122000 -- (-356.281) (-356.297) (-357.018) [-359.345] * (-361.508) (-359.273) (-365.048) [-357.732] -- 0:00:50 122500 -- [-359.280] (-358.352) (-357.101) (-359.367) * (-358.064) (-357.508) [-360.725] (-359.154) -- 0:00:57 123000 -- (-359.025) [-358.467] (-358.608) (-357.244) * (-358.853) (-363.547) (-356.412) [-356.083] -- 0:00:57 123500 -- (-358.898) (-357.723) (-356.923) [-359.365] * (-359.187) (-359.461) [-358.743] (-358.487) -- 0:00:56 124000 -- (-357.886) (-359.915) (-362.678) [-357.750] * (-363.568) (-361.056) (-356.265) [-361.265] -- 0:00:56 124500 -- [-358.170] (-358.900) (-361.816) (-356.294) * [-359.810] (-360.976) (-361.229) (-358.779) -- 0:00:56 125000 -- [-359.219] (-358.831) (-356.853) (-360.403) * [-359.015] (-360.586) (-356.796) (-358.565) -- 0:00:56 Average standard deviation of split frequencies: 0.021379 125500 -- [-360.750] (-358.146) (-358.507) (-358.661) * [-359.724] (-359.113) (-357.750) (-357.354) -- 0:00:55 126000 -- (-358.479) [-358.945] (-358.422) (-360.169) * (-357.269) [-357.104] (-357.069) (-363.616) -- 0:00:55 126500 -- (-360.065) [-359.416] (-359.185) (-358.671) * (-356.882) (-357.886) (-356.902) [-361.926] -- 0:00:55 127000 -- (-360.354) (-357.193) [-356.559] (-358.960) * [-357.049] (-359.235) (-362.038) (-356.737) -- 0:00:54 127500 -- (-362.364) (-358.490) [-359.031] (-358.232) * (-357.507) (-356.753) [-360.604] (-361.272) -- 0:00:54 128000 -- (-359.010) (-357.338) [-357.643] (-359.463) * (-356.004) (-357.352) [-356.944] (-358.095) -- 0:00:54 128500 -- (-365.374) (-358.009) (-359.616) [-357.604] * (-358.354) (-357.921) [-357.693] (-358.832) -- 0:00:54 129000 -- (-360.616) (-358.989) (-358.400) [-357.594] * [-357.537] (-359.184) (-357.632) (-361.875) -- 0:00:54 129500 -- (-357.390) (-360.586) [-360.011] (-359.355) * (-360.798) (-357.869) [-357.122] (-361.831) -- 0:00:53 130000 -- [-358.377] (-357.912) (-358.522) (-361.198) * [-357.289] (-356.897) (-358.823) (-360.366) -- 0:00:53 Average standard deviation of split frequencies: 0.021446 130500 -- [-360.074] (-358.627) (-358.678) (-359.159) * [-357.286] (-359.349) (-360.119) (-357.149) -- 0:00:53 131000 -- (-359.012) [-358.716] (-357.977) (-362.613) * (-359.440) (-356.470) (-360.758) [-359.113] -- 0:00:53 131500 -- (-359.680) (-359.557) (-358.116) [-359.341] * (-359.971) (-360.389) (-361.878) [-356.992] -- 0:00:52 132000 -- (-357.775) (-357.802) (-356.260) [-358.650] * [-360.214] (-357.470) (-360.149) (-359.412) -- 0:00:52 132500 -- (-356.392) (-358.295) [-356.737] (-360.015) * (-357.569) [-358.490] (-361.430) (-360.950) -- 0:00:52 133000 -- (-359.751) [-357.925] (-356.864) (-357.385) * [-357.777] (-359.555) (-357.763) (-360.315) -- 0:00:52 133500 -- (-361.885) [-357.866] (-357.038) (-359.863) * (-359.837) [-356.747] (-359.750) (-356.779) -- 0:00:51 134000 -- (-358.755) (-363.103) [-356.554] (-362.050) * (-357.760) (-359.249) (-356.796) [-356.929] -- 0:00:51 134500 -- [-356.647] (-357.815) (-358.470) (-358.914) * (-359.169) [-358.093] (-358.366) (-356.603) -- 0:00:51 135000 -- [-357.595] (-357.946) (-358.278) (-358.037) * (-357.022) (-357.710) [-358.360] (-358.966) -- 0:00:51 Average standard deviation of split frequencies: 0.021709 135500 -- (-356.862) [-358.499] (-358.952) (-358.218) * (-358.821) [-360.377] (-357.985) (-360.452) -- 0:00:51 136000 -- (-362.824) (-358.681) [-358.403] (-357.721) * (-358.203) (-358.969) (-356.820) [-356.922] -- 0:00:50 136500 -- [-356.995] (-358.903) (-358.227) (-359.524) * [-361.991] (-357.074) (-357.106) (-361.663) -- 0:00:50 137000 -- (-358.897) [-357.371] (-360.827) (-356.943) * (-357.165) [-356.825] (-358.337) (-357.796) -- 0:00:50 137500 -- (-360.651) (-362.354) (-364.320) [-358.216] * (-356.481) (-356.408) (-357.940) [-359.901] -- 0:00:50 138000 -- (-359.072) (-360.216) (-359.611) [-359.453] * (-362.789) (-362.513) (-358.948) [-357.255] -- 0:00:49 138500 -- [-357.428] (-359.905) (-356.510) (-362.312) * (-363.096) (-364.139) [-356.352] (-356.596) -- 0:00:49 139000 -- [-359.193] (-357.278) (-362.040) (-357.940) * [-359.457] (-360.476) (-356.675) (-357.095) -- 0:00:49 139500 -- (-359.760) [-358.273] (-359.116) (-359.946) * (-360.851) [-356.602] (-356.528) (-357.066) -- 0:00:55 140000 -- (-359.659) (-357.033) (-363.351) [-356.977] * (-363.069) (-357.271) [-358.303] (-358.269) -- 0:00:55 Average standard deviation of split frequencies: 0.022155 140500 -- (-359.786) (-356.938) [-357.522] (-358.078) * (-357.112) (-357.043) [-356.877] (-361.519) -- 0:00:55 141000 -- (-359.017) [-357.133] (-358.289) (-356.998) * (-358.068) (-356.711) [-359.073] (-359.033) -- 0:00:54 141500 -- (-356.773) (-359.463) (-358.646) [-357.202] * (-359.288) [-357.725] (-358.516) (-358.887) -- 0:00:54 142000 -- [-357.813] (-358.891) (-360.956) (-360.160) * [-360.718] (-357.063) (-359.891) (-358.195) -- 0:00:54 142500 -- [-357.064] (-358.336) (-358.368) (-357.789) * (-359.705) (-357.431) [-356.604] (-361.076) -- 0:00:54 143000 -- [-356.873] (-361.018) (-357.723) (-358.927) * [-357.044] (-358.319) (-357.912) (-364.462) -- 0:00:53 143500 -- [-357.902] (-358.783) (-356.733) (-356.965) * (-356.482) [-357.774] (-357.160) (-358.750) -- 0:00:53 144000 -- (-355.892) [-357.005] (-356.509) (-359.677) * (-358.051) (-358.625) [-359.184] (-358.939) -- 0:00:53 144500 -- (-357.030) (-359.419) [-356.673] (-357.632) * [-358.667] (-360.863) (-356.378) (-358.803) -- 0:00:53 145000 -- (-355.918) (-358.233) (-356.497) [-360.073] * [-360.015] (-359.000) (-357.818) (-357.965) -- 0:00:53 Average standard deviation of split frequencies: 0.022279 145500 -- (-361.027) [-356.148] (-356.903) (-362.488) * [-359.528] (-356.354) (-361.090) (-357.051) -- 0:00:52 146000 -- (-359.318) (-357.386) [-356.799] (-359.934) * (-357.489) [-356.398] (-357.534) (-357.832) -- 0:00:52 146500 -- (-356.620) (-356.946) [-357.099] (-356.363) * (-358.672) (-356.501) (-362.367) [-357.718] -- 0:00:52 147000 -- (-358.149) [-361.721] (-357.565) (-357.556) * (-360.877) [-357.943] (-356.437) (-356.971) -- 0:00:52 147500 -- (-357.476) (-358.994) (-359.910) [-357.225] * (-357.108) (-356.527) [-356.958] (-359.883) -- 0:00:52 148000 -- (-362.268) [-358.785] (-362.217) (-357.561) * (-359.277) (-357.077) [-359.777] (-358.486) -- 0:00:51 148500 -- (-359.048) [-357.650] (-360.590) (-357.018) * (-361.713) (-357.010) (-360.141) [-357.717] -- 0:00:51 149000 -- (-358.309) (-356.245) (-359.119) [-358.430] * (-358.287) (-357.606) [-357.932] (-357.029) -- 0:00:51 149500 -- (-357.470) (-358.159) (-359.705) [-359.980] * (-358.488) (-356.830) (-358.512) [-357.406] -- 0:00:51 150000 -- (-356.930) (-359.093) [-357.396] (-361.285) * (-356.593) [-356.788] (-357.663) (-361.511) -- 0:00:51 Average standard deviation of split frequencies: 0.023466 150500 -- [-357.280] (-356.858) (-356.299) (-357.807) * (-358.429) (-358.369) (-358.690) [-359.064] -- 0:00:50 151000 -- (-362.279) (-358.128) [-359.336] (-357.649) * (-363.570) (-359.577) (-360.026) [-360.403] -- 0:00:50 151500 -- (-357.668) [-363.120] (-356.935) (-357.550) * (-365.543) (-359.363) (-359.318) [-357.644] -- 0:00:50 152000 -- (-358.015) (-361.078) (-358.149) [-356.730] * [-360.217] (-356.312) (-361.866) (-357.879) -- 0:00:50 152500 -- (-357.082) (-359.361) (-358.359) [-358.785] * (-360.689) [-357.000] (-357.705) (-358.791) -- 0:00:50 153000 -- (-357.533) [-360.888] (-359.186) (-356.164) * (-360.782) (-358.440) [-359.208] (-357.259) -- 0:00:49 153500 -- (-356.634) (-356.766) (-357.608) [-357.027] * (-361.305) (-356.444) [-357.574] (-359.568) -- 0:00:49 154000 -- [-359.784] (-356.911) (-358.102) (-360.039) * [-361.428] (-356.392) (-360.536) (-358.676) -- 0:00:49 154500 -- (-356.655) [-358.327] (-358.966) (-359.145) * (-357.620) (-357.642) [-357.656] (-358.713) -- 0:00:49 155000 -- (-357.232) (-359.221) (-358.614) [-359.959] * (-358.210) [-355.962] (-357.879) (-357.107) -- 0:00:49 Average standard deviation of split frequencies: 0.021312 155500 -- (-357.348) (-358.967) (-359.599) [-357.282] * (-360.967) [-358.242] (-361.133) (-358.593) -- 0:00:48 156000 -- (-357.685) (-358.840) (-357.243) [-358.001] * (-357.016) [-359.182] (-358.519) (-358.182) -- 0:00:54 156500 -- (-363.208) (-359.646) (-357.973) [-358.834] * (-357.380) (-358.932) [-358.252] (-357.205) -- 0:00:53 157000 -- (-362.492) [-357.836] (-357.004) (-359.745) * (-361.195) (-356.819) [-358.798] (-358.841) -- 0:00:53 157500 -- [-360.577] (-361.674) (-357.730) (-360.513) * (-357.042) [-357.961] (-356.786) (-359.142) -- 0:00:53 158000 -- (-373.074) [-363.395] (-358.366) (-359.786) * (-358.644) (-357.966) [-358.357] (-360.777) -- 0:00:53 158500 -- (-360.930) (-357.085) (-359.444) [-357.679] * (-356.664) (-356.845) (-359.401) [-360.056] -- 0:00:53 159000 -- [-357.598] (-360.192) (-358.262) (-358.332) * (-358.655) (-357.681) [-361.879] (-356.373) -- 0:00:52 159500 -- (-360.739) (-357.651) [-357.924] (-357.928) * (-358.946) (-361.429) (-359.304) [-357.286] -- 0:00:52 160000 -- [-356.221] (-356.460) (-358.246) (-359.573) * (-356.611) [-358.195] (-356.458) (-357.325) -- 0:00:52 Average standard deviation of split frequencies: 0.020075 160500 -- (-357.573) (-359.436) [-356.674] (-359.354) * (-357.173) (-358.153) [-356.710] (-359.281) -- 0:00:52 161000 -- (-356.693) (-356.683) [-358.113] (-361.537) * (-363.705) [-356.560] (-365.088) (-357.107) -- 0:00:52 161500 -- (-358.452) (-356.057) [-360.750] (-360.287) * [-358.292] (-359.224) (-355.894) (-357.621) -- 0:00:51 162000 -- (-358.185) (-357.294) [-358.212] (-357.666) * (-358.006) [-356.411] (-356.339) (-357.055) -- 0:00:51 162500 -- [-355.944] (-356.164) (-359.486) (-357.901) * (-356.781) [-359.882] (-357.855) (-358.897) -- 0:00:51 163000 -- (-357.203) (-359.030) (-358.993) [-357.833] * (-361.156) (-362.639) (-357.157) [-359.235] -- 0:00:51 163500 -- (-359.710) [-356.855] (-360.154) (-355.994) * (-359.641) (-359.233) [-356.383] (-361.049) -- 0:00:51 164000 -- (-358.049) (-357.416) (-358.552) [-357.412] * (-359.310) (-359.213) [-357.873] (-356.187) -- 0:00:50 164500 -- [-357.711] (-356.902) (-357.652) (-357.988) * (-358.083) (-360.493) (-358.733) [-356.334] -- 0:00:50 165000 -- (-364.129) (-356.895) (-359.141) [-356.327] * [-356.590] (-356.089) (-358.865) (-359.289) -- 0:00:50 Average standard deviation of split frequencies: 0.019737 165500 -- (-357.053) (-358.367) [-358.406] (-359.766) * [-359.697] (-357.900) (-361.140) (-360.237) -- 0:00:50 166000 -- (-358.960) (-358.507) (-357.407) [-359.320] * (-359.395) (-360.683) [-359.354] (-358.726) -- 0:00:50 166500 -- (-356.964) (-360.976) (-358.226) [-358.488] * [-361.188] (-358.405) (-358.277) (-361.636) -- 0:00:50 167000 -- (-359.325) (-356.377) [-361.256] (-358.328) * [-358.643] (-358.672) (-358.975) (-358.934) -- 0:00:49 167500 -- (-357.088) [-357.433] (-361.713) (-356.520) * (-357.448) (-358.098) [-359.829] (-360.879) -- 0:00:49 168000 -- (-364.108) (-356.802) [-357.116] (-358.794) * [-360.428] (-363.817) (-360.930) (-358.257) -- 0:00:49 168500 -- (-361.144) (-360.318) [-356.364] (-357.645) * (-357.799) (-357.073) [-357.119] (-356.631) -- 0:00:49 169000 -- (-358.637) (-359.275) (-357.973) [-357.876] * (-361.609) [-358.945] (-360.403) (-361.035) -- 0:00:49 169500 -- (-356.836) (-357.726) [-358.738] (-358.781) * (-362.204) (-356.090) (-357.779) [-359.525] -- 0:00:48 170000 -- (-361.554) [-357.540] (-360.458) (-356.627) * (-356.504) (-357.683) (-361.767) [-358.377] -- 0:00:48 Average standard deviation of split frequencies: 0.018092 170500 -- (-359.064) (-357.384) (-358.422) [-360.860] * (-358.560) (-362.214) [-360.700] (-357.226) -- 0:00:48 171000 -- (-357.340) [-356.596] (-357.119) (-365.540) * (-358.247) (-356.667) (-358.134) [-357.974] -- 0:00:48 171500 -- (-359.825) (-356.693) [-358.033] (-359.907) * (-356.121) (-360.024) [-358.697] (-358.135) -- 0:00:48 172000 -- (-356.378) (-361.396) [-358.502] (-360.369) * [-359.979] (-357.489) (-357.328) (-359.632) -- 0:00:48 172500 -- [-357.047] (-358.569) (-359.271) (-360.139) * [-357.456] (-359.047) (-357.093) (-361.266) -- 0:00:52 173000 -- [-356.622] (-358.815) (-359.374) (-359.766) * (-358.783) (-359.497) (-357.472) [-357.843] -- 0:00:52 173500 -- (-360.837) (-359.640) [-357.652] (-359.449) * [-358.257] (-358.673) (-360.033) (-357.009) -- 0:00:52 174000 -- (-358.822) (-356.995) (-356.819) [-359.595] * (-359.888) (-358.244) [-357.002] (-357.150) -- 0:00:52 174500 -- (-360.022) [-357.038] (-357.626) (-362.945) * (-359.936) [-360.820] (-358.162) (-359.423) -- 0:00:52 175000 -- (-357.239) [-358.237] (-358.455) (-362.072) * (-359.100) [-358.405] (-358.978) (-362.879) -- 0:00:51 Average standard deviation of split frequencies: 0.017276 175500 -- (-360.530) [-360.258] (-360.081) (-358.728) * (-358.734) (-359.533) [-358.687] (-364.362) -- 0:00:51 176000 -- (-361.068) (-357.179) (-361.298) [-357.479] * (-358.330) (-356.795) (-361.574) [-358.459] -- 0:00:51 176500 -- (-358.354) [-358.586] (-360.632) (-358.494) * (-361.547) [-358.417] (-360.748) (-356.826) -- 0:00:51 177000 -- [-359.210] (-364.075) (-357.761) (-358.781) * (-358.859) (-357.800) (-358.940) [-356.887] -- 0:00:51 177500 -- [-358.464] (-359.847) (-359.243) (-358.116) * (-358.889) (-356.345) [-359.500] (-359.366) -- 0:00:50 178000 -- [-360.332] (-359.337) (-367.300) (-359.447) * [-356.953] (-357.289) (-359.597) (-360.274) -- 0:00:50 178500 -- (-358.351) (-358.545) (-369.917) [-358.340] * (-359.375) (-358.184) [-358.178] (-358.248) -- 0:00:50 179000 -- (-357.920) (-358.286) (-358.471) [-358.897] * [-358.402] (-356.697) (-357.568) (-357.829) -- 0:00:50 179500 -- [-358.092] (-359.641) (-359.719) (-362.702) * (-360.016) (-357.765) [-356.886] (-359.279) -- 0:00:50 180000 -- (-357.046) [-359.241] (-357.017) (-362.158) * (-358.551) (-358.618) (-358.726) [-356.295] -- 0:00:50 Average standard deviation of split frequencies: 0.017091 180500 -- (-358.899) (-361.498) (-358.446) [-359.674] * (-360.315) [-357.807] (-357.039) (-357.249) -- 0:00:49 181000 -- (-359.487) [-357.939] (-356.123) (-358.299) * [-361.568] (-357.644) (-358.019) (-357.031) -- 0:00:49 181500 -- [-356.291] (-356.385) (-358.504) (-357.463) * (-358.539) [-358.282] (-363.998) (-357.170) -- 0:00:49 182000 -- (-358.876) (-358.028) [-357.579] (-357.791) * (-358.102) (-358.248) (-359.586) [-362.130] -- 0:00:49 182500 -- [-360.297] (-357.718) (-359.178) (-357.035) * (-356.581) (-356.749) (-361.817) [-359.903] -- 0:00:49 183000 -- (-360.375) (-357.671) (-358.717) [-356.862] * [-357.940] (-357.467) (-360.725) (-357.022) -- 0:00:49 183500 -- (-357.735) (-358.419) (-360.653) [-357.007] * (-362.799) [-356.646] (-358.761) (-360.669) -- 0:00:48 184000 -- (-357.187) [-357.681] (-358.803) (-357.489) * (-361.289) [-358.131] (-359.011) (-358.250) -- 0:00:48 184500 -- (-357.860) (-359.865) [-357.286] (-359.786) * (-357.442) [-360.521] (-362.103) (-356.850) -- 0:00:48 185000 -- (-359.593) [-357.413] (-358.528) (-359.019) * [-357.114] (-361.911) (-357.355) (-364.802) -- 0:00:48 Average standard deviation of split frequencies: 0.017341 185500 -- [-357.542] (-360.666) (-360.431) (-358.537) * (-358.325) (-358.469) [-359.185] (-358.983) -- 0:00:48 186000 -- (-364.702) [-356.883] (-356.549) (-358.742) * [-359.339] (-359.021) (-359.844) (-359.992) -- 0:00:48 186500 -- (-358.782) (-358.984) (-358.703) [-358.468] * (-362.196) (-359.713) [-357.417] (-359.107) -- 0:00:47 187000 -- (-365.534) (-358.786) [-358.239] (-357.484) * (-357.153) (-356.860) [-358.173] (-359.634) -- 0:00:47 187500 -- (-358.179) (-357.699) (-357.886) [-356.784] * (-358.764) (-358.017) (-357.823) [-357.655] -- 0:00:47 188000 -- [-356.747] (-360.199) (-357.563) (-357.507) * [-357.505] (-358.203) (-359.737) (-356.127) -- 0:00:47 188500 -- (-357.707) [-358.510] (-360.293) (-357.420) * [-357.714] (-360.117) (-359.961) (-359.760) -- 0:00:47 189000 -- (-356.171) (-359.017) [-361.382] (-360.786) * (-356.639) (-357.871) [-356.392] (-360.192) -- 0:00:51 189500 -- (-359.222) [-363.047] (-360.318) (-357.413) * (-358.717) (-358.155) [-356.995] (-359.603) -- 0:00:51 190000 -- [-358.882] (-358.204) (-358.077) (-357.878) * [-359.949] (-359.132) (-356.105) (-359.479) -- 0:00:51 Average standard deviation of split frequencies: 0.017697 190500 -- (-358.607) (-356.302) (-359.441) [-359.605] * [-356.797] (-357.528) (-357.692) (-356.770) -- 0:00:50 191000 -- (-360.751) (-360.160) (-358.481) [-357.922] * (-357.219) (-357.917) (-357.804) [-357.008] -- 0:00:50 191500 -- (-362.658) (-360.025) (-359.046) [-357.794] * (-356.725) (-361.965) [-357.097] (-356.513) -- 0:00:50 192000 -- (-358.476) (-360.274) (-357.169) [-361.519] * (-358.549) (-359.255) (-358.175) [-356.517] -- 0:00:50 192500 -- [-360.014] (-358.962) (-358.245) (-358.238) * (-356.549) [-357.842] (-359.996) (-357.038) -- 0:00:50 193000 -- (-360.753) (-358.141) [-356.737] (-359.124) * (-359.652) [-359.882] (-357.654) (-359.156) -- 0:00:50 193500 -- [-356.862] (-356.533) (-357.208) (-358.331) * [-358.159] (-357.003) (-362.528) (-359.514) -- 0:00:50 194000 -- (-357.246) (-361.010) [-357.482] (-359.832) * (-356.532) [-358.115] (-356.177) (-358.959) -- 0:00:49 194500 -- (-358.869) [-358.607] (-357.588) (-357.636) * [-358.326] (-361.041) (-356.832) (-356.914) -- 0:00:49 195000 -- (-359.369) (-357.083) [-358.945] (-357.739) * (-360.784) [-357.365] (-357.249) (-360.594) -- 0:00:49 Average standard deviation of split frequencies: 0.017089 195500 -- (-358.681) (-356.695) [-358.488] (-357.891) * [-358.614] (-357.779) (-358.715) (-356.461) -- 0:00:49 196000 -- (-360.032) (-357.079) (-356.843) [-358.109] * (-357.982) (-358.708) (-357.656) [-358.392] -- 0:00:49 196500 -- (-356.429) (-356.679) (-363.826) [-360.730] * (-357.951) (-361.048) (-357.803) [-357.484] -- 0:00:49 197000 -- (-358.772) [-356.262] (-362.970) (-359.343) * [-358.639] (-357.016) (-357.307) (-358.284) -- 0:00:48 197500 -- (-356.735) (-360.185) [-356.807] (-356.992) * (-358.978) (-361.623) [-357.220] (-358.332) -- 0:00:48 198000 -- [-357.942] (-357.280) (-356.545) (-357.142) * (-357.515) (-359.295) [-357.402] (-356.798) -- 0:00:48 198500 -- (-360.467) (-357.476) [-357.411] (-359.773) * [-360.311] (-359.450) (-360.402) (-357.040) -- 0:00:48 199000 -- (-359.432) (-360.005) [-356.998] (-358.090) * (-358.303) [-358.048] (-359.744) (-357.786) -- 0:00:48 199500 -- [-358.129] (-358.002) (-362.846) (-360.929) * (-358.975) (-361.197) (-360.375) [-359.567] -- 0:00:48 200000 -- (-361.465) [-359.176] (-363.007) (-362.152) * (-358.086) [-357.956] (-358.217) (-360.049) -- 0:00:48 Average standard deviation of split frequencies: 0.015009 200500 -- [-360.951] (-358.775) (-357.801) (-358.520) * (-356.840) (-363.026) (-360.817) [-357.231] -- 0:00:47 201000 -- (-359.331) (-357.412) [-358.512] (-358.510) * [-362.200] (-359.175) (-357.078) (-362.431) -- 0:00:47 201500 -- (-357.281) [-356.983] (-357.479) (-356.863) * (-358.450) (-357.644) (-358.903) [-357.525] -- 0:00:47 202000 -- [-361.160] (-357.993) (-357.859) (-359.005) * (-357.086) (-357.847) (-361.294) [-361.562] -- 0:00:47 202500 -- (-358.050) (-357.844) (-358.108) [-358.699] * [-357.219] (-362.405) (-359.715) (-357.453) -- 0:00:47 203000 -- [-359.665] (-357.066) (-363.112) (-356.924) * (-357.749) (-357.131) (-356.900) [-358.777] -- 0:00:47 203500 -- (-357.713) (-357.470) (-358.154) [-359.741] * (-358.915) (-359.980) (-359.215) [-357.851] -- 0:00:46 204000 -- (-358.854) [-359.481] (-358.671) (-357.708) * (-358.977) (-357.171) (-358.352) [-358.897] -- 0:00:50 204500 -- (-359.866) (-359.610) [-357.509] (-357.669) * (-356.796) (-360.262) (-356.119) [-359.486] -- 0:00:50 205000 -- [-357.229] (-358.440) (-362.096) (-356.450) * (-356.329) (-359.056) (-359.878) [-359.128] -- 0:00:50 Average standard deviation of split frequencies: 0.015296 205500 -- [-356.922] (-358.022) (-361.043) (-357.814) * (-357.362) (-358.114) (-359.034) [-360.622] -- 0:00:50 206000 -- (-357.448) [-360.138] (-360.162) (-358.118) * [-359.584] (-357.161) (-360.239) (-356.996) -- 0:00:50 206500 -- (-360.268) (-360.627) (-357.072) [-358.322] * [-358.382] (-359.908) (-359.261) (-359.042) -- 0:00:49 207000 -- (-359.375) (-359.614) (-356.743) [-357.043] * (-358.818) (-361.823) [-356.545] (-358.058) -- 0:00:49 207500 -- (-358.105) [-358.174] (-357.074) (-356.828) * [-357.345] (-358.701) (-358.721) (-360.184) -- 0:00:49 208000 -- (-357.500) (-361.772) [-356.514] (-361.237) * (-358.678) (-356.842) [-359.202] (-358.237) -- 0:00:49 208500 -- (-357.641) (-361.204) [-358.765] (-357.845) * (-359.114) [-359.045] (-358.814) (-357.167) -- 0:00:49 209000 -- (-357.128) [-361.315] (-358.381) (-359.491) * (-359.240) (-369.729) (-357.437) [-357.434] -- 0:00:49 209500 -- (-356.891) (-356.461) [-360.389] (-362.286) * [-362.192] (-358.128) (-357.004) (-362.229) -- 0:00:49 210000 -- (-356.736) (-357.848) [-362.051] (-359.016) * (-357.521) (-359.110) (-356.224) [-358.618] -- 0:00:48 Average standard deviation of split frequencies: 0.015415 210500 -- (-359.049) (-361.720) (-361.587) [-359.287] * (-360.356) (-358.610) [-358.111] (-360.862) -- 0:00:48 211000 -- (-359.295) (-358.764) (-356.967) [-359.289] * (-362.337) (-356.931) [-357.488] (-364.003) -- 0:00:48 211500 -- (-360.872) [-357.382] (-359.567) (-361.610) * (-359.991) (-357.260) [-358.024] (-357.098) -- 0:00:48 212000 -- (-357.018) (-357.505) [-357.343] (-359.206) * (-358.659) (-357.831) (-360.354) [-357.983] -- 0:00:48 212500 -- (-357.734) [-357.134] (-357.713) (-358.323) * (-358.332) (-361.306) [-358.604] (-357.132) -- 0:00:48 213000 -- (-361.609) (-361.855) [-360.790] (-360.482) * [-357.960] (-360.254) (-363.161) (-358.121) -- 0:00:48 213500 -- (-356.908) (-359.129) [-357.634] (-359.205) * (-360.348) [-358.236] (-358.994) (-357.093) -- 0:00:47 214000 -- (-359.509) [-356.771] (-357.716) (-356.480) * (-359.730) (-357.837) (-360.767) [-357.803] -- 0:00:47 214500 -- (-359.660) [-357.668] (-357.195) (-360.788) * (-357.858) (-358.647) (-357.164) [-361.991] -- 0:00:47 215000 -- [-361.984] (-357.584) (-357.776) (-359.971) * (-357.779) (-356.597) (-359.249) [-358.049] -- 0:00:47 Average standard deviation of split frequencies: 0.016176 215500 -- [-358.481] (-357.001) (-362.480) (-358.377) * (-360.931) (-358.103) [-357.161] (-359.509) -- 0:00:47 216000 -- (-360.007) [-358.093] (-356.995) (-360.523) * (-356.799) (-358.829) (-358.359) [-359.343] -- 0:00:47 216500 -- (-359.389) (-356.670) [-356.511] (-356.309) * [-360.515] (-357.114) (-359.144) (-358.455) -- 0:00:47 217000 -- (-359.033) (-359.520) (-359.399) [-356.268] * (-360.900) (-356.261) (-356.716) [-358.994] -- 0:00:46 217500 -- [-356.723] (-359.592) (-359.020) (-362.632) * [-360.335] (-357.397) (-356.810) (-360.148) -- 0:00:46 218000 -- (-359.225) (-360.966) (-356.133) [-359.563] * (-356.925) (-358.373) [-357.493] (-357.287) -- 0:00:46 218500 -- [-356.521] (-357.652) (-358.397) (-362.010) * (-360.791) [-358.807] (-357.426) (-359.126) -- 0:00:46 219000 -- (-358.382) (-358.175) (-363.979) [-357.457] * (-360.487) (-361.198) [-357.262] (-358.383) -- 0:00:46 219500 -- [-357.431] (-360.010) (-358.169) (-358.550) * (-359.997) [-358.394] (-356.211) (-356.306) -- 0:00:46 220000 -- [-356.565] (-359.126) (-357.703) (-359.132) * (-358.081) (-356.669) [-357.458] (-357.523) -- 0:00:46 Average standard deviation of split frequencies: 0.014828 220500 -- (-357.615) (-359.847) (-356.740) [-357.606] * (-359.106) [-356.396] (-358.157) (-357.750) -- 0:00:45 221000 -- (-356.630) [-358.898] (-356.717) (-356.919) * (-358.022) (-357.616) (-359.338) [-357.430] -- 0:00:45 221500 -- [-356.785] (-356.323) (-357.223) (-357.806) * (-360.844) (-358.774) [-360.778] (-357.421) -- 0:00:49 222000 -- [-356.844] (-356.304) (-358.341) (-358.241) * (-359.035) [-358.121] (-358.759) (-359.826) -- 0:00:49 222500 -- (-357.766) (-357.844) [-357.580] (-358.907) * (-358.390) (-358.645) (-359.080) [-360.020] -- 0:00:48 223000 -- (-358.056) (-358.527) [-356.642] (-357.564) * (-358.095) (-360.555) (-360.070) [-359.549] -- 0:00:48 223500 -- (-357.445) (-359.512) [-356.176] (-357.629) * (-356.662) (-357.006) (-357.704) [-357.751] -- 0:00:48 224000 -- (-356.620) (-359.196) (-360.811) [-360.024] * (-357.223) [-360.541] (-356.628) (-360.815) -- 0:00:48 224500 -- (-357.702) (-358.678) (-364.524) [-357.649] * (-357.123) (-358.125) [-357.351] (-360.389) -- 0:00:48 225000 -- (-366.151) (-361.063) (-356.679) [-357.248] * (-356.906) (-357.617) (-358.991) [-357.708] -- 0:00:48 Average standard deviation of split frequencies: 0.013988 225500 -- (-360.563) [-361.089] (-364.191) (-357.226) * (-358.389) (-358.996) (-356.982) [-358.922] -- 0:00:48 226000 -- (-358.414) (-358.586) (-367.696) [-357.328] * (-357.840) (-356.289) [-359.562] (-362.630) -- 0:00:47 226500 -- (-361.507) (-359.300) (-364.993) [-357.171] * (-359.757) (-359.421) [-357.870] (-359.897) -- 0:00:47 227000 -- (-359.137) (-360.825) (-359.683) [-359.026] * (-358.057) [-360.882] (-358.211) (-359.368) -- 0:00:47 227500 -- (-356.870) (-357.728) (-358.308) [-358.462] * [-358.829] (-360.971) (-357.096) (-357.101) -- 0:00:47 228000 -- (-358.407) (-359.528) (-362.597) [-358.452] * [-356.919] (-362.161) (-361.703) (-358.947) -- 0:00:47 228500 -- (-358.678) (-357.121) (-362.639) [-357.716] * [-357.014] (-356.730) (-360.225) (-356.746) -- 0:00:47 229000 -- (-358.529) [-357.667] (-362.338) (-357.488) * (-357.994) (-358.627) [-357.463] (-358.478) -- 0:00:47 229500 -- (-358.747) (-357.649) [-362.660] (-357.930) * (-360.677) (-358.313) (-356.099) [-359.044] -- 0:00:47 230000 -- [-358.015] (-360.148) (-356.967) (-361.734) * [-356.885] (-359.217) (-357.268) (-358.693) -- 0:00:46 Average standard deviation of split frequencies: 0.016349 230500 -- (-359.502) [-362.377] (-358.799) (-364.897) * [-356.875] (-357.049) (-359.459) (-357.961) -- 0:00:46 231000 -- (-356.675) (-362.053) (-358.655) [-360.316] * [-357.796] (-360.724) (-357.202) (-358.294) -- 0:00:46 231500 -- (-356.802) (-358.203) (-358.133) [-357.942] * (-357.189) (-362.224) [-356.691] (-358.586) -- 0:00:46 232000 -- (-358.192) (-356.990) [-356.932] (-358.437) * (-356.604) (-360.150) [-358.629] (-360.043) -- 0:00:46 232500 -- [-358.827] (-359.650) (-357.603) (-356.923) * [-360.132] (-360.153) (-358.995) (-358.414) -- 0:00:46 233000 -- (-357.904) (-363.203) [-356.989] (-361.440) * (-357.933) [-359.732] (-359.223) (-361.171) -- 0:00:46 233500 -- (-358.676) (-358.638) [-357.103] (-358.087) * (-357.356) [-357.669] (-358.126) (-356.748) -- 0:00:45 234000 -- [-356.489] (-358.375) (-358.572) (-361.959) * (-357.201) (-356.359) (-361.156) [-358.939] -- 0:00:45 234500 -- [-357.633] (-360.137) (-362.185) (-358.293) * (-359.598) (-357.479) [-362.212] (-360.608) -- 0:00:45 235000 -- (-358.624) (-356.808) (-364.708) [-358.395] * (-357.390) (-358.364) (-358.139) [-356.855] -- 0:00:45 Average standard deviation of split frequencies: 0.017200 235500 -- (-356.947) [-356.407] (-364.336) (-357.921) * [-357.314] (-358.806) (-357.382) (-358.073) -- 0:00:45 236000 -- (-357.527) [-356.497] (-358.135) (-357.771) * (-356.683) (-361.031) (-356.868) [-359.556] -- 0:00:45 236500 -- (-359.318) (-360.912) (-359.107) [-357.041] * [-356.825] (-358.285) (-361.749) (-356.689) -- 0:00:45 237000 -- (-358.880) [-357.048] (-359.630) (-358.417) * [-359.029] (-359.908) (-357.217) (-356.865) -- 0:00:45 237500 -- (-358.625) (-357.337) (-358.186) [-356.481] * (-358.151) (-356.895) [-357.277] (-357.974) -- 0:00:44 238000 -- [-359.361] (-363.613) (-357.429) (-357.688) * (-358.627) (-356.634) (-357.415) [-356.519] -- 0:00:44 238500 -- (-359.613) [-356.887] (-356.452) (-357.885) * [-358.984] (-358.216) (-357.005) (-357.653) -- 0:00:47 239000 -- (-357.867) (-357.367) (-357.402) [-356.250] * (-357.823) (-361.401) [-357.400] (-359.671) -- 0:00:47 239500 -- (-357.736) [-356.235] (-356.737) (-358.963) * (-356.708) (-358.951) [-356.779] (-359.417) -- 0:00:47 240000 -- [-357.810] (-356.915) (-357.007) (-357.784) * (-361.349) (-356.832) [-359.349] (-360.313) -- 0:00:47 Average standard deviation of split frequencies: 0.018390 240500 -- (-357.497) [-357.253] (-357.973) (-358.332) * (-359.683) (-356.869) [-358.745] (-358.305) -- 0:00:47 241000 -- [-357.181] (-358.495) (-359.668) (-358.256) * [-356.954] (-357.234) (-359.325) (-356.820) -- 0:00:47 241500 -- (-357.648) (-358.808) (-360.488) [-356.073] * (-356.303) (-358.795) (-358.983) [-357.746] -- 0:00:47 242000 -- [-359.714] (-357.184) (-357.695) (-358.153) * (-359.146) [-357.497] (-358.161) (-359.891) -- 0:00:46 242500 -- (-357.436) [-360.665] (-357.315) (-358.074) * (-356.149) (-360.934) [-357.477] (-362.344) -- 0:00:46 243000 -- (-360.866) (-358.238) [-356.582] (-357.437) * [-362.148] (-361.863) (-362.286) (-359.706) -- 0:00:46 243500 -- (-356.384) (-359.084) (-358.198) [-357.383] * [-356.927] (-359.727) (-358.553) (-357.507) -- 0:00:46 244000 -- [-356.945] (-361.378) (-357.235) (-359.455) * (-356.662) [-358.118] (-359.883) (-357.629) -- 0:00:46 244500 -- (-358.259) [-359.579] (-357.153) (-357.585) * (-362.678) (-358.464) [-359.076] (-358.191) -- 0:00:46 245000 -- (-358.562) (-357.378) (-357.306) [-357.128] * (-356.272) [-356.772] (-358.170) (-359.047) -- 0:00:46 Average standard deviation of split frequencies: 0.018950 245500 -- (-360.468) (-356.155) [-356.343] (-360.178) * (-356.788) [-359.901] (-358.771) (-356.937) -- 0:00:46 246000 -- (-358.945) (-357.961) [-357.617] (-357.952) * [-357.850] (-359.720) (-356.725) (-360.407) -- 0:00:45 246500 -- (-357.305) [-356.975] (-359.055) (-360.503) * (-357.657) (-360.880) [-357.627] (-357.113) -- 0:00:45 247000 -- (-357.585) (-361.481) (-358.721) [-358.083] * (-358.945) (-357.421) (-357.854) [-356.704] -- 0:00:45 247500 -- (-357.130) (-360.969) (-359.378) [-366.271] * (-359.149) [-358.259] (-358.973) (-356.964) -- 0:00:45 248000 -- (-362.310) [-357.908] (-360.334) (-360.192) * (-356.426) (-359.436) [-359.956] (-356.893) -- 0:00:45 248500 -- (-356.451) [-359.184] (-359.526) (-358.649) * (-360.813) (-357.213) (-358.138) [-359.155] -- 0:00:45 249000 -- [-356.583] (-358.916) (-362.116) (-356.323) * (-360.282) (-360.286) [-359.617] (-359.617) -- 0:00:45 249500 -- (-357.243) [-357.237] (-361.134) (-357.184) * (-360.143) [-359.561] (-359.527) (-359.747) -- 0:00:45 250000 -- [-361.051] (-356.766) (-365.018) (-356.326) * (-359.035) (-356.255) [-357.696] (-357.492) -- 0:00:45 Average standard deviation of split frequencies: 0.018806 250500 -- (-359.339) [-356.498] (-362.276) (-356.841) * (-359.506) (-358.275) [-358.078] (-358.329) -- 0:00:44 251000 -- [-357.296] (-358.344) (-357.182) (-358.999) * (-358.919) (-358.137) [-358.569] (-360.967) -- 0:00:44 251500 -- (-363.195) (-357.954) [-357.622] (-357.501) * (-362.245) (-356.630) (-359.573) [-360.978] -- 0:00:44 252000 -- (-361.578) (-357.927) [-360.250] (-362.444) * (-359.380) (-357.215) (-359.892) [-356.729] -- 0:00:44 252500 -- [-358.633] (-356.925) (-361.819) (-358.495) * (-360.738) (-359.123) [-357.714] (-358.783) -- 0:00:44 253000 -- (-359.913) (-357.298) (-359.600) [-357.070] * [-358.573] (-357.766) (-361.748) (-360.104) -- 0:00:44 253500 -- (-359.261) (-358.871) (-360.180) [-357.583] * [-358.347] (-358.446) (-360.098) (-356.715) -- 0:00:44 254000 -- [-357.119] (-359.867) (-357.866) (-357.987) * (-357.986) [-357.448] (-356.500) (-356.587) -- 0:00:44 254500 -- (-356.348) (-360.441) (-357.276) [-357.689] * (-357.218) (-358.391) [-359.839] (-358.757) -- 0:00:43 255000 -- (-356.551) [-357.629] (-357.553) (-358.794) * [-358.304] (-356.460) (-359.342) (-358.234) -- 0:00:43 Average standard deviation of split frequencies: 0.018210 255500 -- (-357.461) [-357.805] (-362.128) (-359.423) * (-358.731) [-356.781] (-363.928) (-356.750) -- 0:00:46 256000 -- (-356.286) (-359.785) [-357.026] (-359.015) * (-357.731) [-356.988] (-357.450) (-357.010) -- 0:00:46 256500 -- (-358.942) [-358.390] (-356.768) (-360.091) * [-357.226] (-358.719) (-358.013) (-356.490) -- 0:00:46 257000 -- (-356.325) [-358.938] (-358.713) (-360.453) * [-357.264] (-358.510) (-356.784) (-359.610) -- 0:00:46 257500 -- [-358.659] (-359.663) (-358.656) (-359.225) * (-359.673) [-360.937] (-357.771) (-357.498) -- 0:00:46 258000 -- (-358.674) (-361.124) (-357.411) [-357.014] * (-358.984) [-359.959] (-358.759) (-359.067) -- 0:00:46 258500 -- [-357.406] (-357.245) (-362.108) (-364.872) * [-356.299] (-358.009) (-356.825) (-356.794) -- 0:00:45 259000 -- (-356.611) (-359.749) (-356.937) [-357.524] * [-356.381] (-358.680) (-361.137) (-361.784) -- 0:00:45 259500 -- (-357.878) (-360.641) [-357.874] (-360.828) * (-356.435) [-356.476] (-361.944) (-359.557) -- 0:00:45 260000 -- [-358.800] (-360.226) (-360.072) (-363.316) * (-356.668) (-359.534) (-361.405) [-358.939] -- 0:00:45 Average standard deviation of split frequencies: 0.016778 260500 -- (-364.622) [-358.330] (-364.483) (-356.633) * (-356.785) (-357.369) [-356.676] (-362.514) -- 0:00:45 261000 -- (-359.498) (-358.201) [-360.531] (-357.701) * [-357.630] (-362.563) (-359.816) (-358.577) -- 0:00:45 261500 -- (-358.105) (-359.985) [-356.912] (-359.184) * (-357.463) [-357.395] (-358.650) (-362.084) -- 0:00:45 262000 -- [-359.129] (-359.713) (-365.677) (-356.696) * [-359.313] (-357.346) (-357.152) (-361.477) -- 0:00:45 262500 -- [-356.500] (-360.638) (-365.270) (-360.857) * (-357.523) [-356.766] (-356.808) (-358.555) -- 0:00:44 263000 -- (-359.309) [-356.971] (-356.801) (-357.573) * (-358.295) (-357.904) (-357.790) [-358.946] -- 0:00:44 263500 -- (-361.306) (-357.685) (-357.634) [-359.820] * (-356.066) (-357.947) (-358.784) [-358.248] -- 0:00:44 264000 -- (-357.454) (-357.071) (-359.161) [-356.455] * (-357.697) [-360.612] (-361.181) (-357.899) -- 0:00:44 264500 -- (-361.308) [-357.622] (-359.141) (-358.066) * [-358.054] (-360.480) (-357.432) (-361.312) -- 0:00:44 265000 -- (-358.294) [-358.479] (-357.144) (-357.595) * (-363.703) [-357.378] (-359.782) (-357.198) -- 0:00:44 Average standard deviation of split frequencies: 0.017230 265500 -- (-357.385) (-361.445) [-356.686] (-358.399) * (-364.911) (-358.828) (-358.547) [-357.097] -- 0:00:44 266000 -- (-358.814) [-357.173] (-357.173) (-358.826) * (-357.533) (-364.200) (-361.114) [-356.977] -- 0:00:44 266500 -- (-357.540) (-358.638) (-356.924) [-359.020] * [-358.512] (-361.427) (-356.600) (-356.911) -- 0:00:44 267000 -- (-356.776) [-363.504] (-358.327) (-361.222) * (-359.066) [-360.715] (-359.635) (-357.000) -- 0:00:43 267500 -- [-360.411] (-358.037) (-360.012) (-359.026) * (-357.377) (-357.374) (-359.000) [-361.377] -- 0:00:43 268000 -- (-362.551) (-363.803) [-357.021] (-356.902) * [-356.206] (-358.922) (-359.257) (-363.172) -- 0:00:43 268500 -- (-359.391) (-360.486) [-361.685] (-357.116) * [-357.565] (-359.366) (-363.126) (-357.836) -- 0:00:43 269000 -- [-356.917] (-360.085) (-357.802) (-357.450) * (-357.957) [-357.281] (-365.658) (-359.723) -- 0:00:43 269500 -- (-356.508) (-359.243) (-360.737) [-357.305] * (-356.843) (-359.124) (-358.376) [-357.885] -- 0:00:43 270000 -- [-358.247] (-357.463) (-357.052) (-357.253) * (-356.628) [-357.237] (-359.387) (-358.371) -- 0:00:43 Average standard deviation of split frequencies: 0.017724 270500 -- (-356.300) [-356.271] (-358.113) (-356.771) * [-356.624] (-357.495) (-356.762) (-358.121) -- 0:00:43 271000 -- [-360.272] (-356.716) (-356.752) (-358.698) * [-356.373] (-357.910) (-357.033) (-356.598) -- 0:00:43 271500 -- (-357.404) [-359.584] (-356.897) (-359.959) * [-356.844] (-357.396) (-356.957) (-358.768) -- 0:00:42 272000 -- [-357.424] (-357.853) (-355.945) (-357.385) * [-358.836] (-356.322) (-358.566) (-361.051) -- 0:00:45 272500 -- (-357.880) [-358.400] (-357.018) (-357.343) * (-360.373) (-358.659) [-361.262] (-362.364) -- 0:00:45 273000 -- (-358.036) (-356.979) (-357.294) [-358.096] * (-359.408) (-366.351) [-357.222] (-358.759) -- 0:00:45 273500 -- (-359.206) (-356.787) (-363.568) [-358.234] * (-357.145) (-358.989) (-358.784) [-358.417] -- 0:00:45 274000 -- (-357.080) [-359.315] (-364.223) (-356.504) * [-356.805] (-359.102) (-361.634) (-357.936) -- 0:00:45 274500 -- [-358.745] (-361.607) (-361.411) (-362.782) * [-357.880] (-359.476) (-360.109) (-359.264) -- 0:00:44 275000 -- [-358.803] (-363.021) (-359.012) (-356.722) * [-357.676] (-358.140) (-359.122) (-359.918) -- 0:00:44 Average standard deviation of split frequencies: 0.018386 275500 -- [-360.950] (-358.026) (-357.614) (-357.909) * [-356.991] (-357.462) (-357.614) (-358.215) -- 0:00:44 276000 -- (-356.747) (-357.287) [-359.330] (-357.184) * (-358.911) (-359.088) (-358.329) [-356.398] -- 0:00:44 276500 -- [-356.223] (-357.504) (-357.859) (-357.668) * (-359.031) (-360.190) [-359.416] (-356.704) -- 0:00:44 277000 -- (-358.549) (-360.073) [-357.143] (-359.878) * (-361.668) (-361.490) [-360.133] (-359.912) -- 0:00:44 277500 -- (-359.105) [-358.628] (-358.808) (-357.377) * [-357.403] (-357.562) (-358.203) (-362.060) -- 0:00:44 278000 -- (-357.972) [-356.984] (-358.158) (-358.948) * (-360.935) (-365.053) (-360.818) [-356.806] -- 0:00:44 278500 -- (-357.078) [-360.286] (-358.190) (-357.901) * [-358.311] (-360.002) (-371.420) (-361.053) -- 0:00:44 279000 -- (-356.651) (-359.990) [-359.229] (-357.895) * (-360.202) (-357.654) (-359.710) [-358.333] -- 0:00:43 279500 -- (-357.633) (-363.464) [-360.402] (-357.240) * (-357.482) (-358.948) [-359.733] (-360.664) -- 0:00:43 280000 -- (-358.162) (-357.227) [-359.258] (-356.799) * (-357.987) (-357.049) [-358.108] (-359.409) -- 0:00:43 Average standard deviation of split frequencies: 0.017846 280500 -- [-359.253] (-357.563) (-359.396) (-359.368) * [-359.853] (-358.594) (-358.288) (-357.754) -- 0:00:43 281000 -- [-358.763] (-360.786) (-362.498) (-360.446) * (-359.586) (-360.905) (-361.433) [-357.802] -- 0:00:43 281500 -- (-359.671) (-359.895) [-358.513] (-361.055) * (-358.002) (-357.260) (-359.232) [-357.581] -- 0:00:43 282000 -- [-363.604] (-362.202) (-358.703) (-365.530) * (-358.749) (-359.893) (-357.320) [-356.331] -- 0:00:43 282500 -- (-358.907) [-360.370] (-361.410) (-361.307) * [-358.333] (-361.014) (-358.252) (-359.683) -- 0:00:43 283000 -- [-356.361] (-358.636) (-357.102) (-356.492) * (-357.478) (-360.442) [-356.292] (-357.872) -- 0:00:43 283500 -- [-359.872] (-361.859) (-358.460) (-360.399) * (-358.986) (-360.641) (-357.013) [-357.544] -- 0:00:42 284000 -- (-359.787) [-360.227] (-359.189) (-357.331) * (-357.035) (-356.538) (-357.919) [-357.728] -- 0:00:42 284500 -- (-357.697) (-359.456) (-357.173) [-357.825] * (-358.740) (-363.201) [-357.678] (-356.973) -- 0:00:42 285000 -- [-361.089] (-363.296) (-357.543) (-356.634) * [-358.967] (-358.530) (-356.309) (-357.539) -- 0:00:42 Average standard deviation of split frequencies: 0.016580 285500 -- [-359.404] (-361.016) (-357.530) (-357.491) * (-360.388) [-357.122] (-358.402) (-361.053) -- 0:00:42 286000 -- [-358.347] (-356.892) (-360.389) (-359.525) * (-359.918) [-356.703] (-357.628) (-360.496) -- 0:00:42 286500 -- (-362.588) [-357.338] (-365.667) (-360.263) * (-356.440) [-362.771] (-359.588) (-359.321) -- 0:00:42 287000 -- (-358.483) (-361.467) [-357.348] (-365.076) * (-357.544) (-358.605) [-358.879] (-358.358) -- 0:00:42 287500 -- (-358.205) (-363.838) [-357.998] (-364.319) * [-359.679] (-359.431) (-358.759) (-357.990) -- 0:00:42 288000 -- (-357.083) [-358.816] (-357.713) (-358.554) * (-364.686) (-357.535) [-357.162] (-361.872) -- 0:00:42 288500 -- (-358.260) (-362.469) [-359.179] (-360.278) * (-358.664) [-359.562] (-362.394) (-358.503) -- 0:00:41 289000 -- (-356.348) (-357.523) [-357.340] (-360.040) * [-358.217] (-361.931) (-361.510) (-358.713) -- 0:00:44 289500 -- (-358.086) (-360.919) [-356.946] (-357.900) * [-356.907] (-361.465) (-358.148) (-359.212) -- 0:00:44 290000 -- (-357.217) (-359.779) (-359.013) [-357.170] * (-357.823) [-359.633] (-358.652) (-360.344) -- 0:00:44 Average standard deviation of split frequencies: 0.016027 290500 -- [-357.536] (-356.369) (-361.164) (-356.800) * (-360.855) (-357.916) [-359.479] (-360.367) -- 0:00:43 291000 -- [-363.266] (-361.365) (-362.434) (-359.885) * (-360.921) (-356.771) (-358.010) [-362.135] -- 0:00:43 291500 -- (-361.131) (-360.646) [-362.985] (-367.695) * (-360.522) (-359.318) [-359.550] (-356.359) -- 0:00:43 292000 -- (-358.815) [-359.159] (-364.134) (-358.428) * (-361.689) [-358.080] (-361.022) (-357.308) -- 0:00:43 292500 -- (-357.822) (-357.019) (-359.697) [-361.140] * [-356.585] (-360.892) (-359.073) (-357.686) -- 0:00:43 293000 -- (-358.713) (-360.166) [-356.945] (-358.217) * (-357.609) (-361.246) (-356.968) [-358.351] -- 0:00:43 293500 -- (-358.288) [-362.756] (-358.833) (-356.997) * [-356.768] (-362.986) (-359.651) (-357.793) -- 0:00:43 294000 -- (-356.471) (-358.600) [-360.383] (-361.121) * (-356.100) (-359.608) (-365.752) [-359.666] -- 0:00:43 294500 -- [-357.529] (-357.654) (-357.639) (-357.247) * [-358.950] (-363.603) (-366.480) (-358.895) -- 0:00:43 295000 -- (-358.218) [-361.302] (-360.432) (-359.426) * (-357.013) (-357.830) [-360.748] (-357.346) -- 0:00:43 Average standard deviation of split frequencies: 0.016956 295500 -- (-359.984) [-358.534] (-360.566) (-364.210) * (-360.948) (-358.980) [-356.866] (-358.909) -- 0:00:42 296000 -- (-359.725) [-359.700] (-358.957) (-360.986) * (-359.060) [-357.048] (-362.389) (-359.058) -- 0:00:42 296500 -- [-359.088] (-361.384) (-361.556) (-365.887) * (-355.995) (-358.030) (-357.108) [-359.118] -- 0:00:42 297000 -- (-358.293) (-356.177) (-357.456) [-363.777] * [-356.862] (-359.977) (-357.729) (-358.815) -- 0:00:42 297500 -- (-362.236) (-356.693) (-357.719) [-363.290] * (-357.825) (-361.461) (-356.517) [-357.941] -- 0:00:42 298000 -- [-357.157] (-357.903) (-360.785) (-359.436) * (-357.110) (-357.721) [-358.665] (-362.139) -- 0:00:42 298500 -- [-357.118] (-358.624) (-357.374) (-358.217) * (-360.226) (-358.867) [-357.051] (-357.107) -- 0:00:42 299000 -- [-360.923] (-359.592) (-358.076) (-357.122) * (-358.725) [-360.232] (-359.514) (-358.874) -- 0:00:42 299500 -- (-357.595) (-365.798) (-360.412) [-356.530] * (-357.712) (-357.471) (-356.345) [-359.274] -- 0:00:42 300000 -- [-356.791] (-360.672) (-358.910) (-361.828) * (-359.015) (-357.046) (-356.810) [-361.139] -- 0:00:42 Average standard deviation of split frequencies: 0.017149 300500 -- [-357.672] (-361.575) (-361.091) (-357.083) * (-361.002) (-360.341) [-357.289] (-363.056) -- 0:00:41 301000 -- (-359.935) (-357.641) [-362.829] (-359.106) * (-361.073) (-362.851) [-358.063] (-361.708) -- 0:00:41 301500 -- (-360.807) (-359.657) (-364.608) [-357.922] * [-359.037] (-359.272) (-358.459) (-357.440) -- 0:00:41 302000 -- (-359.349) (-357.084) (-364.798) [-357.863] * (-360.005) (-359.538) (-357.680) [-357.267] -- 0:00:41 302500 -- (-359.400) [-357.477] (-359.946) (-356.865) * [-356.164] (-359.430) (-357.469) (-357.582) -- 0:00:41 303000 -- (-359.020) [-359.562] (-359.232) (-356.210) * (-358.581) (-360.240) (-360.106) [-356.539] -- 0:00:41 303500 -- [-360.432] (-358.561) (-359.301) (-356.291) * (-357.150) (-362.031) (-358.486) [-357.911] -- 0:00:41 304000 -- (-363.319) (-358.040) (-357.313) [-359.670] * (-357.699) (-360.775) [-361.153] (-358.401) -- 0:00:41 304500 -- [-363.868] (-357.915) (-359.701) (-359.889) * (-357.919) [-358.007] (-357.089) (-357.623) -- 0:00:41 305000 -- (-358.123) (-356.776) [-357.117] (-357.746) * [-357.137] (-358.091) (-357.067) (-357.419) -- 0:00:41 Average standard deviation of split frequencies: 0.016272 305500 -- (-357.273) (-360.988) [-359.136] (-356.896) * [-359.402] (-357.750) (-362.164) (-357.915) -- 0:00:40 306000 -- (-356.630) [-359.716] (-359.823) (-357.161) * (-357.098) (-360.281) [-358.177] (-357.517) -- 0:00:43 306500 -- (-356.385) (-357.868) (-358.619) [-356.673] * (-356.998) (-361.404) (-358.518) [-356.854] -- 0:00:42 307000 -- (-361.076) (-357.890) (-356.937) [-358.767] * (-356.563) [-357.461] (-357.427) (-357.604) -- 0:00:42 307500 -- (-360.107) [-357.968] (-358.275) (-356.032) * (-357.321) [-359.780] (-356.150) (-363.673) -- 0:00:42 308000 -- (-357.235) (-360.568) [-359.395] (-367.482) * (-358.257) (-358.209) (-356.588) [-362.855] -- 0:00:42 308500 -- (-357.791) (-359.953) [-358.307] (-364.242) * (-363.157) (-359.016) (-356.093) [-356.370] -- 0:00:42 309000 -- (-360.959) [-359.256] (-358.073) (-358.909) * [-358.171] (-356.800) (-356.940) (-361.209) -- 0:00:42 309500 -- (-356.821) [-356.964] (-358.028) (-358.406) * (-360.594) (-356.591) [-357.018] (-365.268) -- 0:00:42 310000 -- [-357.865] (-357.779) (-357.183) (-357.169) * (-359.040) [-359.757] (-362.045) (-357.874) -- 0:00:42 Average standard deviation of split frequencies: 0.015263 310500 -- [-359.312] (-361.116) (-359.528) (-359.125) * (-360.450) (-356.084) [-360.606] (-358.383) -- 0:00:42 311000 -- (-357.977) (-357.730) [-357.866] (-358.259) * (-357.908) [-356.623] (-360.741) (-357.728) -- 0:00:42 311500 -- [-359.286] (-357.258) (-360.087) (-359.115) * (-357.400) (-356.742) (-357.998) [-358.846] -- 0:00:41 312000 -- [-356.938] (-357.589) (-363.411) (-360.404) * [-363.414] (-361.171) (-358.322) (-357.141) -- 0:00:41 312500 -- [-357.452] (-358.210) (-361.825) (-357.564) * (-360.027) (-360.609) [-358.583] (-360.928) -- 0:00:41 313000 -- [-357.722] (-358.407) (-366.067) (-357.839) * (-362.380) [-356.293] (-359.031) (-361.225) -- 0:00:41 313500 -- (-359.406) (-357.353) [-367.915] (-356.190) * (-358.656) [-357.702] (-359.780) (-359.927) -- 0:00:41 314000 -- [-356.506] (-356.568) (-363.200) (-358.549) * [-358.343] (-358.131) (-357.415) (-358.635) -- 0:00:41 314500 -- [-359.673] (-362.010) (-360.525) (-356.144) * (-357.169) (-361.752) (-363.293) [-357.873] -- 0:00:41 315000 -- (-357.393) (-359.224) (-357.874) [-357.284] * (-356.359) (-359.309) (-360.842) [-359.041] -- 0:00:41 Average standard deviation of split frequencies: 0.014479 315500 -- (-359.553) [-359.840] (-358.254) (-355.974) * [-356.026] (-361.207) (-361.081) (-362.664) -- 0:00:41 316000 -- (-360.044) (-360.018) [-358.757] (-356.717) * [-357.131] (-361.569) (-362.063) (-358.053) -- 0:00:41 316500 -- (-361.074) [-359.908] (-359.846) (-357.474) * (-357.303) (-357.080) [-360.404] (-357.882) -- 0:00:41 317000 -- (-359.468) (-361.435) (-356.861) [-357.886] * (-360.471) [-357.235] (-363.024) (-358.189) -- 0:00:40 317500 -- (-358.751) (-360.512) (-358.292) [-359.771] * (-359.533) (-357.720) (-358.940) [-358.841] -- 0:00:40 318000 -- (-358.449) (-358.527) [-357.554] (-361.762) * (-361.410) [-357.996] (-357.780) (-359.474) -- 0:00:40 318500 -- (-360.602) (-358.808) (-357.558) [-356.985] * [-359.421] (-359.070) (-357.742) (-358.526) -- 0:00:40 319000 -- (-361.303) (-357.763) (-358.818) [-358.807] * (-362.942) (-360.738) [-358.138] (-359.460) -- 0:00:40 319500 -- (-358.633) (-359.627) (-362.266) [-359.863] * [-360.588] (-358.322) (-357.001) (-361.685) -- 0:00:40 320000 -- [-360.411] (-358.540) (-361.165) (-360.718) * (-358.023) [-358.012] (-356.943) (-359.593) -- 0:00:40 Average standard deviation of split frequencies: 0.013058 320500 -- (-361.901) [-357.720] (-357.641) (-358.721) * (-360.316) [-361.251] (-357.883) (-359.517) -- 0:00:40 321000 -- (-358.338) (-358.319) (-357.622) [-357.430] * [-359.906] (-359.083) (-359.400) (-357.237) -- 0:00:40 321500 -- [-358.700] (-357.311) (-356.051) (-359.525) * (-358.041) [-357.880] (-359.694) (-358.825) -- 0:00:40 322000 -- [-357.299] (-357.102) (-357.029) (-357.649) * [-356.747] (-357.296) (-359.449) (-365.770) -- 0:00:40 322500 -- [-356.935] (-357.025) (-360.010) (-358.215) * [-356.768] (-360.630) (-361.010) (-359.935) -- 0:00:39 323000 -- (-356.604) (-358.640) [-357.379] (-361.632) * [-357.136] (-359.843) (-357.457) (-360.572) -- 0:00:41 323500 -- [-357.852] (-360.933) (-357.803) (-360.245) * (-357.673) [-360.638] (-356.267) (-360.719) -- 0:00:41 324000 -- (-356.979) (-361.139) [-356.268] (-360.356) * (-358.166) [-364.094] (-356.536) (-360.546) -- 0:00:41 324500 -- (-361.338) (-358.252) [-358.094] (-358.353) * (-356.738) (-360.609) [-357.410] (-358.960) -- 0:00:41 325000 -- (-356.946) (-356.554) [-357.732] (-357.147) * (-357.251) (-358.600) [-356.079] (-358.897) -- 0:00:41 Average standard deviation of split frequencies: 0.011398 325500 -- [-358.201] (-358.590) (-357.794) (-357.885) * [-359.705] (-357.596) (-356.113) (-357.577) -- 0:00:41 326000 -- (-359.180) (-358.944) (-356.776) [-360.692] * (-362.901) [-357.072] (-357.630) (-358.523) -- 0:00:41 326500 -- (-357.849) (-358.327) (-358.965) [-363.309] * (-358.011) [-358.674] (-361.853) (-358.845) -- 0:00:41 327000 -- (-356.729) (-357.390) (-357.065) [-359.415] * (-356.421) [-357.966] (-357.145) (-357.668) -- 0:00:41 327500 -- (-356.792) (-356.523) [-358.405] (-357.759) * (-357.731) (-357.922) (-357.747) [-357.687] -- 0:00:41 328000 -- (-357.194) (-359.403) (-357.644) [-358.115] * (-357.568) (-359.308) [-357.795] (-359.877) -- 0:00:40 328500 -- (-357.346) (-359.895) (-358.088) [-362.509] * (-359.520) (-356.848) [-356.692] (-357.012) -- 0:00:40 329000 -- (-358.780) (-360.085) (-358.050) [-357.472] * (-359.315) (-356.898) (-359.530) [-356.115] -- 0:00:40 329500 -- (-358.933) [-360.829] (-356.746) (-356.662) * [-358.665] (-356.909) (-357.125) (-357.803) -- 0:00:40 330000 -- (-357.430) (-357.829) [-361.230] (-356.599) * [-357.861] (-357.692) (-359.142) (-356.147) -- 0:00:40 Average standard deviation of split frequencies: 0.012296 330500 -- (-358.742) (-357.495) [-360.886] (-357.069) * (-357.890) [-356.947] (-359.761) (-358.892) -- 0:00:40 331000 -- [-358.776] (-356.676) (-356.533) (-357.172) * (-357.033) (-358.550) [-357.294] (-358.225) -- 0:00:40 331500 -- (-359.303) (-357.435) [-358.273] (-357.112) * (-357.758) (-357.588) (-359.577) [-357.956] -- 0:00:40 332000 -- (-359.485) (-359.731) (-360.634) [-357.121] * (-360.880) (-359.114) [-358.086] (-362.849) -- 0:00:40 332500 -- (-358.168) [-359.216] (-356.387) (-361.517) * (-358.905) (-358.224) [-359.544] (-359.727) -- 0:00:40 333000 -- [-358.058] (-359.171) (-357.169) (-356.964) * (-356.708) (-359.358) (-358.194) [-360.244] -- 0:00:40 333500 -- (-358.881) (-361.421) [-358.304] (-357.201) * (-359.593) (-360.367) [-358.311] (-361.894) -- 0:00:39 334000 -- (-358.599) (-358.877) (-357.692) [-358.238] * (-358.997) (-356.763) [-359.350] (-360.142) -- 0:00:39 334500 -- (-357.174) (-359.504) (-358.290) [-356.916] * (-359.582) [-357.725] (-357.905) (-358.360) -- 0:00:39 335000 -- [-359.428] (-357.073) (-358.002) (-359.490) * (-356.852) (-361.062) (-356.657) [-356.667] -- 0:00:39 Average standard deviation of split frequencies: 0.013535 335500 -- (-359.191) (-359.716) (-359.269) [-359.153] * (-358.200) (-357.747) [-357.528] (-359.177) -- 0:00:39 336000 -- [-356.594] (-365.735) (-357.450) (-359.325) * (-359.167) (-360.044) [-357.011] (-366.300) -- 0:00:39 336500 -- (-356.477) [-356.546] (-356.715) (-357.863) * (-359.437) [-357.523] (-359.867) (-360.801) -- 0:00:39 337000 -- (-361.509) (-358.249) [-356.885] (-357.674) * [-360.808] (-358.654) (-360.166) (-362.232) -- 0:00:39 337500 -- (-356.604) (-356.547) (-357.313) [-356.994] * (-357.378) [-357.908] (-358.002) (-358.134) -- 0:00:39 338000 -- (-359.410) (-357.200) [-358.699] (-357.830) * (-359.280) (-356.683) (-359.494) [-357.414] -- 0:00:39 338500 -- (-361.494) [-356.445] (-357.257) (-361.716) * (-360.160) (-358.790) [-360.262] (-356.596) -- 0:00:39 339000 -- [-356.945] (-361.668) (-358.043) (-358.845) * (-364.318) (-360.350) [-359.053] (-356.389) -- 0:00:38 339500 -- [-357.568] (-358.823) (-360.178) (-359.176) * (-358.624) (-357.054) (-358.904) [-360.552] -- 0:00:38 340000 -- (-359.897) (-356.682) [-358.529] (-357.692) * (-356.728) (-358.766) [-356.910] (-360.124) -- 0:00:38 Average standard deviation of split frequencies: 0.013838 340500 -- (-358.406) (-359.035) (-360.347) [-357.962] * (-360.164) (-360.171) (-358.692) [-357.518] -- 0:00:40 341000 -- (-361.779) (-359.518) [-361.000] (-358.327) * (-358.642) [-358.376] (-357.149) (-356.556) -- 0:00:40 341500 -- [-359.611] (-358.023) (-358.372) (-357.463) * (-357.212) (-357.373) (-356.731) [-356.879] -- 0:00:40 342000 -- (-362.163) (-358.381) [-356.239] (-358.341) * (-357.838) [-357.396] (-357.806) (-357.292) -- 0:00:40 342500 -- (-357.044) (-357.518) (-358.489) [-359.581] * (-357.201) (-360.117) [-357.470] (-358.509) -- 0:00:40 343000 -- [-358.216] (-358.065) (-362.149) (-359.667) * [-356.252] (-356.910) (-357.105) (-357.614) -- 0:00:40 343500 -- (-358.960) [-362.900] (-361.457) (-357.032) * [-357.895] (-361.181) (-365.208) (-357.259) -- 0:00:40 344000 -- [-359.609] (-362.207) (-361.349) (-357.000) * (-357.092) (-358.815) [-361.144] (-357.775) -- 0:00:40 344500 -- (-357.797) (-357.710) [-357.774] (-359.861) * (-359.449) (-359.415) (-357.921) [-356.115] -- 0:00:39 345000 -- (-358.108) (-362.816) [-356.839] (-362.140) * [-358.404] (-359.105) (-357.059) (-358.671) -- 0:00:39 Average standard deviation of split frequencies: 0.014105 345500 -- (-356.530) (-358.167) [-357.826] (-356.748) * (-360.074) (-357.623) [-356.510] (-362.473) -- 0:00:39 346000 -- (-359.629) (-360.055) (-360.492) [-358.588] * (-357.387) [-357.998] (-359.204) (-360.834) -- 0:00:39 346500 -- (-357.018) [-359.820] (-357.405) (-358.595) * [-359.513] (-358.677) (-357.985) (-357.818) -- 0:00:39 347000 -- (-357.805) [-357.524] (-356.368) (-361.081) * (-359.530) (-359.832) [-357.327] (-358.294) -- 0:00:39 347500 -- (-358.727) (-358.317) [-356.272] (-359.497) * (-356.726) [-357.749] (-358.263) (-361.929) -- 0:00:39 348000 -- (-358.153) [-359.490] (-356.344) (-361.704) * [-356.896] (-357.621) (-356.205) (-363.101) -- 0:00:39 348500 -- (-357.662) (-359.482) (-356.673) [-356.681] * (-362.453) (-360.670) [-359.000] (-359.585) -- 0:00:39 349000 -- (-356.581) (-358.880) [-357.759] (-358.671) * [-359.486] (-359.857) (-363.903) (-361.282) -- 0:00:39 349500 -- (-356.540) [-364.389] (-356.140) (-359.264) * (-358.605) (-357.901) (-360.677) [-356.268] -- 0:00:39 350000 -- (-356.737) (-360.297) [-360.911] (-357.750) * (-358.553) (-362.678) (-358.543) [-357.071] -- 0:00:39 Average standard deviation of split frequencies: 0.013918 350500 -- (-358.629) (-358.512) (-360.670) [-357.505] * [-357.046] (-358.839) (-358.075) (-358.608) -- 0:00:38 351000 -- (-356.296) (-358.867) (-361.137) [-358.249] * (-357.501) (-358.271) (-360.799) [-359.431] -- 0:00:38 351500 -- [-360.449] (-362.235) (-358.576) (-358.855) * (-357.258) (-359.771) (-360.866) [-358.448] -- 0:00:38 352000 -- (-364.077) (-363.447) [-360.479] (-357.484) * (-357.978) (-357.435) [-358.572] (-360.173) -- 0:00:38 352500 -- (-360.120) (-365.466) [-359.602] (-357.567) * (-358.941) [-356.272] (-357.653) (-357.959) -- 0:00:38 353000 -- (-364.999) (-358.942) [-358.270] (-356.305) * (-362.281) (-358.633) (-363.219) [-358.238] -- 0:00:38 353500 -- [-358.132] (-361.772) (-356.825) (-362.068) * (-357.024) [-356.826] (-358.592) (-361.754) -- 0:00:38 354000 -- [-358.083] (-360.074) (-360.913) (-358.099) * [-359.649] (-359.027) (-359.383) (-359.235) -- 0:00:38 354500 -- (-357.193) (-360.200) (-359.257) [-357.204] * (-358.683) [-356.626] (-361.563) (-363.357) -- 0:00:38 355000 -- (-357.590) (-359.657) (-360.874) [-358.256] * (-358.549) (-357.337) (-358.484) [-358.458] -- 0:00:38 Average standard deviation of split frequencies: 0.013987 355500 -- (-358.546) (-357.521) (-359.189) [-361.679] * (-358.694) [-360.246] (-356.837) (-358.522) -- 0:00:38 356000 -- (-356.994) [-358.410] (-363.963) (-357.885) * (-358.504) (-359.570) (-356.162) [-360.180] -- 0:00:37 356500 -- (-359.236) (-363.268) [-358.709] (-357.384) * (-359.087) (-360.977) [-358.022] (-359.678) -- 0:00:37 357000 -- [-360.135] (-359.258) (-357.092) (-360.274) * (-361.937) (-356.826) [-359.940] (-358.602) -- 0:00:37 357500 -- (-358.775) (-361.377) (-358.057) [-356.069] * (-356.960) (-356.674) (-357.041) [-356.582] -- 0:00:39 358000 -- [-359.227] (-359.022) (-360.127) (-358.970) * (-358.707) (-358.921) [-356.839] (-358.464) -- 0:00:39 358500 -- (-358.712) [-356.655] (-364.522) (-357.699) * (-357.178) [-357.861] (-357.171) (-356.820) -- 0:00:39 359000 -- (-359.667) [-356.320] (-360.664) (-358.162) * [-357.400] (-358.049) (-359.990) (-363.012) -- 0:00:39 359500 -- (-359.422) (-359.929) [-358.193] (-357.207) * [-360.000] (-358.881) (-363.373) (-359.328) -- 0:00:39 360000 -- (-361.693) [-358.510] (-360.090) (-357.494) * (-357.801) (-358.920) [-359.056] (-357.409) -- 0:00:39 Average standard deviation of split frequencies: 0.013532 360500 -- (-365.461) [-357.659] (-359.076) (-358.267) * [-356.340] (-361.806) (-358.258) (-362.427) -- 0:00:39 361000 -- (-359.629) (-357.738) (-360.479) [-357.813] * [-356.950] (-359.843) (-357.747) (-356.956) -- 0:00:38 361500 -- (-357.821) (-357.868) [-360.283] (-360.212) * (-359.204) (-359.458) [-356.363] (-357.437) -- 0:00:38 362000 -- (-357.003) (-357.215) [-358.778] (-361.186) * (-359.698) (-357.197) (-356.293) [-359.247] -- 0:00:38 362500 -- (-359.309) (-356.077) (-356.593) [-358.960] * (-361.394) (-357.997) [-356.848] (-358.513) -- 0:00:38 363000 -- (-357.719) [-356.021] (-357.362) (-357.930) * (-357.087) (-356.289) [-358.242] (-357.850) -- 0:00:38 363500 -- (-361.249) (-358.448) [-359.076] (-357.691) * (-357.667) [-357.243] (-356.939) (-356.987) -- 0:00:38 364000 -- (-356.353) (-357.223) [-359.485] (-358.128) * (-361.541) [-359.296] (-356.993) (-358.732) -- 0:00:38 364500 -- (-356.693) (-358.466) (-361.284) [-358.305] * [-365.506] (-360.049) (-360.129) (-358.444) -- 0:00:38 365000 -- (-360.899) (-359.193) (-359.222) [-357.826] * (-363.997) (-360.101) [-356.918] (-358.256) -- 0:00:38 Average standard deviation of split frequencies: 0.013486 365500 -- (-361.900) (-356.436) [-359.707] (-356.520) * (-363.602) (-357.568) [-357.332] (-356.485) -- 0:00:38 366000 -- (-355.993) (-360.387) (-357.836) [-358.375] * (-358.411) (-358.372) (-357.303) [-359.409] -- 0:00:38 366500 -- (-356.254) [-358.018] (-357.301) (-357.790) * (-357.288) (-358.895) [-357.435] (-358.219) -- 0:00:38 367000 -- (-358.363) (-357.642) (-356.148) [-360.163] * (-356.623) [-356.580] (-359.677) (-360.292) -- 0:00:37 367500 -- (-357.619) [-358.639] (-359.114) (-357.781) * (-357.423) [-358.273] (-363.585) (-357.982) -- 0:00:37 368000 -- (-363.151) (-360.221) [-356.882] (-357.459) * [-360.349] (-357.472) (-360.212) (-359.137) -- 0:00:37 368500 -- (-358.748) (-359.785) [-359.019] (-357.407) * (-359.383) [-358.092] (-358.330) (-357.923) -- 0:00:37 369000 -- [-357.839] (-358.739) (-359.526) (-361.277) * (-359.956) (-357.232) [-358.336] (-359.825) -- 0:00:37 369500 -- (-358.663) (-358.709) (-359.871) [-356.905] * [-358.749] (-357.273) (-359.160) (-358.893) -- 0:00:37 370000 -- [-357.285] (-356.355) (-358.311) (-356.905) * [-357.800] (-360.397) (-358.068) (-359.415) -- 0:00:37 Average standard deviation of split frequencies: 0.015977 370500 -- (-360.653) (-356.613) (-357.025) [-356.449] * (-359.267) [-360.220] (-358.577) (-356.760) -- 0:00:37 371000 -- [-360.311] (-359.705) (-359.399) (-356.837) * [-357.460] (-357.527) (-358.797) (-356.598) -- 0:00:37 371500 -- [-356.093] (-359.275) (-358.550) (-358.995) * (-358.808) (-364.964) [-357.905] (-358.016) -- 0:00:37 372000 -- (-356.818) (-365.090) (-357.444) [-356.775] * (-358.788) (-360.621) [-357.077] (-358.944) -- 0:00:37 372500 -- [-356.547] (-359.919) (-360.118) (-357.919) * [-361.109] (-357.080) (-356.774) (-358.513) -- 0:00:37 373000 -- (-356.670) (-357.044) (-359.850) [-360.092] * (-358.022) [-356.735] (-358.522) (-358.930) -- 0:00:36 373500 -- (-358.057) [-358.510] (-359.765) (-360.823) * [-357.042] (-356.867) (-360.174) (-363.077) -- 0:00:36 374000 -- (-356.981) (-360.885) [-358.671] (-358.930) * (-363.409) [-356.846] (-359.943) (-363.217) -- 0:00:36 374500 -- [-358.235] (-357.050) (-359.934) (-357.385) * (-357.770) [-358.516] (-356.756) (-358.718) -- 0:00:38 375000 -- (-357.761) [-360.041] (-358.119) (-359.708) * [-358.322] (-361.012) (-360.921) (-360.963) -- 0:00:38 Average standard deviation of split frequencies: 0.014381 375500 -- [-357.654] (-359.836) (-358.159) (-359.306) * (-357.803) (-356.876) [-356.470] (-358.354) -- 0:00:38 376000 -- [-360.102] (-356.948) (-360.649) (-357.630) * (-357.390) (-356.030) [-358.321] (-361.284) -- 0:00:38 376500 -- (-358.785) [-357.370] (-357.190) (-368.932) * (-359.687) [-356.550] (-358.545) (-358.814) -- 0:00:38 377000 -- (-358.702) [-358.753] (-357.989) (-361.535) * [-357.568] (-357.885) (-364.796) (-359.021) -- 0:00:38 377500 -- (-358.456) (-359.345) (-357.099) [-357.938] * [-360.298] (-359.677) (-358.760) (-357.119) -- 0:00:37 378000 -- (-356.915) (-360.833) [-358.270] (-356.499) * (-360.977) [-357.702] (-356.667) (-358.999) -- 0:00:37 378500 -- (-358.043) (-357.747) (-359.540) [-359.241] * (-356.809) (-358.698) (-358.395) [-358.337] -- 0:00:37 379000 -- [-357.254] (-358.502) (-358.626) (-357.646) * (-360.788) (-359.178) [-358.697] (-359.742) -- 0:00:37 379500 -- [-356.191] (-357.747) (-357.432) (-359.242) * (-358.417) (-357.023) (-359.018) [-361.214] -- 0:00:37 380000 -- [-356.899] (-360.841) (-357.614) (-359.760) * [-357.779] (-356.883) (-358.186) (-358.881) -- 0:00:37 Average standard deviation of split frequencies: 0.014654 380500 -- (-357.048) (-358.575) (-359.474) [-360.539] * (-357.402) (-359.036) [-361.027] (-356.427) -- 0:00:37 381000 -- (-358.424) [-358.194] (-356.332) (-359.112) * [-359.891] (-361.496) (-359.209) (-356.710) -- 0:00:37 381500 -- (-357.652) [-360.126] (-358.817) (-359.597) * [-360.658] (-356.393) (-359.030) (-356.562) -- 0:00:37 382000 -- (-362.790) [-356.773] (-360.110) (-358.110) * [-358.029] (-362.999) (-359.275) (-359.111) -- 0:00:37 382500 -- [-356.613] (-361.084) (-359.905) (-358.661) * (-358.666) [-358.372] (-360.723) (-362.969) -- 0:00:37 383000 -- (-357.999) (-358.454) (-357.192) [-357.337] * (-358.117) (-357.230) [-361.922] (-356.697) -- 0:00:37 383500 -- (-358.917) (-362.417) (-358.782) [-356.687] * (-357.193) (-358.481) [-360.389] (-356.658) -- 0:00:36 384000 -- (-358.588) [-358.675] (-359.032) (-357.794) * [-357.730] (-359.075) (-356.739) (-358.147) -- 0:00:36 384500 -- [-357.010] (-357.999) (-359.859) (-358.415) * (-359.265) (-357.991) [-359.725] (-357.362) -- 0:00:36 385000 -- (-360.002) (-358.037) [-357.938] (-357.096) * [-358.094] (-358.126) (-357.505) (-356.568) -- 0:00:36 Average standard deviation of split frequencies: 0.014316 385500 -- [-357.819] (-358.432) (-358.185) (-358.192) * (-360.924) (-356.929) (-357.768) [-357.970] -- 0:00:36 386000 -- (-359.848) (-358.900) (-358.205) [-358.774] * (-359.654) [-359.879] (-361.111) (-356.808) -- 0:00:36 386500 -- (-360.266) (-357.464) [-359.198] (-359.893) * (-358.706) (-360.547) [-357.268] (-357.656) -- 0:00:36 387000 -- (-359.250) (-358.295) [-358.676] (-357.450) * (-356.614) [-360.461] (-364.180) (-364.762) -- 0:00:36 387500 -- (-359.880) (-362.222) (-360.491) [-358.701] * (-357.024) (-358.601) [-362.054] (-367.196) -- 0:00:36 388000 -- (-358.063) [-358.026] (-359.656) (-359.272) * (-358.418) [-356.242] (-359.838) (-358.009) -- 0:00:36 388500 -- (-359.528) [-357.418] (-359.504) (-356.950) * (-360.221) [-359.115] (-357.191) (-362.370) -- 0:00:36 389000 -- (-357.260) (-360.420) (-356.589) [-357.281] * (-356.853) (-360.024) [-362.150] (-358.866) -- 0:00:36 389500 -- [-356.834] (-359.068) (-360.061) (-359.517) * (-356.793) [-357.168] (-357.433) (-359.111) -- 0:00:36 390000 -- (-358.897) (-358.546) [-362.381] (-359.346) * (-358.998) [-359.343] (-358.572) (-357.416) -- 0:00:35 Average standard deviation of split frequencies: 0.013743 390500 -- (-361.293) [-356.314] (-356.801) (-356.803) * (-357.114) (-362.871) (-357.861) [-358.791] -- 0:00:35 391000 -- (-357.851) (-359.070) (-364.397) [-358.460] * [-357.466] (-356.308) (-356.783) (-358.855) -- 0:00:35 391500 -- [-357.992] (-356.376) (-356.999) (-357.844) * [-359.951] (-356.626) (-358.329) (-356.999) -- 0:00:35 392000 -- (-359.839) (-356.415) (-357.206) [-357.707] * [-359.598] (-357.836) (-362.100) (-359.291) -- 0:00:37 392500 -- (-358.353) [-357.891] (-366.521) (-356.280) * [-358.916] (-357.844) (-358.269) (-360.678) -- 0:00:37 393000 -- [-359.598] (-359.465) (-364.934) (-357.030) * [-360.291] (-360.273) (-362.034) (-360.262) -- 0:00:37 393500 -- [-359.119] (-356.532) (-361.064) (-358.299) * (-360.609) [-356.348] (-366.243) (-356.606) -- 0:00:36 394000 -- [-359.777] (-357.193) (-362.755) (-361.836) * (-359.453) [-357.164] (-356.947) (-359.277) -- 0:00:36 394500 -- (-357.426) [-358.950] (-364.448) (-359.145) * (-361.045) (-357.081) (-357.302) [-356.949] -- 0:00:36 395000 -- (-362.469) [-360.095] (-362.469) (-357.963) * (-360.315) [-362.069] (-356.155) (-357.843) -- 0:00:36 Average standard deviation of split frequencies: 0.013558 395500 -- [-357.163] (-358.075) (-357.311) (-356.375) * (-358.888) [-357.351] (-358.157) (-357.896) -- 0:00:36 396000 -- (-359.736) (-360.526) [-358.446] (-360.040) * [-359.162] (-359.273) (-359.029) (-358.903) -- 0:00:36 396500 -- (-360.468) (-358.564) [-361.026] (-359.732) * (-357.184) [-358.166] (-358.176) (-357.907) -- 0:00:36 397000 -- (-357.813) (-357.610) [-359.397] (-360.174) * (-356.084) (-357.534) (-358.245) [-358.228] -- 0:00:36 397500 -- (-359.843) (-360.585) [-358.560] (-357.917) * [-357.472] (-357.782) (-358.818) (-357.202) -- 0:00:36 398000 -- (-359.919) [-356.992] (-357.132) (-360.799) * (-358.870) [-357.407] (-356.825) (-357.403) -- 0:00:36 398500 -- (-358.346) (-356.117) [-357.690] (-358.063) * (-356.603) (-359.929) (-356.241) [-356.939] -- 0:00:36 399000 -- [-357.764] (-359.827) (-358.057) (-358.499) * (-358.151) (-358.862) (-357.564) [-358.809] -- 0:00:36 399500 -- (-360.896) [-357.288] (-361.424) (-362.147) * (-356.775) (-357.952) [-356.976] (-356.724) -- 0:00:36 400000 -- [-359.205] (-357.817) (-360.417) (-359.117) * (-358.530) (-357.577) (-356.926) [-357.300] -- 0:00:36 Average standard deviation of split frequencies: 0.013661 400500 -- (-360.640) (-357.028) [-358.822] (-362.517) * [-357.356] (-361.549) (-358.592) (-357.322) -- 0:00:35 401000 -- (-358.930) (-357.291) [-356.378] (-360.189) * (-363.010) (-361.514) (-358.252) [-359.037] -- 0:00:35 401500 -- (-357.429) (-361.924) [-356.727] (-359.998) * (-358.104) (-360.889) (-360.214) [-356.560] -- 0:00:35 402000 -- (-358.296) [-356.604] (-357.364) (-358.735) * (-357.653) [-360.522] (-357.554) (-363.356) -- 0:00:35 402500 -- (-358.827) (-357.273) (-356.687) [-357.930] * (-357.515) (-361.144) [-365.080] (-360.898) -- 0:00:35 403000 -- (-358.977) [-358.589] (-359.433) (-357.442) * (-360.073) (-357.796) [-357.838] (-358.541) -- 0:00:35 403500 -- (-362.479) [-357.434] (-359.203) (-357.178) * (-361.878) (-361.001) (-357.738) [-358.097] -- 0:00:35 404000 -- (-358.275) (-356.857) (-357.501) [-356.511] * [-356.472] (-362.185) (-356.978) (-357.508) -- 0:00:35 404500 -- [-358.635] (-359.592) (-359.755) (-359.054) * (-362.133) (-360.227) (-358.960) [-358.420] -- 0:00:35 405000 -- [-357.238] (-360.280) (-362.727) (-359.276) * (-358.953) (-356.770) (-361.019) [-360.527] -- 0:00:35 Average standard deviation of split frequencies: 0.014514 405500 -- (-359.938) [-358.112] (-358.566) (-358.457) * (-357.810) [-358.041] (-360.667) (-359.466) -- 0:00:35 406000 -- (-357.602) (-357.736) [-358.413] (-359.183) * (-358.329) [-357.234] (-357.109) (-358.895) -- 0:00:35 406500 -- [-356.836] (-357.545) (-358.347) (-358.479) * (-357.616) [-365.876] (-358.550) (-356.097) -- 0:00:35 407000 -- [-358.273] (-358.545) (-357.298) (-359.816) * (-356.293) [-358.139] (-358.282) (-357.030) -- 0:00:34 407500 -- (-360.245) (-357.643) (-358.565) [-360.319] * (-358.974) (-362.105) [-359.346] (-359.965) -- 0:00:34 408000 -- (-356.260) (-360.883) [-356.644] (-358.545) * (-360.582) (-358.095) (-359.086) [-359.681] -- 0:00:34 408500 -- (-358.856) [-359.674] (-360.494) (-358.519) * (-356.928) [-356.489] (-358.319) (-356.417) -- 0:00:36 409000 -- (-360.710) [-357.656] (-359.344) (-359.306) * (-357.036) [-357.575] (-359.379) (-357.406) -- 0:00:36 409500 -- [-361.558] (-356.234) (-361.467) (-357.928) * (-359.038) (-358.721) (-358.729) [-356.654] -- 0:00:36 410000 -- (-359.191) [-357.742] (-356.469) (-357.887) * [-356.603] (-359.102) (-360.266) (-359.617) -- 0:00:35 Average standard deviation of split frequencies: 0.014413 410500 -- (-364.645) [-357.780] (-362.679) (-357.889) * (-356.618) (-361.280) [-357.463] (-360.226) -- 0:00:35 411000 -- [-359.006] (-358.365) (-362.530) (-360.537) * (-359.763) (-357.745) (-357.427) [-357.466] -- 0:00:35 411500 -- (-358.328) [-358.843] (-357.820) (-358.033) * [-360.331] (-359.492) (-356.991) (-357.644) -- 0:00:35 412000 -- [-358.995] (-361.560) (-356.761) (-357.045) * (-360.487) (-358.129) (-359.997) [-357.197] -- 0:00:35 412500 -- (-358.979) (-359.997) (-356.475) [-357.850] * [-358.556] (-357.380) (-357.907) (-359.216) -- 0:00:35 413000 -- (-357.368) (-358.617) [-357.063] (-358.471) * (-357.914) (-357.435) [-357.776] (-362.797) -- 0:00:35 413500 -- (-358.337) (-357.357) (-359.264) [-358.077] * (-358.590) [-356.789] (-357.303) (-357.120) -- 0:00:35 414000 -- (-356.923) [-356.684] (-359.733) (-360.181) * [-357.230] (-356.843) (-357.334) (-358.048) -- 0:00:35 414500 -- (-357.620) (-360.351) (-357.304) [-356.703] * (-359.096) (-359.367) [-357.813] (-358.216) -- 0:00:35 415000 -- [-357.611] (-358.456) (-359.991) (-364.350) * (-357.035) [-356.241] (-357.321) (-358.136) -- 0:00:35 Average standard deviation of split frequencies: 0.014731 415500 -- (-358.706) (-357.096) [-358.255] (-366.238) * (-357.589) [-357.051] (-358.360) (-359.037) -- 0:00:35 416000 -- [-357.673] (-356.081) (-358.268) (-359.134) * (-361.264) [-358.815] (-358.532) (-357.639) -- 0:00:35 416500 -- (-357.253) (-361.814) (-367.332) [-357.776] * (-359.162) (-360.146) (-357.045) [-357.629] -- 0:00:35 417000 -- (-361.535) [-361.057] (-359.384) (-356.457) * [-357.793] (-357.738) (-359.754) (-357.186) -- 0:00:34 417500 -- (-357.504) (-361.210) (-357.593) [-356.183] * (-357.486) (-361.846) [-359.133] (-357.433) -- 0:00:34 418000 -- [-359.698] (-361.376) (-356.924) (-358.866) * (-357.157) (-358.954) (-356.748) [-358.276] -- 0:00:34 418500 -- [-357.551] (-358.552) (-357.076) (-362.652) * [-357.132] (-358.338) (-356.771) (-357.433) -- 0:00:34 419000 -- [-360.459] (-359.398) (-357.309) (-358.309) * (-356.615) [-357.463] (-359.071) (-361.361) -- 0:00:34 419500 -- (-362.308) (-362.985) [-357.553] (-357.080) * [-357.139] (-357.167) (-359.617) (-361.180) -- 0:00:34 420000 -- (-360.756) (-359.868) (-359.901) [-358.862] * [-357.384] (-357.321) (-362.027) (-357.420) -- 0:00:34 Average standard deviation of split frequencies: 0.014078 420500 -- (-359.437) [-357.019] (-358.370) (-356.181) * [-357.170] (-357.899) (-358.768) (-356.449) -- 0:00:34 421000 -- (-358.618) (-358.562) [-357.539] (-357.222) * (-361.513) (-359.376) (-361.206) [-357.953] -- 0:00:34 421500 -- [-360.294] (-357.232) (-359.255) (-356.079) * (-362.853) [-356.654] (-360.322) (-360.880) -- 0:00:34 422000 -- (-358.328) (-357.819) [-361.060] (-359.181) * (-360.888) (-356.315) (-358.115) [-358.186] -- 0:00:34 422500 -- (-360.084) (-360.454) [-358.846] (-361.680) * (-356.995) (-357.787) (-357.202) [-356.779] -- 0:00:34 423000 -- (-360.211) (-357.369) (-359.138) [-357.122] * [-356.336] (-356.627) (-356.832) (-360.407) -- 0:00:34 423500 -- [-358.083] (-358.003) (-356.896) (-356.158) * [-358.051] (-357.718) (-360.589) (-357.917) -- 0:00:34 424000 -- (-357.539) (-358.449) [-356.408] (-359.086) * (-358.094) (-360.530) [-363.008] (-359.910) -- 0:00:33 424500 -- (-362.159) [-357.267] (-359.885) (-358.728) * [-359.922] (-358.081) (-358.435) (-361.714) -- 0:00:33 425000 -- (-360.291) (-358.403) [-357.979] (-359.198) * (-359.146) (-356.543) [-358.319] (-358.034) -- 0:00:33 Average standard deviation of split frequencies: 0.013210 425500 -- (-358.278) [-359.370] (-359.748) (-357.124) * (-358.422) (-358.289) [-359.889] (-360.508) -- 0:00:35 426000 -- (-358.542) [-357.949] (-359.393) (-360.499) * [-357.435] (-358.050) (-359.364) (-360.023) -- 0:00:35 426500 -- [-358.537] (-357.446) (-361.679) (-357.309) * [-358.077] (-359.638) (-356.666) (-358.836) -- 0:00:34 427000 -- (-356.896) [-358.710] (-363.700) (-358.015) * (-360.266) (-362.638) (-358.010) [-362.802] -- 0:00:34 427500 -- (-356.571) [-357.705] (-358.578) (-359.704) * (-362.041) (-359.273) [-359.258] (-358.785) -- 0:00:34 428000 -- (-357.797) (-357.326) [-359.901] (-356.985) * (-357.100) (-360.320) [-357.154] (-360.988) -- 0:00:34 428500 -- (-357.293) [-359.002] (-357.173) (-357.223) * (-360.207) (-357.636) (-358.883) [-358.068] -- 0:00:34 429000 -- (-361.723) (-359.266) (-359.220) [-358.716] * (-360.489) [-357.283] (-356.591) (-357.177) -- 0:00:34 429500 -- (-358.408) (-357.207) (-358.492) [-360.318] * (-360.741) [-356.803] (-357.117) (-357.613) -- 0:00:34 430000 -- (-358.785) [-361.176] (-359.962) (-359.228) * (-361.708) (-359.729) (-356.814) [-356.608] -- 0:00:34 Average standard deviation of split frequencies: 0.013067 430500 -- (-359.804) (-357.471) (-359.669) [-357.295] * (-360.111) (-359.416) (-358.023) [-356.938] -- 0:00:34 431000 -- (-356.907) (-356.977) (-357.058) [-357.475] * (-359.013) [-356.232] (-357.258) (-359.157) -- 0:00:34 431500 -- (-356.933) (-358.847) (-356.688) [-360.321] * (-358.847) (-358.523) [-358.153] (-356.739) -- 0:00:34 432000 -- (-361.105) (-358.340) [-356.383] (-357.613) * (-358.233) (-361.869) [-358.555] (-357.207) -- 0:00:34 432500 -- (-359.532) (-365.819) [-356.583] (-357.885) * (-357.966) (-360.301) [-357.602] (-360.173) -- 0:00:34 433000 -- (-359.060) (-356.405) [-358.561] (-356.557) * (-356.968) (-358.213) (-362.396) [-356.175] -- 0:00:34 433500 -- (-361.501) [-357.951] (-357.436) (-356.573) * (-361.582) (-359.220) (-363.008) [-358.749] -- 0:00:33 434000 -- (-357.533) (-358.701) [-362.261] (-357.539) * (-359.543) (-359.692) (-360.301) [-356.572] -- 0:00:33 434500 -- [-358.630] (-357.510) (-360.156) (-356.586) * (-357.360) (-361.418) [-358.192] (-359.488) -- 0:00:33 435000 -- (-360.509) (-359.943) [-359.747] (-357.099) * [-357.276] (-360.922) (-360.193) (-357.560) -- 0:00:33 Average standard deviation of split frequencies: 0.012569 435500 -- (-357.323) (-361.753) (-358.386) [-359.561] * (-359.701) [-358.178] (-359.233) (-358.728) -- 0:00:33 436000 -- (-359.385) (-357.927) (-358.379) [-358.176] * (-357.570) (-360.164) [-356.380] (-359.192) -- 0:00:33 436500 -- (-358.005) (-360.100) (-357.458) [-359.263] * (-356.931) [-357.052] (-356.438) (-358.145) -- 0:00:33 437000 -- (-360.175) (-357.898) [-358.055] (-359.632) * (-358.347) (-360.356) [-357.277] (-364.005) -- 0:00:33 437500 -- (-357.065) [-357.077] (-357.034) (-359.609) * (-361.093) (-359.855) [-356.846] (-356.960) -- 0:00:33 438000 -- (-359.087) (-356.232) (-361.987) [-358.790] * (-358.428) [-357.735] (-358.582) (-360.973) -- 0:00:33 438500 -- (-356.907) (-357.603) (-361.848) [-358.906] * (-356.726) [-358.761] (-358.912) (-357.093) -- 0:00:33 439000 -- (-362.158) (-358.122) [-358.854] (-358.132) * (-357.026) [-358.051] (-357.903) (-358.960) -- 0:00:33 439500 -- (-362.731) (-357.186) [-358.216] (-357.032) * (-358.916) (-358.885) (-360.221) [-357.259] -- 0:00:33 440000 -- (-356.998) (-357.016) (-357.223) [-356.566] * (-357.236) (-358.172) [-356.158] (-358.988) -- 0:00:33 Average standard deviation of split frequencies: 0.012338 440500 -- (-358.845) (-357.395) (-361.756) [-357.235] * (-358.506) (-357.527) [-360.058] (-357.306) -- 0:00:33 441000 -- (-356.795) [-359.048] (-360.562) (-360.482) * (-358.595) [-360.578] (-356.338) (-358.792) -- 0:00:32 441500 -- (-358.337) [-356.171] (-357.797) (-356.276) * [-357.663] (-359.586) (-358.021) (-360.477) -- 0:00:32 442000 -- (-362.717) (-357.103) [-357.952] (-363.126) * [-358.684] (-359.497) (-356.623) (-358.105) -- 0:00:32 442500 -- (-359.703) (-356.974) [-359.523] (-359.714) * (-358.393) (-357.245) [-357.573] (-356.901) -- 0:00:32 443000 -- (-360.213) (-356.107) (-357.897) [-360.124] * (-358.430) [-356.205] (-357.576) (-362.730) -- 0:00:33 443500 -- (-359.240) [-356.659] (-357.328) (-360.134) * [-356.970] (-357.431) (-359.982) (-357.163) -- 0:00:33 444000 -- (-359.587) (-358.579) [-359.268] (-357.651) * (-362.667) [-358.736] (-358.904) (-357.688) -- 0:00:33 444500 -- (-356.279) (-361.295) (-357.917) [-359.489] * (-357.887) (-361.235) (-358.784) [-357.028] -- 0:00:33 445000 -- (-357.180) [-359.199] (-359.017) (-359.583) * [-356.024] (-359.483) (-357.084) (-357.789) -- 0:00:33 Average standard deviation of split frequencies: 0.011891 445500 -- (-360.001) [-357.840] (-356.420) (-362.542) * (-357.610) (-359.611) (-356.748) [-357.224] -- 0:00:33 446000 -- (-360.115) [-357.788] (-356.546) (-357.933) * (-360.888) [-356.352] (-358.992) (-357.115) -- 0:00:33 446500 -- (-357.656) (-360.591) [-356.313] (-356.817) * (-356.687) (-359.778) (-362.203) [-356.428] -- 0:00:33 447000 -- (-357.720) (-357.667) [-357.304] (-358.344) * (-357.691) (-358.255) [-363.327] (-360.643) -- 0:00:33 447500 -- [-358.975] (-359.767) (-358.553) (-358.839) * (-359.719) [-359.649] (-359.052) (-361.505) -- 0:00:33 448000 -- (-359.169) [-358.142] (-357.326) (-361.333) * (-357.976) (-359.788) [-356.548] (-358.995) -- 0:00:33 448500 -- (-360.070) (-358.905) [-360.274] (-360.797) * (-358.186) (-359.461) (-356.093) [-359.319] -- 0:00:33 449000 -- (-357.661) [-358.649] (-360.001) (-360.431) * (-358.949) (-359.320) [-356.818] (-358.271) -- 0:00:33 449500 -- (-364.194) [-356.089] (-359.523) (-358.093) * (-360.177) (-358.198) (-359.564) [-357.756] -- 0:00:33 450000 -- (-362.702) [-359.870] (-361.324) (-357.375) * (-358.715) [-357.923] (-357.795) (-358.505) -- 0:00:33 Average standard deviation of split frequencies: 0.011637 450500 -- (-356.113) [-358.926] (-358.125) (-358.153) * [-358.963] (-360.968) (-358.353) (-359.135) -- 0:00:32 451000 -- (-358.110) [-358.512] (-358.009) (-358.683) * [-358.094] (-357.020) (-357.346) (-356.597) -- 0:00:32 451500 -- (-360.078) (-359.661) [-358.035] (-361.666) * [-356.601] (-359.141) (-358.537) (-359.512) -- 0:00:32 452000 -- (-360.693) (-356.991) (-359.143) [-358.191] * (-356.491) (-357.634) (-356.909) [-358.371] -- 0:00:32 452500 -- (-361.671) (-357.567) (-359.819) [-359.524] * (-360.341) [-358.027] (-358.820) (-358.853) -- 0:00:32 453000 -- (-361.135) (-359.780) (-360.600) [-359.180] * (-360.940) (-357.917) (-359.125) [-359.295] -- 0:00:32 453500 -- (-363.692) (-357.046) [-358.519] (-356.158) * (-361.918) [-362.240] (-358.141) (-361.074) -- 0:00:32 454000 -- [-358.667] (-359.248) (-358.764) (-364.498) * [-360.716] (-361.469) (-361.604) (-360.595) -- 0:00:32 454500 -- [-358.919] (-357.632) (-356.717) (-365.523) * (-357.338) (-358.471) [-358.206] (-358.657) -- 0:00:32 455000 -- (-362.075) (-357.047) [-357.476] (-357.785) * (-357.122) [-357.330] (-359.904) (-358.479) -- 0:00:32 Average standard deviation of split frequencies: 0.012018 455500 -- (-359.591) (-358.570) (-357.271) [-359.121] * [-356.447] (-358.318) (-357.490) (-363.543) -- 0:00:32 456000 -- (-356.087) (-359.074) [-358.243] (-358.456) * (-356.827) (-360.441) (-359.635) [-357.675] -- 0:00:32 456500 -- (-358.639) (-362.152) (-358.513) [-359.077] * (-359.615) (-357.521) [-360.492] (-358.023) -- 0:00:32 457000 -- (-359.051) (-360.649) (-356.766) [-357.699] * (-361.587) (-359.258) [-356.638] (-359.781) -- 0:00:32 457500 -- (-356.671) (-362.717) (-359.420) [-357.684] * [-356.721] (-358.054) (-360.847) (-357.777) -- 0:00:32 458000 -- [-359.051] (-361.297) (-357.827) (-356.505) * (-359.493) (-360.493) (-356.404) [-357.005] -- 0:00:31 458500 -- (-358.395) (-358.415) (-359.683) [-357.423] * (-356.333) (-360.706) [-358.999] (-356.830) -- 0:00:31 459000 -- (-360.920) (-358.103) (-360.456) [-356.292] * (-359.941) [-358.985] (-357.877) (-360.204) -- 0:00:31 459500 -- (-359.237) (-358.597) (-357.654) [-357.198] * (-357.715) [-358.340] (-361.038) (-359.990) -- 0:00:31 460000 -- (-357.716) (-358.460) (-359.154) [-358.580] * (-358.187) (-356.931) [-362.344] (-358.566) -- 0:00:32 Average standard deviation of split frequencies: 0.012088 460500 -- (-357.328) (-357.126) [-357.816] (-357.478) * (-359.677) (-358.828) [-358.894] (-358.665) -- 0:00:32 461000 -- [-360.471] (-359.134) (-358.732) (-358.741) * (-358.330) [-356.946] (-358.148) (-357.006) -- 0:00:32 461500 -- [-359.948] (-357.920) (-359.169) (-357.369) * (-357.165) (-361.198) [-359.494] (-357.378) -- 0:00:32 462000 -- [-356.785] (-358.342) (-358.023) (-356.781) * (-358.591) (-363.471) (-360.514) [-359.746] -- 0:00:32 462500 -- (-360.868) (-361.474) [-357.623] (-357.113) * (-357.804) [-358.258] (-359.066) (-360.901) -- 0:00:32 463000 -- [-358.455] (-356.787) (-356.991) (-359.643) * [-360.277] (-357.060) (-359.597) (-357.780) -- 0:00:32 463500 -- (-359.004) [-357.266] (-359.200) (-358.362) * (-358.394) (-356.578) (-359.354) [-357.372] -- 0:00:32 464000 -- [-358.829] (-356.448) (-358.513) (-359.593) * (-356.891) [-357.593] (-363.344) (-356.643) -- 0:00:32 464500 -- (-356.281) (-358.634) (-358.148) [-360.117] * [-356.657] (-363.220) (-358.717) (-356.899) -- 0:00:32 465000 -- (-356.310) (-359.066) (-356.768) [-357.752] * (-359.334) (-359.653) (-357.143) [-357.203] -- 0:00:32 Average standard deviation of split frequencies: 0.012455 465500 -- [-358.141] (-358.583) (-357.367) (-358.447) * (-359.392) (-362.771) [-357.231] (-357.127) -- 0:00:32 466000 -- (-356.451) (-359.559) (-359.765) [-358.463] * (-358.600) (-362.879) [-359.136] (-356.684) -- 0:00:32 466500 -- (-358.971) (-360.499) [-358.421] (-360.796) * (-358.134) (-357.962) (-362.048) [-359.121] -- 0:00:32 467000 -- (-357.351) (-356.882) (-357.005) [-357.182] * (-358.523) (-356.865) [-358.378] (-364.245) -- 0:00:31 467500 -- [-357.299] (-356.434) (-357.893) (-358.880) * (-358.687) (-357.622) (-356.185) [-356.436] -- 0:00:31 468000 -- (-358.897) (-357.349) [-355.974] (-359.154) * (-361.040) (-361.724) [-358.423] (-362.147) -- 0:00:31 468500 -- [-359.808] (-357.049) (-356.347) (-358.189) * [-357.807] (-359.563) (-357.362) (-357.824) -- 0:00:31 469000 -- [-358.388] (-358.280) (-356.688) (-358.224) * (-357.032) (-359.779) (-362.779) [-357.673] -- 0:00:31 469500 -- (-356.839) (-360.932) (-359.467) [-358.197] * (-358.248) (-361.562) (-360.333) [-360.582] -- 0:00:31 470000 -- (-358.869) [-357.487] (-357.360) (-356.998) * (-363.634) [-359.734] (-359.543) (-358.703) -- 0:00:31 Average standard deviation of split frequencies: 0.012820 470500 -- [-361.663] (-357.631) (-357.865) (-358.939) * (-360.162) (-359.891) [-357.243] (-357.372) -- 0:00:31 471000 -- (-358.195) [-359.737] (-357.544) (-360.591) * (-357.546) (-359.649) (-356.920) [-356.656] -- 0:00:31 471500 -- (-356.848) (-358.507) (-358.389) [-358.094] * [-360.083] (-357.063) (-358.803) (-356.832) -- 0:00:31 472000 -- (-360.201) (-358.721) [-357.276] (-359.274) * (-358.444) (-356.581) [-360.328] (-359.761) -- 0:00:31 472500 -- (-357.861) (-356.750) [-357.558] (-368.465) * (-357.086) (-358.226) [-358.262] (-358.578) -- 0:00:31 473000 -- (-358.929) [-357.475] (-358.514) (-358.584) * (-356.208) (-358.134) [-358.668] (-357.336) -- 0:00:31 473500 -- (-360.672) (-357.424) [-359.752] (-356.173) * (-357.055) (-358.267) (-359.240) [-359.137] -- 0:00:31 474000 -- [-358.038] (-361.898) (-357.211) (-359.139) * (-357.710) (-356.019) (-358.501) [-359.126] -- 0:00:31 474500 -- (-358.641) (-360.318) (-356.938) [-356.897] * (-356.830) (-357.743) [-358.964] (-366.309) -- 0:00:31 475000 -- (-361.817) [-361.070] (-359.277) (-358.688) * (-357.555) (-357.593) (-357.500) [-358.147] -- 0:00:30 Average standard deviation of split frequencies: 0.012676 475500 -- (-357.617) (-359.634) [-360.232] (-357.297) * [-357.508] (-358.344) (-362.012) (-360.731) -- 0:00:30 476000 -- [-359.890] (-358.308) (-359.101) (-358.265) * (-358.415) (-359.857) (-357.529) [-360.111] -- 0:00:30 476500 -- [-357.191] (-359.847) (-358.708) (-359.771) * [-358.111] (-358.283) (-362.681) (-356.470) -- 0:00:30 477000 -- [-356.699] (-358.575) (-359.367) (-357.131) * (-356.729) (-359.265) [-362.324] (-356.860) -- 0:00:30 477500 -- (-356.740) (-358.736) (-362.930) [-356.590] * (-358.949) (-357.739) (-357.541) [-357.916] -- 0:00:31 478000 -- [-357.611] (-360.976) (-359.123) (-356.318) * (-365.152) [-358.375] (-358.290) (-359.368) -- 0:00:31 478500 -- [-359.682] (-357.215) (-360.186) (-357.380) * (-359.737) [-358.449] (-357.056) (-358.227) -- 0:00:31 479000 -- (-357.791) (-357.866) (-357.466) [-360.502] * (-360.194) [-358.442] (-356.960) (-356.501) -- 0:00:31 479500 -- (-357.827) (-357.988) [-358.214] (-359.063) * (-357.564) [-358.608] (-360.436) (-359.642) -- 0:00:31 480000 -- [-357.124] (-359.997) (-361.644) (-358.557) * (-358.886) (-360.939) (-358.462) [-359.857] -- 0:00:31 Average standard deviation of split frequencies: 0.012946 480500 -- (-357.853) (-357.121) (-359.424) [-358.757] * [-359.344] (-360.249) (-360.946) (-356.662) -- 0:00:31 481000 -- (-361.105) (-361.365) (-361.608) [-359.607] * [-360.830] (-359.812) (-363.558) (-359.008) -- 0:00:31 481500 -- [-362.706] (-362.012) (-358.886) (-359.148) * (-359.730) (-356.861) (-362.501) [-358.082] -- 0:00:31 482000 -- (-358.721) (-360.931) (-357.447) [-357.280] * (-358.774) [-357.052] (-357.301) (-357.295) -- 0:00:31 482500 -- (-357.552) (-359.904) (-359.384) [-356.282] * (-357.941) (-358.373) (-357.327) [-357.513] -- 0:00:31 483000 -- (-357.767) (-360.946) [-358.370] (-356.225) * (-358.926) [-357.160] (-358.158) (-360.312) -- 0:00:31 483500 -- (-357.921) [-361.740] (-358.300) (-357.414) * [-356.537] (-356.684) (-357.280) (-358.730) -- 0:00:30 484000 -- [-359.356] (-358.119) (-357.226) (-361.295) * (-358.569) (-357.466) (-358.154) [-356.812] -- 0:00:30 484500 -- (-357.883) [-357.621] (-356.504) (-359.808) * (-357.821) (-357.339) [-355.962] (-357.145) -- 0:00:30 485000 -- [-358.845] (-357.032) (-356.674) (-357.982) * (-356.927) [-356.861] (-357.516) (-356.634) -- 0:00:30 Average standard deviation of split frequencies: 0.013192 485500 -- (-359.170) (-359.482) (-358.479) [-357.335] * (-357.035) [-356.665] (-358.535) (-359.527) -- 0:00:30 486000 -- (-358.692) (-356.764) [-357.582] (-358.014) * [-356.474] (-361.579) (-356.960) (-360.146) -- 0:00:30 486500 -- (-359.190) (-360.116) (-359.473) [-360.021] * (-356.562) (-359.305) (-357.732) [-357.176] -- 0:00:30 487000 -- (-362.241) (-362.397) (-358.679) [-360.890] * (-356.379) (-363.462) (-358.738) [-358.404] -- 0:00:30 487500 -- (-359.158) (-357.399) [-363.740] (-357.600) * (-362.052) [-357.491] (-359.496) (-360.056) -- 0:00:30 488000 -- [-356.633] (-359.293) (-360.668) (-358.805) * (-361.925) (-359.882) [-358.421] (-359.517) -- 0:00:30 488500 -- (-357.200) (-358.366) (-358.007) [-359.011] * [-356.545] (-359.038) (-357.434) (-358.802) -- 0:00:30 489000 -- [-360.727] (-358.609) (-358.589) (-359.533) * (-356.622) [-359.999] (-358.131) (-358.868) -- 0:00:30 489500 -- (-358.718) [-359.698] (-357.091) (-359.647) * (-358.195) (-358.476) (-361.546) [-357.830] -- 0:00:30 490000 -- (-359.090) [-356.224] (-357.477) (-358.602) * (-356.603) [-359.404] (-356.881) (-358.017) -- 0:00:30 Average standard deviation of split frequencies: 0.012426 490500 -- (-359.006) (-358.086) (-362.130) [-358.730] * (-356.586) [-358.836] (-357.942) (-356.740) -- 0:00:30 491000 -- (-359.617) (-359.653) (-358.699) [-357.087] * (-356.882) [-357.663] (-359.044) (-359.586) -- 0:00:30 491500 -- [-362.965] (-356.194) (-358.865) (-360.681) * (-356.813) (-356.039) [-357.378] (-365.117) -- 0:00:30 492000 -- (-357.998) (-356.896) (-361.551) [-359.367] * (-357.472) (-360.588) [-357.653] (-362.075) -- 0:00:29 492500 -- [-356.443] (-357.452) (-360.578) (-359.260) * [-357.452] (-359.433) (-358.865) (-359.919) -- 0:00:30 493000 -- (-359.818) (-357.103) (-356.793) [-359.366] * [-357.568] (-357.114) (-359.145) (-358.083) -- 0:00:30 493500 -- (-359.234) (-357.658) (-359.341) [-357.942] * (-361.575) [-358.795] (-362.809) (-359.404) -- 0:00:30 494000 -- [-360.335] (-359.735) (-360.832) (-357.220) * [-357.366] (-359.458) (-358.603) (-357.089) -- 0:00:30 494500 -- [-357.312] (-360.761) (-358.615) (-356.465) * (-358.387) (-359.908) (-363.426) [-357.332] -- 0:00:30 495000 -- (-358.296) [-357.562] (-359.015) (-358.897) * (-359.548) [-358.652] (-361.970) (-358.785) -- 0:00:30 Average standard deviation of split frequencies: 0.012058 495500 -- [-358.798] (-356.549) (-356.663) (-364.523) * (-361.366) (-359.912) (-359.628) [-357.068] -- 0:00:30 496000 -- (-361.152) [-357.973] (-357.588) (-359.746) * (-357.574) [-356.712] (-359.975) (-358.671) -- 0:00:30 496500 -- (-359.237) (-360.527) [-358.779] (-359.767) * (-360.565) [-362.992] (-357.225) (-356.817) -- 0:00:30 497000 -- (-356.869) [-359.619] (-360.079) (-360.352) * (-357.971) [-358.012] (-357.578) (-357.830) -- 0:00:30 497500 -- (-358.878) [-358.756] (-357.743) (-359.378) * (-360.053) (-358.051) [-364.939] (-356.324) -- 0:00:30 498000 -- (-358.862) (-360.231) [-357.279] (-357.615) * (-361.132) (-357.329) (-357.895) [-358.160] -- 0:00:30 498500 -- [-359.138] (-361.548) (-357.231) (-357.874) * (-357.885) (-358.250) (-364.318) [-359.352] -- 0:00:30 499000 -- (-357.943) (-357.722) (-358.145) [-357.341] * (-356.724) (-359.212) (-357.643) [-360.000] -- 0:00:30 499500 -- [-358.721] (-359.041) (-358.657) (-357.857) * (-357.455) (-357.276) (-358.738) [-357.706] -- 0:00:30 500000 -- (-358.357) [-358.590] (-365.030) (-358.085) * (-359.565) [-357.456] (-358.853) (-358.217) -- 0:00:30 Average standard deviation of split frequencies: 0.012554 500500 -- (-358.184) [-357.054] (-357.188) (-358.991) * (-357.850) (-359.914) [-361.374] (-363.487) -- 0:00:29 501000 -- [-356.516] (-358.481) (-359.669) (-356.710) * (-357.888) (-356.990) (-356.502) [-357.597] -- 0:00:29 501500 -- [-356.136] (-361.601) (-358.834) (-357.249) * (-358.097) (-360.354) [-357.037] (-360.353) -- 0:00:29 502000 -- (-357.126) [-358.847] (-360.923) (-358.290) * (-361.306) (-359.968) [-360.745] (-357.872) -- 0:00:29 502500 -- [-357.645] (-357.233) (-358.716) (-357.326) * (-360.349) (-362.319) [-361.010] (-357.117) -- 0:00:29 503000 -- (-359.935) [-358.996] (-358.092) (-362.140) * (-358.419) (-357.741) [-360.701] (-361.825) -- 0:00:29 503500 -- (-359.151) (-358.184) (-358.344) [-358.327] * (-358.082) (-358.374) (-361.201) [-359.531] -- 0:00:29 504000 -- (-358.740) (-359.791) (-359.665) [-360.134] * (-360.034) (-357.872) [-358.304] (-356.402) -- 0:00:29 504500 -- (-361.807) [-358.787] (-364.533) (-360.718) * (-356.800) (-357.535) [-357.076] (-360.757) -- 0:00:29 505000 -- (-360.439) [-359.064] (-357.104) (-357.993) * (-361.576) [-360.629] (-356.877) (-357.139) -- 0:00:29 Average standard deviation of split frequencies: 0.012461 505500 -- (-360.883) [-357.049] (-358.437) (-357.739) * (-366.031) (-361.418) (-356.386) [-358.525] -- 0:00:29 506000 -- (-357.687) [-358.432] (-358.336) (-357.431) * (-357.388) (-363.803) [-360.336] (-357.538) -- 0:00:29 506500 -- [-356.692] (-358.263) (-356.639) (-359.323) * [-364.364] (-366.373) (-356.911) (-357.300) -- 0:00:29 507000 -- (-358.458) [-355.870] (-356.904) (-357.238) * [-364.673] (-358.500) (-361.984) (-357.957) -- 0:00:29 507500 -- (-360.859) (-356.019) (-365.828) [-356.384] * (-360.633) (-357.311) (-361.407) [-357.371] -- 0:00:29 508000 -- (-357.372) [-356.428] (-360.402) (-356.098) * (-362.892) [-358.541] (-360.212) (-357.782) -- 0:00:29 508500 -- (-359.387) (-358.464) (-357.319) [-357.893] * (-360.957) (-356.776) [-359.649] (-358.167) -- 0:00:28 509000 -- (-356.675) (-358.372) (-358.717) [-359.939] * (-361.422) (-357.478) [-359.668] (-357.671) -- 0:00:28 509500 -- (-357.280) (-357.624) (-357.716) [-356.942] * (-362.200) (-357.798) (-358.143) [-361.596] -- 0:00:29 510000 -- (-358.961) (-357.133) (-357.307) [-357.527] * (-356.631) (-361.241) [-356.725] (-358.457) -- 0:00:29 Average standard deviation of split frequencies: 0.012751 510500 -- (-357.638) [-359.008] (-357.764) (-358.273) * (-358.014) (-359.849) (-358.348) [-358.930] -- 0:00:29 511000 -- (-357.452) (-358.463) [-357.759] (-359.682) * (-360.585) [-359.113] (-357.885) (-356.907) -- 0:00:29 511500 -- [-357.558] (-358.688) (-356.945) (-360.118) * [-358.518] (-357.537) (-358.446) (-362.291) -- 0:00:29 512000 -- (-357.082) (-359.841) [-360.871] (-358.506) * (-358.840) [-357.900] (-356.283) (-361.532) -- 0:00:29 512500 -- (-359.883) (-356.752) (-358.966) [-359.446] * (-358.686) (-360.964) (-357.952) [-359.347] -- 0:00:29 513000 -- (-357.691) [-357.182] (-360.671) (-357.622) * (-359.958) [-358.061] (-358.177) (-358.393) -- 0:00:29 513500 -- [-357.440] (-357.589) (-362.476) (-359.349) * [-359.175] (-359.432) (-359.864) (-357.582) -- 0:00:29 514000 -- (-360.472) (-356.999) [-358.508] (-361.743) * [-357.351] (-357.988) (-357.659) (-364.852) -- 0:00:29 514500 -- (-360.987) (-357.176) (-358.927) [-360.914] * [-361.439] (-358.958) (-364.751) (-356.493) -- 0:00:29 515000 -- (-357.408) [-357.734] (-361.489) (-358.069) * (-359.481) [-357.588] (-359.436) (-357.277) -- 0:00:29 Average standard deviation of split frequencies: 0.012790 515500 -- (-356.868) (-362.490) [-360.138] (-356.093) * (-360.408) [-357.183] (-357.460) (-358.601) -- 0:00:29 516000 -- (-359.475) (-363.433) (-358.679) [-356.751] * (-357.223) (-357.909) [-358.560] (-357.788) -- 0:00:29 516500 -- (-356.294) (-360.297) [-356.344] (-360.401) * [-357.118] (-358.156) (-356.954) (-358.408) -- 0:00:29 517000 -- (-362.259) (-357.236) [-358.563] (-357.622) * (-357.434) (-357.680) [-358.119] (-362.317) -- 0:00:28 517500 -- (-360.018) [-356.277] (-358.023) (-357.244) * (-358.939) (-358.429) [-358.239] (-361.421) -- 0:00:28 518000 -- (-357.367) [-359.430] (-357.571) (-356.929) * (-358.830) (-360.224) [-359.182] (-367.929) -- 0:00:28 518500 -- (-363.833) (-357.640) (-359.440) [-358.410] * [-358.109] (-359.536) (-361.654) (-362.524) -- 0:00:28 519000 -- (-357.947) [-358.455] (-356.733) (-357.787) * (-356.701) (-357.636) [-357.862] (-357.075) -- 0:00:28 519500 -- [-356.441] (-359.095) (-357.014) (-358.714) * (-357.867) [-357.764] (-363.193) (-359.344) -- 0:00:28 520000 -- (-356.712) (-356.956) (-358.197) [-358.541] * [-356.273] (-356.676) (-359.685) (-359.459) -- 0:00:28 Average standard deviation of split frequencies: 0.012845 520500 -- (-358.990) [-358.848] (-357.537) (-358.781) * [-358.335] (-357.690) (-359.010) (-360.227) -- 0:00:28 521000 -- (-358.408) [-356.710] (-362.138) (-362.566) * (-359.358) (-358.331) [-363.603] (-359.221) -- 0:00:28 521500 -- (-357.052) (-356.901) [-357.969] (-357.726) * (-357.298) (-357.064) [-358.406] (-358.999) -- 0:00:28 522000 -- (-356.313) (-356.573) [-360.262] (-358.070) * [-357.443] (-358.534) (-360.296) (-357.767) -- 0:00:28 522500 -- (-357.260) (-358.656) [-359.064] (-358.883) * (-360.861) (-357.153) [-359.358] (-357.796) -- 0:00:28 523000 -- (-357.260) (-360.389) [-357.496] (-358.270) * (-360.355) (-357.528) (-359.514) [-358.823] -- 0:00:28 523500 -- [-356.935] (-357.741) (-358.168) (-359.986) * (-360.726) [-357.283] (-357.065) (-357.895) -- 0:00:28 524000 -- (-358.275) (-356.876) (-359.266) [-359.494] * [-358.096] (-361.881) (-359.383) (-358.132) -- 0:00:28 524500 -- [-357.312] (-358.324) (-359.081) (-357.759) * (-364.431) (-359.410) [-356.487] (-358.640) -- 0:00:28 525000 -- (-361.483) [-356.575] (-362.288) (-358.446) * (-357.786) [-361.030] (-356.391) (-356.701) -- 0:00:28 Average standard deviation of split frequencies: 0.013163 525500 -- (-365.078) [-360.099] (-355.993) (-357.377) * (-357.564) (-360.162) (-357.503) [-358.729] -- 0:00:27 526000 -- (-359.552) (-360.437) (-362.429) [-359.961] * (-356.958) [-358.544] (-358.131) (-358.183) -- 0:00:27 526500 -- (-360.507) [-357.198] (-359.374) (-360.007) * (-358.169) (-357.756) (-360.798) [-360.438] -- 0:00:28 527000 -- (-357.287) [-357.504] (-360.119) (-357.280) * (-357.406) [-359.816] (-361.467) (-357.419) -- 0:00:28 527500 -- (-360.305) [-361.678] (-358.994) (-357.194) * (-362.998) (-358.056) (-362.100) [-358.747] -- 0:00:28 528000 -- (-358.978) [-358.321] (-359.192) (-356.285) * [-357.957] (-357.846) (-358.688) (-357.368) -- 0:00:28 528500 -- (-356.387) [-359.052] (-360.308) (-358.317) * (-358.772) (-357.160) (-359.544) [-356.864] -- 0:00:28 529000 -- [-358.021] (-359.916) (-360.417) (-356.085) * (-357.697) [-359.869] (-358.029) (-358.100) -- 0:00:28 529500 -- (-358.338) (-359.194) [-358.532] (-356.573) * [-363.158] (-357.553) (-360.727) (-356.521) -- 0:00:28 530000 -- (-356.726) (-361.191) (-356.639) [-357.241] * (-360.949) [-356.694] (-361.539) (-359.321) -- 0:00:28 Average standard deviation of split frequencies: 0.013103 530500 -- (-357.271) (-358.652) [-356.827] (-357.705) * [-359.709] (-356.702) (-356.141) (-360.987) -- 0:00:28 531000 -- [-358.834] (-358.045) (-357.724) (-362.510) * (-357.731) [-356.470] (-356.693) (-357.811) -- 0:00:28 531500 -- (-360.363) (-357.113) [-357.142] (-360.134) * (-358.031) [-356.402] (-357.852) (-359.129) -- 0:00:28 532000 -- (-359.515) (-357.838) [-358.294] (-358.169) * [-356.545] (-356.996) (-360.821) (-360.887) -- 0:00:28 532500 -- (-358.878) (-357.012) [-358.226] (-358.545) * (-358.407) [-359.345] (-356.819) (-360.718) -- 0:00:28 533000 -- (-357.282) (-360.807) [-359.620] (-358.381) * [-359.133] (-358.367) (-357.624) (-359.679) -- 0:00:28 533500 -- (-359.791) (-366.816) [-358.686] (-357.643) * [-357.772] (-362.565) (-358.672) (-357.081) -- 0:00:27 534000 -- [-360.800] (-361.505) (-357.361) (-356.876) * [-357.165] (-357.998) (-358.300) (-362.265) -- 0:00:27 534500 -- (-357.733) [-356.726] (-357.057) (-357.185) * [-360.196] (-357.239) (-357.700) (-359.898) -- 0:00:27 535000 -- (-358.036) (-356.880) (-363.739) [-357.690] * (-361.777) (-360.023) [-358.142] (-359.432) -- 0:00:27 Average standard deviation of split frequencies: 0.012753 535500 -- (-358.638) (-357.466) (-361.028) [-360.232] * (-359.231) (-357.786) [-358.193] (-361.459) -- 0:00:27 536000 -- (-357.040) [-359.156] (-358.617) (-362.092) * (-360.111) [-358.325] (-356.308) (-357.628) -- 0:00:27 536500 -- (-356.746) (-357.349) [-357.197] (-358.099) * (-356.612) (-357.487) [-358.329] (-356.972) -- 0:00:27 537000 -- (-356.912) (-359.492) (-357.858) [-358.918] * (-357.433) (-357.756) [-359.319] (-358.713) -- 0:00:27 537500 -- (-356.365) [-358.699] (-362.369) (-360.265) * [-357.857] (-357.543) (-360.046) (-357.659) -- 0:00:27 538000 -- (-356.489) [-358.281] (-356.753) (-358.515) * (-357.866) [-359.334] (-363.914) (-357.392) -- 0:00:27 538500 -- [-356.194] (-356.998) (-358.015) (-357.010) * (-357.537) (-359.402) [-358.046] (-356.728) -- 0:00:27 539000 -- [-356.196] (-358.742) (-359.567) (-359.396) * (-359.934) (-360.342) (-358.945) [-357.050] -- 0:00:27 539500 -- [-357.516] (-357.227) (-357.304) (-360.867) * (-357.987) (-359.520) (-357.090) [-357.382] -- 0:00:27 540000 -- (-356.532) (-356.778) [-357.621] (-356.880) * [-358.551] (-358.306) (-356.711) (-365.170) -- 0:00:27 Average standard deviation of split frequencies: 0.013078 540500 -- (-356.592) [-359.706] (-359.594) (-360.827) * [-359.246] (-358.475) (-357.543) (-363.113) -- 0:00:27 541000 -- [-357.186] (-358.074) (-358.393) (-356.485) * [-359.288] (-356.970) (-362.377) (-362.348) -- 0:00:27 541500 -- [-358.634] (-356.545) (-360.789) (-357.354) * (-357.677) (-357.854) [-358.823] (-359.345) -- 0:00:27 542000 -- (-358.913) (-357.060) [-362.582] (-364.673) * (-357.025) (-361.816) (-355.918) [-359.868] -- 0:00:27 542500 -- (-358.443) (-358.696) [-359.559] (-359.412) * (-357.000) (-360.507) [-356.850] (-357.458) -- 0:00:26 543000 -- (-356.516) [-359.264] (-358.080) (-360.525) * [-356.369] (-362.594) (-356.292) (-356.980) -- 0:00:26 543500 -- [-359.108] (-359.741) (-357.695) (-360.531) * (-357.518) [-357.173] (-357.732) (-356.073) -- 0:00:27 544000 -- (-356.875) (-358.608) (-358.407) [-360.756] * [-359.230] (-360.443) (-361.318) (-358.069) -- 0:00:27 544500 -- (-357.877) (-360.073) (-360.094) [-359.230] * (-357.278) (-361.837) [-360.151] (-360.004) -- 0:00:27 545000 -- (-359.981) [-357.934] (-357.243) (-360.472) * (-360.569) [-360.678] (-356.801) (-358.177) -- 0:00:27 Average standard deviation of split frequencies: 0.013490 545500 -- (-356.394) [-357.318] (-358.192) (-357.207) * (-358.628) (-358.203) (-357.814) [-357.384] -- 0:00:27 546000 -- (-356.086) (-357.494) (-359.098) [-357.573] * (-358.454) (-360.297) (-358.443) [-359.042] -- 0:00:27 546500 -- (-363.357) (-357.770) (-359.305) [-357.988] * (-357.135) (-357.530) (-357.274) [-357.395] -- 0:00:27 547000 -- (-356.506) (-361.741) [-357.331] (-356.763) * [-359.817] (-359.087) (-357.756) (-356.756) -- 0:00:27 547500 -- (-357.526) (-363.740) [-357.684] (-357.364) * (-366.445) [-357.621] (-357.756) (-361.664) -- 0:00:27 548000 -- [-356.958] (-359.751) (-358.475) (-359.845) * [-357.236] (-358.944) (-358.057) (-360.309) -- 0:00:27 548500 -- (-359.376) [-360.719] (-360.884) (-358.222) * (-358.456) (-357.990) (-356.893) [-358.579] -- 0:00:27 549000 -- (-359.186) (-362.079) [-359.253] (-367.768) * (-359.430) [-357.768] (-358.420) (-359.721) -- 0:00:27 549500 -- [-358.383] (-357.494) (-359.318) (-364.057) * (-360.264) (-357.553) [-357.236] (-360.713) -- 0:00:27 550000 -- (-358.769) [-356.718] (-358.978) (-359.129) * (-362.811) (-357.347) (-358.101) [-358.481] -- 0:00:27 Average standard deviation of split frequencies: 0.013697 550500 -- [-356.916] (-356.856) (-357.612) (-360.972) * (-360.529) (-357.772) (-358.332) [-359.438] -- 0:00:26 551000 -- (-357.077) (-358.313) [-358.465] (-357.897) * (-359.925) (-358.763) [-357.087] (-362.207) -- 0:00:26 551500 -- [-358.899] (-358.854) (-358.338) (-358.852) * (-361.917) (-360.271) (-358.778) [-357.748] -- 0:00:26 552000 -- [-359.097] (-357.250) (-356.368) (-363.370) * (-361.636) (-359.406) [-358.814] (-356.599) -- 0:00:26 552500 -- (-358.998) (-357.585) [-358.359] (-357.951) * (-364.801) (-355.942) (-359.714) [-357.697] -- 0:00:26 553000 -- [-359.285] (-357.085) (-357.988) (-364.140) * (-359.937) (-356.642) (-360.919) [-357.123] -- 0:00:26 553500 -- (-358.101) (-356.392) (-357.531) [-360.258] * (-362.464) (-357.262) [-357.915] (-358.048) -- 0:00:26 554000 -- (-361.340) (-359.132) (-359.927) [-356.930] * (-358.660) [-360.050] (-357.733) (-359.607) -- 0:00:26 554500 -- (-359.464) (-358.627) [-357.910] (-356.804) * (-359.961) [-359.763] (-359.826) (-360.407) -- 0:00:26 555000 -- [-358.417] (-358.222) (-357.093) (-357.273) * (-356.593) (-357.898) (-356.936) [-359.296] -- 0:00:26 Average standard deviation of split frequencies: 0.012718 555500 -- (-358.948) [-359.785] (-356.342) (-359.322) * (-360.764) [-357.915] (-359.172) (-358.261) -- 0:00:26 556000 -- (-356.781) (-363.698) [-357.006] (-360.441) * (-364.578) (-357.587) (-358.966) [-357.510] -- 0:00:26 556500 -- [-356.646] (-358.359) (-356.607) (-358.967) * (-358.118) (-357.802) (-358.331) [-358.769] -- 0:00:26 557000 -- (-359.799) (-361.981) [-356.446] (-357.850) * (-356.983) (-358.908) [-359.467] (-360.048) -- 0:00:26 557500 -- (-357.511) (-359.723) [-359.967] (-361.912) * (-358.707) [-359.870] (-360.271) (-358.838) -- 0:00:26 558000 -- [-361.044] (-359.970) (-358.444) (-356.895) * (-356.137) (-360.026) (-358.024) [-358.929] -- 0:00:26 558500 -- (-361.012) [-359.027] (-358.810) (-361.232) * (-358.397) [-356.004] (-356.820) (-356.675) -- 0:00:26 559000 -- [-358.956] (-357.118) (-358.027) (-357.118) * (-357.512) [-357.196] (-357.441) (-359.223) -- 0:00:26 559500 -- (-357.815) (-359.696) (-357.369) [-358.220] * (-356.256) (-358.907) (-358.050) [-358.983] -- 0:00:25 560000 -- (-357.183) (-361.667) [-361.607] (-361.309) * [-358.559] (-359.870) (-359.196) (-355.942) -- 0:00:25 Average standard deviation of split frequencies: 0.012875 560500 -- [-357.114] (-358.409) (-355.962) (-357.696) * [-357.217] (-357.686) (-358.368) (-356.465) -- 0:00:26 561000 -- [-358.060] (-358.561) (-359.128) (-358.794) * (-359.345) [-359.984] (-357.309) (-363.406) -- 0:00:26 561500 -- (-360.121) [-360.712] (-356.743) (-358.408) * [-358.270] (-359.324) (-357.738) (-357.204) -- 0:00:26 562000 -- [-359.165] (-358.495) (-357.368) (-359.024) * [-358.253] (-357.359) (-359.694) (-357.049) -- 0:00:26 562500 -- (-357.534) (-359.060) (-357.744) [-359.171] * [-357.469] (-360.436) (-362.006) (-356.323) -- 0:00:26 563000 -- [-356.518] (-363.213) (-359.049) (-359.384) * (-359.768) (-358.853) (-358.434) [-359.318] -- 0:00:26 563500 -- (-358.909) (-364.795) [-359.702] (-357.298) * (-359.222) (-359.401) [-356.744] (-359.595) -- 0:00:26 564000 -- (-357.250) (-357.206) (-359.301) [-357.823] * (-356.152) (-356.677) [-361.897] (-356.807) -- 0:00:26 564500 -- (-358.875) [-357.753] (-358.506) (-357.698) * [-358.477] (-359.607) (-357.771) (-358.099) -- 0:00:26 565000 -- [-359.320] (-358.723) (-361.123) (-359.430) * (-358.949) [-357.456] (-357.113) (-359.045) -- 0:00:26 Average standard deviation of split frequencies: 0.013375 565500 -- (-357.511) (-359.649) (-358.705) [-360.792] * (-358.795) [-357.096] (-358.968) (-356.428) -- 0:00:26 566000 -- (-357.556) (-357.323) [-357.120] (-362.772) * (-357.405) [-357.333] (-359.286) (-356.611) -- 0:00:26 566500 -- [-356.807] (-358.008) (-358.544) (-357.889) * (-357.134) (-356.879) (-359.169) [-356.513] -- 0:00:26 567000 -- (-357.751) (-359.844) [-356.516] (-359.085) * (-356.364) (-357.995) [-358.814] (-358.599) -- 0:00:25 567500 -- [-357.279] (-357.975) (-360.602) (-359.999) * [-357.705] (-357.267) (-362.243) (-364.752) -- 0:00:25 568000 -- [-356.841] (-357.044) (-357.528) (-356.284) * (-358.091) [-356.917] (-357.262) (-358.731) -- 0:00:25 568500 -- (-357.110) (-356.945) [-360.721] (-359.365) * (-357.644) (-360.861) (-361.228) [-357.385] -- 0:00:25 569000 -- (-356.259) (-356.758) (-358.401) [-358.230] * (-360.477) (-357.175) [-359.382] (-358.860) -- 0:00:25 569500 -- (-356.888) (-356.617) (-360.111) [-358.700] * [-359.578] (-357.783) (-356.799) (-360.201) -- 0:00:25 570000 -- (-358.039) [-358.752] (-359.038) (-356.378) * (-358.614) (-356.593) [-356.468] (-370.427) -- 0:00:25 Average standard deviation of split frequencies: 0.012907 570500 -- (-360.309) (-358.796) (-357.709) [-356.628] * (-359.212) [-357.350] (-360.346) (-357.555) -- 0:00:25 571000 -- [-358.008] (-359.981) (-359.089) (-360.216) * (-356.303) (-358.739) [-359.081] (-358.132) -- 0:00:25 571500 -- (-361.686) [-357.475] (-359.602) (-356.880) * (-356.657) [-360.874] (-359.416) (-359.602) -- 0:00:25 572000 -- (-358.841) (-360.979) (-359.883) [-356.075] * (-357.328) (-360.319) [-359.276] (-357.302) -- 0:00:25 572500 -- (-359.030) (-359.615) [-356.301] (-357.100) * (-359.590) (-357.455) [-359.188] (-357.581) -- 0:00:25 573000 -- (-357.633) (-357.425) (-358.767) [-357.972] * (-361.276) (-361.976) (-358.001) [-356.909] -- 0:00:25 573500 -- (-358.094) (-357.303) [-357.735] (-361.213) * (-356.394) (-358.942) (-359.098) [-359.303] -- 0:00:25 574000 -- [-361.449] (-361.341) (-359.379) (-360.193) * [-360.134] (-357.430) (-357.580) (-356.636) -- 0:00:25 574500 -- [-357.429] (-359.300) (-368.590) (-356.958) * (-359.899) (-358.312) (-358.941) [-356.258] -- 0:00:25 575000 -- (-358.479) [-357.620] (-362.619) (-357.330) * (-361.402) (-356.323) [-358.427] (-362.303) -- 0:00:25 Average standard deviation of split frequencies: 0.012440 575500 -- [-359.817] (-360.148) (-358.782) (-356.705) * (-360.354) (-356.495) [-356.379] (-356.286) -- 0:00:25 576000 -- (-359.262) (-361.486) [-357.661] (-356.917) * (-359.725) (-358.216) [-356.616] (-357.278) -- 0:00:25 576500 -- (-358.794) (-359.894) [-356.912] (-359.265) * (-359.366) [-357.941] (-358.900) (-358.346) -- 0:00:24 577000 -- (-358.281) (-358.698) [-357.532] (-361.671) * (-359.164) [-358.501] (-357.408) (-357.278) -- 0:00:24 577500 -- (-356.756) [-356.729] (-359.880) (-359.329) * (-357.765) [-357.223] (-356.825) (-358.140) -- 0:00:25 578000 -- (-358.413) (-356.778) [-356.976] (-359.120) * (-358.722) (-360.362) (-356.816) [-359.382] -- 0:00:25 578500 -- (-358.478) (-357.173) [-356.848] (-357.473) * (-357.210) (-359.562) (-358.131) [-357.252] -- 0:00:25 579000 -- (-359.805) (-358.673) (-357.102) [-357.149] * [-359.482] (-358.194) (-361.266) (-365.011) -- 0:00:25 579500 -- (-360.473) (-357.733) [-359.415] (-357.060) * (-356.957) [-356.409] (-357.874) (-364.943) -- 0:00:25 580000 -- [-357.226] (-361.449) (-361.961) (-357.623) * [-357.303] (-356.763) (-361.846) (-358.004) -- 0:00:25 Average standard deviation of split frequencies: 0.012177 580500 -- (-357.256) [-359.223] (-363.367) (-357.968) * (-359.496) (-357.671) (-358.511) [-357.668] -- 0:00:25 581000 -- (-357.793) (-358.093) (-361.264) [-358.256] * (-359.016) (-361.867) [-359.335] (-358.711) -- 0:00:25 581500 -- (-361.938) [-356.721] (-356.348) (-359.271) * [-357.594] (-357.114) (-358.456) (-360.767) -- 0:00:25 582000 -- (-357.595) (-360.821) [-357.131] (-358.262) * (-359.079) (-358.453) [-358.623] (-366.050) -- 0:00:25 582500 -- (-359.195) (-358.203) (-357.380) [-360.269] * (-357.943) (-361.087) (-359.587) [-364.419] -- 0:00:25 583000 -- (-358.257) (-358.061) [-356.894] (-357.218) * (-357.158) [-356.090] (-360.440) (-359.718) -- 0:00:25 583500 -- (-357.885) (-358.662) [-357.624] (-359.369) * (-359.518) (-360.498) (-356.960) [-357.112] -- 0:00:24 584000 -- (-356.938) (-358.109) [-359.079] (-361.236) * (-362.161) [-359.012] (-361.370) (-358.011) -- 0:00:24 584500 -- (-357.224) (-359.497) (-357.041) [-358.116] * [-358.361] (-357.772) (-357.807) (-357.772) -- 0:00:24 585000 -- (-358.758) (-357.165) [-358.982] (-356.649) * (-358.725) [-356.429] (-357.853) (-357.967) -- 0:00:24 Average standard deviation of split frequencies: 0.012218 585500 -- [-357.634] (-357.557) (-358.367) (-357.573) * (-360.739) (-356.711) [-356.760] (-357.641) -- 0:00:24 586000 -- [-356.704] (-357.811) (-357.499) (-356.205) * (-359.014) (-356.890) [-357.950] (-356.016) -- 0:00:24 586500 -- (-359.676) (-358.183) (-357.262) [-356.412] * [-357.896] (-358.901) (-358.050) (-361.690) -- 0:00:24 587000 -- (-357.280) (-357.716) [-358.117] (-358.558) * (-357.799) [-357.160] (-362.735) (-357.650) -- 0:00:24 587500 -- (-360.259) (-358.201) (-358.043) [-356.501] * (-358.800) (-357.487) [-359.725] (-360.034) -- 0:00:24 588000 -- (-359.179) (-359.935) [-360.310] (-357.586) * [-357.683] (-358.271) (-359.657) (-357.202) -- 0:00:24 588500 -- (-361.453) [-360.845] (-358.505) (-356.634) * (-358.302) (-359.161) (-359.275) [-358.576] -- 0:00:24 589000 -- (-359.374) (-362.005) [-358.400] (-356.422) * (-358.042) (-360.910) (-357.596) [-357.644] -- 0:00:24 589500 -- (-358.598) (-361.466) (-358.932) [-356.356] * (-360.912) (-366.069) [-357.753] (-359.108) -- 0:00:24 590000 -- (-357.621) [-358.348] (-359.222) (-361.264) * [-359.538] (-357.761) (-359.183) (-358.991) -- 0:00:24 Average standard deviation of split frequencies: 0.012869 590500 -- (-361.334) (-360.487) [-362.122] (-358.248) * [-360.656] (-359.480) (-357.931) (-357.856) -- 0:00:24 591000 -- [-357.757] (-359.587) (-358.590) (-360.406) * (-357.447) (-359.694) [-356.934] (-362.391) -- 0:00:24 591500 -- (-358.313) (-356.779) [-358.538] (-357.348) * (-357.554) (-359.938) [-356.360] (-358.380) -- 0:00:24 592000 -- (-357.561) (-358.193) (-359.256) [-360.256] * (-360.768) (-358.974) [-358.613] (-357.759) -- 0:00:24 592500 -- (-359.285) [-359.961] (-361.524) (-357.486) * (-359.207) (-357.441) [-358.304] (-357.162) -- 0:00:24 593000 -- (-359.667) (-356.702) [-357.520] (-357.482) * [-357.808] (-363.131) (-358.886) (-358.528) -- 0:00:24 593500 -- (-358.138) [-358.084] (-357.760) (-357.715) * (-359.669) [-362.070] (-357.892) (-357.632) -- 0:00:23 594000 -- (-356.943) (-361.369) (-359.541) [-361.004] * (-360.797) [-361.256] (-356.751) (-357.915) -- 0:00:23 594500 -- (-357.279) (-357.734) [-358.376] (-365.997) * [-357.610] (-357.262) (-362.605) (-359.941) -- 0:00:24 595000 -- [-358.218] (-362.100) (-359.061) (-359.696) * [-357.049] (-357.954) (-359.857) (-361.344) -- 0:00:24 Average standard deviation of split frequencies: 0.012606 595500 -- (-361.867) (-358.212) [-356.853] (-360.413) * (-358.512) [-357.505] (-358.821) (-360.827) -- 0:00:24 596000 -- (-360.038) [-360.017] (-358.441) (-357.977) * (-357.534) (-357.924) (-356.713) [-357.988] -- 0:00:24 596500 -- (-366.668) (-358.657) (-358.161) [-358.670] * [-357.999] (-360.620) (-358.183) (-358.277) -- 0:00:24 597000 -- [-359.947] (-356.776) (-360.827) (-357.998) * (-358.340) [-360.642] (-358.715) (-356.851) -- 0:00:24 597500 -- (-358.262) [-357.389] (-360.603) (-359.137) * [-359.393] (-356.967) (-358.198) (-359.669) -- 0:00:24 598000 -- (-356.356) (-359.393) (-357.728) [-357.718] * [-357.609] (-358.899) (-359.992) (-357.027) -- 0:00:24 598500 -- (-360.024) [-356.765] (-359.597) (-359.199) * (-359.281) (-361.821) (-357.348) [-361.677] -- 0:00:24 599000 -- (-363.733) [-356.973] (-358.040) (-358.186) * [-357.329] (-356.391) (-357.594) (-364.825) -- 0:00:24 599500 -- (-358.467) (-361.506) [-359.333] (-356.805) * (-360.072) [-356.948] (-359.349) (-359.440) -- 0:00:24 600000 -- (-358.257) (-360.054) [-358.266] (-358.014) * [-359.938] (-358.585) (-358.144) (-357.648) -- 0:00:24 Average standard deviation of split frequencies: 0.012851 600500 -- [-359.267] (-359.723) (-356.392) (-359.601) * (-358.429) [-358.099] (-358.651) (-364.031) -- 0:00:23 601000 -- (-358.506) (-356.940) [-366.498] (-358.535) * (-362.019) (-358.936) (-358.016) [-357.628] -- 0:00:23 601500 -- [-358.371] (-357.368) (-358.804) (-357.935) * [-357.490] (-356.676) (-359.454) (-361.023) -- 0:00:23 602000 -- (-356.481) (-361.522) (-357.378) [-360.258] * (-360.963) (-358.705) [-358.292] (-359.744) -- 0:00:23 602500 -- (-356.722) [-357.088] (-358.563) (-360.352) * (-362.524) (-357.736) [-357.736] (-357.827) -- 0:00:23 603000 -- (-356.556) [-358.319] (-356.856) (-359.379) * (-358.580) (-362.042) [-360.147] (-358.345) -- 0:00:23 603500 -- (-357.407) (-362.375) (-358.860) [-358.866] * (-357.656) [-357.616] (-359.097) (-362.188) -- 0:00:23 604000 -- (-358.532) [-357.266] (-360.296) (-357.066) * (-365.724) (-358.253) [-359.500] (-358.905) -- 0:00:23 604500 -- (-357.423) (-358.134) (-359.682) [-358.928] * (-358.127) (-356.634) [-357.577] (-358.006) -- 0:00:23 605000 -- (-357.583) (-359.972) (-361.334) [-359.311] * (-359.146) (-360.322) (-361.478) [-360.235] -- 0:00:23 Average standard deviation of split frequencies: 0.012300 605500 -- (-359.834) (-358.026) [-358.125] (-358.370) * (-358.626) (-356.265) (-357.698) [-362.778] -- 0:00:23 606000 -- [-359.141] (-357.003) (-358.902) (-357.329) * (-358.355) (-361.661) [-356.784] (-356.911) -- 0:00:23 606500 -- (-358.097) (-360.086) [-359.468] (-360.000) * (-357.776) (-360.017) (-358.447) [-357.493] -- 0:00:23 607000 -- (-360.010) [-357.271] (-356.482) (-362.121) * [-361.786] (-358.697) (-356.337) (-356.506) -- 0:00:23 607500 -- (-358.167) (-358.237) (-359.753) [-363.017] * (-360.368) (-360.249) [-357.711] (-358.987) -- 0:00:23 608000 -- (-358.974) [-359.139] (-359.546) (-357.176) * (-359.091) (-359.674) (-356.775) [-356.674] -- 0:00:23 608500 -- (-357.826) (-357.486) [-361.284] (-358.075) * [-357.083] (-358.917) (-357.397) (-357.273) -- 0:00:23 609000 -- (-358.635) (-356.057) (-360.527) [-358.886] * (-361.310) [-357.358] (-359.050) (-356.771) -- 0:00:23 609500 -- (-359.631) (-359.093) (-357.762) [-358.089] * (-356.431) [-359.913] (-357.512) (-356.880) -- 0:00:23 610000 -- [-356.603] (-357.471) (-356.999) (-357.886) * (-360.165) [-357.496] (-358.650) (-360.551) -- 0:00:23 Average standard deviation of split frequencies: 0.010904 610500 -- [-356.910] (-359.396) (-361.080) (-360.193) * (-357.640) (-359.980) [-356.956] (-357.087) -- 0:00:22 611000 -- (-358.653) [-357.479] (-359.357) (-357.769) * (-356.907) (-359.463) (-357.227) [-356.788] -- 0:00:23 611500 -- (-359.185) (-357.365) (-358.863) [-359.252] * [-358.447] (-356.549) (-357.504) (-356.941) -- 0:00:23 612000 -- (-361.320) (-360.807) (-358.609) [-357.504] * (-360.198) (-358.167) [-362.194] (-360.035) -- 0:00:23 612500 -- (-359.548) (-360.699) [-356.866] (-360.748) * (-358.559) (-359.967) (-359.094) [-356.664] -- 0:00:23 613000 -- [-359.484] (-358.604) (-357.153) (-358.456) * (-358.810) (-358.413) [-363.373] (-358.164) -- 0:00:23 613500 -- (-357.089) (-359.292) (-358.785) [-359.331] * (-360.635) (-356.972) (-356.793) [-357.460] -- 0:00:23 614000 -- (-357.377) (-361.941) (-359.713) [-358.021] * (-357.818) (-361.034) [-357.841] (-359.421) -- 0:00:23 614500 -- (-358.744) [-358.786] (-359.036) (-362.765) * [-357.241] (-359.546) (-358.233) (-360.293) -- 0:00:23 615000 -- (-357.904) (-360.861) (-360.802) [-358.623] * (-357.532) (-363.691) [-358.493] (-361.005) -- 0:00:23 Average standard deviation of split frequencies: 0.010522 615500 -- (-358.658) (-358.156) [-356.970] (-357.113) * [-357.580] (-359.894) (-358.689) (-363.707) -- 0:00:23 616000 -- (-357.476) (-360.387) (-361.797) [-357.965] * (-358.173) (-360.244) [-356.096] (-360.697) -- 0:00:23 616500 -- [-357.508] (-360.718) (-362.181) (-361.274) * (-362.011) (-359.781) (-357.649) [-360.883] -- 0:00:23 617000 -- (-357.114) [-359.455] (-359.157) (-357.201) * (-359.997) (-358.846) (-356.590) [-358.430] -- 0:00:22 617500 -- (-357.439) (-361.164) (-360.155) [-358.378] * (-361.149) (-360.608) [-359.054] (-357.914) -- 0:00:22 618000 -- [-357.468] (-359.130) (-359.961) (-360.530) * (-358.406) [-362.310] (-360.199) (-361.013) -- 0:00:22 618500 -- (-363.899) (-365.733) (-359.353) [-358.036] * (-361.810) (-356.891) [-359.098] (-357.568) -- 0:00:22 619000 -- (-357.660) (-357.443) (-356.920) [-357.495] * (-357.007) [-359.265] (-357.312) (-361.188) -- 0:00:22 619500 -- (-358.226) (-367.084) (-361.184) [-357.950] * [-358.054] (-360.143) (-357.778) (-361.889) -- 0:00:22 620000 -- (-357.756) (-359.283) (-358.763) [-357.629] * (-359.315) [-358.216] (-359.944) (-359.029) -- 0:00:22 Average standard deviation of split frequencies: 0.010111 620500 -- (-357.527) [-357.636] (-358.113) (-356.903) * (-358.505) (-359.545) (-357.209) [-357.038] -- 0:00:22 621000 -- [-356.623] (-360.013) (-359.142) (-356.920) * (-357.109) (-359.244) (-358.349) [-356.914] -- 0:00:22 621500 -- (-357.641) (-358.121) (-358.621) [-357.215] * (-358.882) (-361.397) [-359.416] (-360.549) -- 0:00:22 622000 -- (-361.107) [-357.262] (-357.974) (-358.311) * (-361.765) (-360.360) (-362.580) [-358.081] -- 0:00:22 622500 -- (-357.083) (-358.614) [-357.909] (-356.795) * [-357.773] (-356.819) (-358.979) (-356.873) -- 0:00:22 623000 -- (-357.319) [-359.403] (-358.893) (-358.098) * [-359.107] (-358.268) (-360.621) (-359.612) -- 0:00:22 623500 -- [-362.769] (-360.170) (-362.054) (-362.287) * (-359.244) [-358.409] (-360.649) (-358.955) -- 0:00:22 624000 -- (-361.794) [-359.467] (-360.628) (-358.801) * (-356.947) (-356.840) (-359.806) [-357.870] -- 0:00:22 624500 -- (-357.715) [-357.644] (-359.901) (-357.194) * (-359.591) [-357.872] (-360.590) (-358.454) -- 0:00:22 625000 -- (-358.163) (-357.540) (-359.384) [-358.549] * (-356.212) (-357.790) (-357.879) [-358.979] -- 0:00:22 Average standard deviation of split frequencies: 0.010260 625500 -- (-360.707) (-359.381) (-357.099) [-357.203] * (-357.104) (-356.594) (-357.690) [-357.594] -- 0:00:22 626000 -- [-358.268] (-358.242) (-356.692) (-357.299) * (-359.063) [-357.557] (-359.561) (-357.071) -- 0:00:22 626500 -- (-356.891) [-358.613] (-358.416) (-357.291) * (-358.727) (-359.262) [-359.156] (-357.693) -- 0:00:22 627000 -- (-358.099) (-356.808) [-358.472] (-360.970) * [-358.053] (-356.339) (-359.766) (-356.783) -- 0:00:22 627500 -- [-357.903] (-357.274) (-359.705) (-357.141) * (-358.526) (-364.686) (-363.557) [-357.294] -- 0:00:21 628000 -- (-359.561) (-356.636) (-362.737) [-357.083] * (-358.003) [-356.775] (-363.556) (-356.645) -- 0:00:21 628500 -- (-356.612) (-357.592) (-358.083) [-357.768] * (-358.102) (-360.407) [-357.741] (-357.576) -- 0:00:22 629000 -- [-358.487] (-358.952) (-359.227) (-357.907) * [-356.835] (-356.202) (-359.326) (-358.309) -- 0:00:22 629500 -- (-357.216) (-359.003) (-357.097) [-360.805] * (-358.208) (-357.066) [-356.611] (-364.276) -- 0:00:22 630000 -- [-357.755] (-360.643) (-358.347) (-360.383) * (-357.004) (-357.222) (-360.175) [-358.335] -- 0:00:22 Average standard deviation of split frequencies: 0.010166 630500 -- [-358.072] (-360.826) (-357.019) (-356.686) * [-358.812] (-359.075) (-356.376) (-356.727) -- 0:00:22 631000 -- (-358.040) (-356.946) (-357.566) [-357.035] * (-358.444) (-358.167) (-357.588) [-358.442] -- 0:00:22 631500 -- [-360.688] (-359.268) (-359.595) (-356.889) * (-358.251) (-357.611) (-357.154) [-356.776] -- 0:00:22 632000 -- (-359.057) [-357.903] (-364.428) (-357.241) * (-357.648) (-360.016) (-360.053) [-357.096] -- 0:00:22 632500 -- (-356.937) (-357.017) (-356.295) [-358.470] * (-357.644) (-362.660) [-358.992] (-360.195) -- 0:00:22 633000 -- (-357.666) [-358.080] (-359.418) (-358.342) * [-356.993] (-359.440) (-359.673) (-358.514) -- 0:00:22 633500 -- (-357.694) (-360.149) [-363.014] (-360.705) * (-357.173) (-357.794) [-359.799] (-358.560) -- 0:00:21 634000 -- (-358.183) [-359.633] (-357.836) (-359.004) * [-357.157] (-358.065) (-357.574) (-358.956) -- 0:00:21 634500 -- (-357.194) (-359.402) [-357.897] (-359.187) * [-356.657] (-361.955) (-357.280) (-356.245) -- 0:00:21 635000 -- (-358.922) [-358.230] (-358.959) (-357.672) * [-356.708] (-359.535) (-357.037) (-358.167) -- 0:00:21 Average standard deviation of split frequencies: 0.009883 635500 -- (-357.088) (-361.638) [-358.294] (-356.770) * [-358.158] (-356.904) (-358.820) (-357.795) -- 0:00:21 636000 -- (-359.393) (-359.184) [-357.520] (-359.893) * (-358.979) [-358.343] (-358.490) (-357.375) -- 0:00:21 636500 -- (-357.165) [-357.686] (-358.531) (-357.922) * (-357.245) (-357.507) (-359.300) [-358.466] -- 0:00:21 637000 -- [-360.219] (-358.626) (-356.709) (-358.893) * (-359.297) (-356.843) [-359.000] (-358.279) -- 0:00:21 637500 -- (-360.972) (-359.617) (-358.855) [-356.981] * (-361.437) (-361.181) (-357.857) [-357.330] -- 0:00:21 638000 -- (-361.337) (-360.047) (-360.070) [-358.132] * (-362.464) [-357.295] (-357.641) (-358.246) -- 0:00:21 638500 -- (-360.065) (-360.636) [-357.534] (-360.335) * [-361.860] (-359.165) (-356.053) (-364.160) -- 0:00:21 639000 -- (-358.317) (-360.453) [-357.751] (-358.197) * (-362.181) [-359.328] (-357.014) (-361.136) -- 0:00:21 639500 -- [-358.299] (-366.353) (-358.114) (-358.356) * (-358.640) [-356.217] (-359.498) (-358.358) -- 0:00:21 640000 -- (-357.740) (-360.498) [-358.201] (-358.834) * (-356.476) [-356.777] (-361.178) (-357.743) -- 0:00:21 Average standard deviation of split frequencies: 0.009762 640500 -- (-359.938) (-357.294) (-362.761) [-358.740] * [-357.874] (-359.042) (-358.334) (-361.401) -- 0:00:21 641000 -- (-357.234) (-357.755) [-359.000] (-359.640) * (-358.752) (-358.985) [-356.745] (-361.499) -- 0:00:21 641500 -- (-357.213) (-357.846) [-358.448] (-357.350) * (-359.655) [-357.965] (-357.314) (-358.000) -- 0:00:21 642000 -- (-356.871) [-359.433] (-358.663) (-358.603) * (-360.000) [-357.214] (-357.809) (-364.703) -- 0:00:21 642500 -- (-357.456) [-357.232] (-361.136) (-357.379) * (-364.328) (-356.846) (-360.621) [-357.306] -- 0:00:21 643000 -- (-358.612) (-359.730) [-360.816] (-357.843) * (-359.328) (-359.476) (-358.117) [-356.417] -- 0:00:21 643500 -- (-358.454) [-359.322] (-356.727) (-356.862) * [-357.204] (-357.679) (-356.267) (-360.831) -- 0:00:21 644000 -- (-361.173) [-357.584] (-357.353) (-356.760) * (-356.496) (-358.430) (-361.023) [-360.072] -- 0:00:21 644500 -- (-359.310) (-361.403) (-357.662) [-358.841] * (-356.956) (-357.834) [-357.316] (-359.513) -- 0:00:20 645000 -- (-359.297) (-358.709) [-359.084] (-357.615) * (-358.072) (-360.922) [-356.823] (-357.731) -- 0:00:20 Average standard deviation of split frequencies: 0.009778 645500 -- [-357.711] (-358.802) (-358.588) (-359.650) * [-356.498] (-359.979) (-358.071) (-358.915) -- 0:00:21 646000 -- (-357.884) (-356.906) (-358.866) [-361.704] * (-357.895) (-358.036) (-357.946) [-356.803] -- 0:00:21 646500 -- (-357.480) [-358.634] (-357.769) (-357.714) * (-363.808) (-357.892) [-358.008] (-357.461) -- 0:00:21 647000 -- (-359.423) (-362.615) (-356.339) [-358.153] * [-359.014] (-356.308) (-359.705) (-357.696) -- 0:00:21 647500 -- [-356.981] (-362.499) (-357.062) (-359.367) * (-363.767) [-357.170] (-358.833) (-359.100) -- 0:00:21 648000 -- (-360.013) [-356.819] (-357.022) (-358.090) * (-358.349) [-357.443] (-367.284) (-357.476) -- 0:00:21 648500 -- [-359.750] (-357.960) (-358.633) (-360.581) * [-359.388] (-359.215) (-365.772) (-357.101) -- 0:00:21 649000 -- (-356.696) [-358.201] (-357.440) (-364.646) * (-356.954) (-359.425) (-362.740) [-356.761] -- 0:00:21 649500 -- (-359.192) (-358.213) (-359.538) [-356.763] * (-357.070) (-357.392) (-360.850) [-356.691] -- 0:00:21 650000 -- (-358.689) (-364.180) (-358.170) [-358.379] * (-360.244) (-358.057) [-359.476] (-362.932) -- 0:00:21 Average standard deviation of split frequencies: 0.009612 650500 -- (-360.457) (-364.407) (-365.433) [-358.859] * (-357.924) (-359.243) [-358.045] (-358.009) -- 0:00:20 651000 -- [-356.823] (-357.491) (-363.877) (-357.980) * [-359.505] (-359.966) (-358.678) (-357.655) -- 0:00:20 651500 -- (-357.705) (-358.833) (-363.032) [-358.178] * (-357.517) [-357.992] (-359.296) (-358.093) -- 0:00:20 652000 -- (-360.248) [-358.070] (-364.554) (-358.580) * (-357.067) (-357.225) (-357.212) [-357.704] -- 0:00:20 652500 -- (-357.524) (-362.446) [-359.241] (-358.156) * (-357.844) [-358.777] (-361.995) (-356.837) -- 0:00:20 653000 -- (-361.916) (-356.709) [-359.095] (-363.221) * (-358.951) (-357.056) [-358.431] (-359.860) -- 0:00:20 653500 -- [-357.909] (-357.239) (-358.391) (-360.340) * (-356.888) [-357.418] (-358.812) (-357.379) -- 0:00:20 654000 -- (-355.989) [-356.592] (-359.384) (-357.203) * (-359.591) [-359.911] (-356.313) (-357.691) -- 0:00:20 654500 -- (-359.555) (-359.769) (-361.749) [-357.983] * (-356.225) (-357.912) (-356.821) [-360.513] -- 0:00:20 655000 -- (-357.198) (-360.541) (-361.493) [-358.446] * (-357.429) [-356.578] (-357.066) (-358.535) -- 0:00:20 Average standard deviation of split frequencies: 0.009294 655500 -- [-357.991] (-358.260) (-357.878) (-357.264) * (-356.447) [-358.241] (-356.831) (-357.212) -- 0:00:20 656000 -- (-363.545) (-356.730) [-357.089] (-359.191) * [-356.887] (-357.976) (-358.319) (-356.850) -- 0:00:20 656500 -- (-358.275) (-357.638) [-356.989] (-357.261) * (-358.722) [-357.894] (-358.585) (-357.910) -- 0:00:20 657000 -- (-357.156) (-360.237) [-357.382] (-358.788) * [-357.716] (-356.462) (-356.757) (-360.048) -- 0:00:20 657500 -- [-358.833] (-357.274) (-359.607) (-357.538) * (-356.327) [-359.612] (-356.904) (-356.769) -- 0:00:20 658000 -- [-360.137] (-356.998) (-357.415) (-356.518) * (-358.427) [-359.406] (-357.403) (-357.640) -- 0:00:20 658500 -- (-357.595) (-361.989) [-357.180] (-362.077) * (-366.536) (-359.862) (-358.528) [-359.062] -- 0:00:20 659000 -- (-357.819) (-359.980) (-357.414) [-359.117] * (-358.961) (-360.973) [-356.460] (-359.124) -- 0:00:20 659500 -- [-358.794] (-358.906) (-363.287) (-356.988) * [-360.564] (-360.116) (-357.950) (-359.411) -- 0:00:20 660000 -- (-358.372) (-356.458) [-360.896] (-358.472) * (-357.049) (-362.680) [-356.693] (-357.715) -- 0:00:20 Average standard deviation of split frequencies: 0.009704 660500 -- [-359.340] (-356.749) (-362.313) (-357.619) * (-356.633) (-358.066) (-360.868) [-358.471] -- 0:00:20 661000 -- (-357.806) (-359.015) [-359.591] (-359.857) * [-358.196] (-360.132) (-363.967) (-356.466) -- 0:00:20 661500 -- (-358.478) (-357.980) [-356.659] (-359.371) * [-356.478] (-359.964) (-359.795) (-359.241) -- 0:00:19 662000 -- [-361.316] (-359.445) (-356.359) (-360.779) * (-358.788) (-360.142) (-362.243) [-359.653] -- 0:00:20 662500 -- (-356.813) (-356.747) [-363.444] (-358.363) * [-365.524] (-358.754) (-359.767) (-357.884) -- 0:00:20 663000 -- (-357.393) [-357.232] (-358.685) (-357.451) * (-357.922) (-362.552) [-362.355] (-363.056) -- 0:00:20 663500 -- (-358.589) (-357.346) [-358.364] (-356.817) * (-356.764) (-361.073) (-362.154) [-357.117] -- 0:00:20 664000 -- (-356.529) (-360.723) (-359.253) [-356.991] * [-359.678] (-362.591) (-359.593) (-359.589) -- 0:00:20 664500 -- (-357.512) (-358.722) [-357.196] (-359.231) * (-358.933) [-360.092] (-358.136) (-362.212) -- 0:00:20 665000 -- (-356.839) (-356.759) (-358.881) [-356.871] * (-361.177) (-358.252) (-357.553) [-358.043] -- 0:00:20 Average standard deviation of split frequencies: 0.009673 665500 -- [-360.754] (-361.364) (-360.583) (-357.420) * (-357.521) (-357.370) (-362.438) [-357.989] -- 0:00:20 666000 -- (-358.274) [-357.307] (-356.247) (-360.550) * (-357.075) (-359.508) [-356.893] (-356.650) -- 0:00:20 666500 -- (-361.367) (-357.582) [-358.352] (-357.977) * (-361.489) (-361.438) [-359.015] (-359.242) -- 0:00:20 667000 -- (-356.927) (-361.967) (-359.641) [-361.180] * (-360.665) (-360.268) (-356.513) [-361.850] -- 0:00:19 667500 -- (-357.682) (-361.935) (-362.110) [-359.272] * (-360.941) (-356.531) (-358.804) [-356.767] -- 0:00:19 668000 -- (-360.443) [-358.001] (-357.382) (-359.099) * [-357.404] (-357.691) (-359.897) (-360.364) -- 0:00:19 668500 -- (-361.121) (-357.332) [-357.104] (-357.891) * (-356.737) [-357.127] (-358.817) (-358.994) -- 0:00:19 669000 -- (-362.644) (-359.973) [-357.100] (-359.206) * (-356.367) (-358.891) [-360.337] (-358.630) -- 0:00:19 669500 -- (-358.685) [-358.608] (-359.181) (-359.173) * [-358.831] (-360.319) (-359.367) (-357.990) -- 0:00:19 670000 -- (-358.505) [-358.388] (-360.698) (-358.383) * (-357.251) (-358.115) (-356.403) [-357.961] -- 0:00:19 Average standard deviation of split frequencies: 0.009419 670500 -- (-363.022) (-357.346) [-359.649] (-357.632) * (-358.346) (-358.191) [-357.133] (-361.490) -- 0:00:19 671000 -- (-359.096) [-357.819] (-360.712) (-359.219) * (-356.759) (-360.479) (-357.387) [-357.900] -- 0:00:19 671500 -- (-359.923) (-357.667) [-357.675] (-356.821) * (-356.937) (-357.261) [-360.887] (-358.512) -- 0:00:19 672000 -- (-357.415) (-361.023) (-358.365) [-357.595] * [-356.496] (-357.473) (-361.905) (-359.345) -- 0:00:19 672500 -- (-356.545) [-356.651] (-358.589) (-357.572) * (-356.540) [-356.749] (-361.436) (-357.808) -- 0:00:19 673000 -- (-360.210) (-360.531) [-359.107] (-358.095) * (-357.540) [-361.908] (-357.351) (-362.832) -- 0:00:19 673500 -- [-359.045] (-358.049) (-360.657) (-357.512) * (-361.522) (-359.243) (-357.633) [-361.717] -- 0:00:19 674000 -- (-359.768) (-358.188) [-357.042] (-358.472) * [-360.129] (-359.324) (-358.146) (-361.318) -- 0:00:19 674500 -- (-356.888) (-363.599) [-356.721] (-359.207) * (-356.400) [-357.919] (-357.134) (-360.807) -- 0:00:19 675000 -- (-356.429) (-357.738) (-355.986) [-356.532] * [-356.478] (-361.766) (-359.059) (-358.881) -- 0:00:19 Average standard deviation of split frequencies: 0.009484 675500 -- (-359.707) [-357.910] (-359.490) (-358.213) * (-357.505) (-360.313) [-358.796] (-358.329) -- 0:00:19 676000 -- (-357.658) [-357.891] (-357.884) (-359.576) * (-357.689) [-358.229] (-360.574) (-359.500) -- 0:00:19 676500 -- [-357.429] (-357.833) (-359.286) (-363.463) * (-361.906) [-356.308] (-359.605) (-359.226) -- 0:00:19 677000 -- (-358.679) [-357.791] (-358.931) (-360.835) * (-357.619) [-359.161] (-357.321) (-359.709) -- 0:00:19 677500 -- (-357.490) (-361.570) [-360.469] (-358.472) * [-358.681] (-359.930) (-358.908) (-356.775) -- 0:00:19 678000 -- (-360.092) (-359.036) (-363.752) [-359.139] * (-358.759) (-359.811) (-360.136) [-360.397] -- 0:00:18 678500 -- [-360.088] (-357.527) (-361.048) (-358.692) * (-359.214) (-357.221) (-361.999) [-360.850] -- 0:00:18 679000 -- (-358.136) [-357.107] (-358.291) (-359.115) * (-357.547) (-359.648) [-356.657] (-362.054) -- 0:00:19 679500 -- (-359.962) (-358.192) (-361.544) [-356.791] * (-356.448) (-358.051) [-356.634] (-360.402) -- 0:00:19 680000 -- [-357.887] (-361.294) (-357.513) (-358.443) * [-357.456] (-360.417) (-356.287) (-358.965) -- 0:00:19 Average standard deviation of split frequencies: 0.009188 680500 -- (-356.957) [-358.269] (-358.013) (-359.633) * [-357.712] (-360.162) (-357.867) (-358.555) -- 0:00:19 681000 -- [-356.891] (-358.652) (-356.372) (-362.650) * [-359.243] (-357.246) (-360.829) (-358.671) -- 0:00:19 681500 -- (-358.489) (-357.617) (-358.183) [-358.459] * (-359.874) (-361.365) [-359.476] (-356.588) -- 0:00:19 682000 -- [-360.656] (-356.139) (-360.371) (-359.453) * (-358.645) (-356.448) (-358.062) [-356.699] -- 0:00:19 682500 -- (-357.822) (-356.982) [-360.573] (-358.633) * [-357.497] (-359.156) (-357.078) (-359.304) -- 0:00:19 683000 -- (-357.390) (-357.581) (-357.829) [-356.922] * (-358.316) [-359.319] (-360.355) (-357.191) -- 0:00:19 683500 -- (-359.185) [-357.952] (-359.181) (-358.494) * (-360.369) (-356.949) (-357.081) [-356.577] -- 0:00:18 684000 -- (-357.145) (-358.275) (-357.638) [-357.061] * (-360.549) (-356.300) (-360.719) [-358.439] -- 0:00:18 684500 -- (-357.178) (-360.446) (-359.544) [-358.645] * (-357.392) (-358.664) [-358.336] (-356.800) -- 0:00:18 685000 -- (-360.084) (-356.732) [-358.571] (-360.417) * (-356.581) (-358.035) [-357.353] (-357.853) -- 0:00:18 Average standard deviation of split frequencies: 0.009483 685500 -- [-359.261] (-360.193) (-358.625) (-356.352) * (-356.540) (-357.865) [-357.172] (-358.400) -- 0:00:18 686000 -- [-360.794] (-357.455) (-357.425) (-356.539) * [-358.458] (-358.222) (-356.737) (-356.734) -- 0:00:18 686500 -- (-358.663) (-358.818) [-360.730] (-356.811) * [-361.445] (-356.243) (-358.691) (-358.455) -- 0:00:18 687000 -- (-357.660) (-356.464) [-357.139] (-360.188) * (-356.501) (-356.298) [-360.608] (-357.771) -- 0:00:18 687500 -- [-357.679] (-357.454) (-356.791) (-360.044) * (-357.977) (-356.140) (-360.820) [-359.824] -- 0:00:18 688000 -- [-359.131] (-358.933) (-360.555) (-362.739) * (-356.797) [-356.798] (-358.484) (-364.191) -- 0:00:18 688500 -- (-358.119) (-361.075) [-359.153] (-358.302) * [-356.411] (-358.405) (-359.226) (-360.495) -- 0:00:18 689000 -- (-360.482) (-359.482) [-358.780] (-360.602) * [-355.999] (-358.962) (-357.192) (-360.409) -- 0:00:18 689500 -- (-360.297) (-358.578) [-357.820] (-356.814) * (-357.070) [-361.029] (-356.577) (-359.985) -- 0:00:18 690000 -- [-359.363] (-356.944) (-358.315) (-359.368) * (-357.194) (-362.931) [-359.583] (-359.491) -- 0:00:18 Average standard deviation of split frequencies: 0.009692 690500 -- (-357.314) (-358.111) (-360.399) [-357.861] * (-356.863) (-357.898) [-357.594] (-357.152) -- 0:00:18 691000 -- (-357.646) (-358.066) (-357.167) [-357.020] * [-357.845] (-357.332) (-356.417) (-358.096) -- 0:00:18 691500 -- (-364.419) (-359.186) (-358.188) [-356.985] * (-356.767) (-360.398) [-356.214] (-357.100) -- 0:00:18 692000 -- (-364.854) [-356.893] (-357.755) (-360.777) * [-357.284] (-362.883) (-358.823) (-356.933) -- 0:00:18 692500 -- [-359.783] (-356.935) (-356.896) (-359.520) * (-357.546) (-359.143) (-363.345) [-358.079] -- 0:00:18 693000 -- [-357.129] (-359.241) (-357.082) (-356.547) * (-359.202) [-356.124] (-359.004) (-358.485) -- 0:00:18 693500 -- (-358.716) (-356.331) [-356.571] (-357.438) * (-356.804) [-356.431] (-358.963) (-360.354) -- 0:00:18 694000 -- (-358.588) (-358.137) (-357.093) [-357.530] * (-359.206) [-359.991] (-359.229) (-359.936) -- 0:00:18 694500 -- (-356.448) [-357.596] (-362.797) (-358.387) * [-356.682] (-356.870) (-359.524) (-359.108) -- 0:00:18 695000 -- (-358.458) (-362.048) [-357.768] (-365.730) * (-360.174) (-358.062) [-357.578] (-358.088) -- 0:00:17 Average standard deviation of split frequencies: 0.009482 695500 -- (-362.485) (-358.277) [-358.883] (-361.241) * [-358.372] (-359.248) (-360.966) (-358.315) -- 0:00:17 696000 -- (-358.735) (-360.141) [-358.225] (-360.772) * (-357.883) (-360.555) [-356.982] (-356.663) -- 0:00:18 696500 -- (-356.300) [-357.473] (-358.639) (-362.723) * [-356.268] (-362.797) (-356.575) (-356.402) -- 0:00:18 697000 -- (-356.720) [-357.106] (-356.217) (-366.277) * (-358.468) (-362.729) [-360.522] (-361.055) -- 0:00:18 697500 -- (-357.063) (-361.372) [-361.972] (-357.611) * (-357.842) (-359.947) (-365.870) [-356.798] -- 0:00:18 698000 -- (-356.590) [-360.273] (-356.873) (-356.962) * (-357.485) (-357.977) (-360.074) [-357.257] -- 0:00:18 698500 -- (-359.671) (-362.762) [-356.633] (-358.769) * (-358.638) [-359.432] (-358.875) (-358.983) -- 0:00:18 699000 -- (-360.063) (-362.767) (-360.506) [-360.698] * (-358.460) (-356.483) [-356.811] (-363.321) -- 0:00:18 699500 -- [-358.202] (-359.070) (-357.205) (-361.061) * [-357.388] (-357.939) (-361.504) (-360.444) -- 0:00:18 700000 -- (-359.146) (-362.964) [-359.225] (-357.564) * [-358.974] (-358.636) (-359.089) (-358.299) -- 0:00:18 Average standard deviation of split frequencies: 0.009419 700500 -- (-359.707) [-357.546] (-358.390) (-357.590) * [-361.563] (-364.227) (-357.585) (-365.683) -- 0:00:17 701000 -- (-358.345) (-360.321) [-359.192] (-365.058) * (-359.176) (-357.475) [-357.776] (-359.911) -- 0:00:17 701500 -- (-359.281) [-357.173] (-360.136) (-356.833) * (-357.633) [-356.988] (-356.107) (-358.211) -- 0:00:17 702000 -- [-359.730] (-357.527) (-360.358) (-358.251) * (-358.499) [-356.309] (-357.141) (-359.013) -- 0:00:17 702500 -- (-358.387) (-361.410) [-357.727] (-358.083) * (-356.597) (-358.469) (-357.035) [-359.133] -- 0:00:17 703000 -- [-356.402] (-358.871) (-360.940) (-358.367) * (-356.328) (-357.471) (-358.770) [-360.043] -- 0:00:17 703500 -- (-361.810) [-360.635] (-358.404) (-362.575) * (-357.778) (-359.733) (-357.447) [-361.410] -- 0:00:17 704000 -- [-357.775] (-359.027) (-357.565) (-358.196) * [-357.083] (-358.220) (-357.444) (-358.103) -- 0:00:17 704500 -- [-357.621] (-356.906) (-356.607) (-357.960) * [-360.171] (-366.717) (-359.673) (-358.199) -- 0:00:17 705000 -- [-357.964] (-358.010) (-356.594) (-356.910) * [-359.290] (-357.513) (-359.949) (-358.264) -- 0:00:17 Average standard deviation of split frequencies: 0.009259 705500 -- (-357.534) (-359.345) [-356.580] (-358.169) * [-360.395] (-359.479) (-357.917) (-358.826) -- 0:00:17 706000 -- (-357.873) (-356.953) [-359.212] (-356.446) * (-358.901) [-357.623] (-358.903) (-357.368) -- 0:00:17 706500 -- (-358.708) [-357.957] (-358.576) (-359.098) * (-356.645) (-357.463) (-356.349) [-357.924] -- 0:00:17 707000 -- (-359.380) [-359.246] (-359.193) (-362.610) * (-356.783) (-357.045) [-356.396] (-359.445) -- 0:00:17 707500 -- (-360.610) (-356.877) [-358.981] (-361.101) * (-361.436) [-356.684] (-357.223) (-359.271) -- 0:00:17 708000 -- [-357.866] (-362.358) (-359.951) (-359.720) * (-358.097) [-357.075] (-356.964) (-357.351) -- 0:00:17 708500 -- (-357.651) [-357.838] (-365.913) (-356.848) * (-360.237) [-358.164] (-357.150) (-360.970) -- 0:00:17 709000 -- (-358.056) [-358.496] (-363.825) (-361.857) * [-357.861] (-356.358) (-359.670) (-357.531) -- 0:00:17 709500 -- (-359.301) (-356.641) [-361.606] (-359.642) * (-357.138) (-359.606) [-357.982] (-357.372) -- 0:00:17 710000 -- [-357.226] (-360.274) (-357.741) (-359.022) * (-360.074) [-357.860] (-359.365) (-360.325) -- 0:00:17 Average standard deviation of split frequencies: 0.009021 710500 -- (-359.712) (-366.098) [-356.636] (-358.217) * (-357.759) (-357.770) [-359.010] (-358.393) -- 0:00:17 711000 -- (-356.850) (-356.869) (-363.512) [-356.844] * (-358.841) (-357.455) (-359.010) [-357.024] -- 0:00:17 711500 -- [-356.130] (-360.160) (-364.502) (-356.399) * [-358.097] (-357.693) (-360.148) (-356.815) -- 0:00:17 712000 -- [-357.385] (-357.371) (-356.924) (-358.152) * (-358.602) (-357.445) (-357.641) [-358.607] -- 0:00:16 712500 -- (-357.943) [-357.907] (-357.725) (-359.598) * (-360.526) (-358.521) [-357.533] (-356.370) -- 0:00:16 713000 -- (-357.337) [-360.060] (-357.220) (-358.229) * (-358.901) (-357.299) [-360.617] (-358.054) -- 0:00:17 713500 -- (-357.289) (-357.570) (-358.410) [-358.393] * [-356.542] (-360.050) (-357.599) (-361.485) -- 0:00:17 714000 -- (-356.686) (-360.680) (-358.588) [-357.801] * (-357.596) [-357.206] (-356.985) (-359.790) -- 0:00:17 714500 -- (-356.388) (-358.449) [-358.010] (-359.961) * (-359.102) (-357.093) (-357.049) [-357.360] -- 0:00:17 715000 -- (-358.349) (-360.015) [-356.973] (-359.428) * (-358.191) [-359.401] (-358.857) (-361.231) -- 0:00:17 Average standard deviation of split frequencies: 0.009086 715500 -- (-358.873) (-356.342) [-359.013] (-361.312) * (-358.008) (-357.247) [-358.618] (-358.115) -- 0:00:17 716000 -- (-357.092) (-356.143) [-358.360] (-360.068) * (-360.204) [-357.987] (-359.987) (-357.578) -- 0:00:17 716500 -- (-362.064) (-356.973) [-357.332] (-359.256) * (-357.528) (-359.968) [-359.747] (-359.307) -- 0:00:17 717000 -- [-357.769] (-360.691) (-357.359) (-359.993) * [-358.514] (-358.096) (-360.389) (-361.376) -- 0:00:16 717500 -- [-358.676] (-357.946) (-357.081) (-361.316) * (-359.194) (-357.850) [-356.485] (-359.665) -- 0:00:16 718000 -- [-358.884] (-365.150) (-356.465) (-357.071) * (-362.806) (-359.014) (-356.324) [-357.534] -- 0:00:16 718500 -- (-360.739) (-359.496) (-357.585) [-357.592] * [-360.065] (-357.270) (-358.983) (-359.660) -- 0:00:16 719000 -- (-356.690) (-363.694) [-357.620] (-357.338) * (-357.912) [-357.664] (-358.531) (-358.298) -- 0:00:16 719500 -- (-356.561) (-357.479) (-360.265) [-357.690] * (-356.799) [-359.814] (-357.035) (-358.829) -- 0:00:16 720000 -- (-357.168) (-358.420) [-357.020] (-361.265) * (-362.789) [-361.112] (-356.110) (-357.238) -- 0:00:16 Average standard deviation of split frequencies: 0.009637 720500 -- (-356.759) (-358.511) [-356.405] (-366.982) * (-359.843) [-362.470] (-357.112) (-359.366) -- 0:00:16 721000 -- (-357.040) (-357.911) [-360.703] (-369.375) * [-358.521] (-358.152) (-358.868) (-359.097) -- 0:00:16 721500 -- (-356.413) (-359.492) (-357.526) [-361.088] * (-360.690) [-357.886] (-360.026) (-357.037) -- 0:00:16 722000 -- [-358.400] (-358.706) (-366.820) (-362.690) * (-357.262) [-359.814] (-359.408) (-361.703) -- 0:00:16 722500 -- (-358.106) (-362.291) [-362.281] (-360.858) * (-357.082) (-358.471) (-359.314) [-357.828] -- 0:00:16 723000 -- [-358.000] (-358.168) (-357.417) (-359.539) * (-357.582) (-357.456) [-358.378] (-359.361) -- 0:00:16 723500 -- (-360.587) [-363.026] (-364.171) (-360.307) * [-358.667] (-356.116) (-358.700) (-356.947) -- 0:00:16 724000 -- [-360.400] (-360.863) (-359.272) (-366.738) * (-357.829) [-357.499] (-358.764) (-356.021) -- 0:00:16 724500 -- (-359.661) (-359.455) (-356.324) [-357.642] * [-360.310] (-359.410) (-356.023) (-360.887) -- 0:00:16 725000 -- (-358.862) [-356.634] (-356.467) (-364.090) * (-359.208) [-358.841] (-357.555) (-360.543) -- 0:00:16 Average standard deviation of split frequencies: 0.009983 725500 -- (-359.115) (-357.139) [-356.794] (-357.550) * (-357.320) (-360.075) [-358.834] (-356.123) -- 0:00:16 726000 -- [-359.852] (-359.810) (-358.295) (-358.166) * [-358.072] (-358.527) (-357.544) (-357.370) -- 0:00:16 726500 -- (-357.067) [-361.273] (-358.458) (-357.607) * (-363.708) (-361.157) (-357.640) [-356.998] -- 0:00:16 727000 -- (-359.566) [-357.091] (-358.588) (-358.205) * [-357.158] (-360.009) (-358.134) (-360.342) -- 0:00:16 727500 -- (-358.981) (-356.694) [-356.935] (-360.337) * (-357.572) [-357.574] (-358.988) (-356.111) -- 0:00:16 728000 -- (-361.527) (-357.090) (-356.510) [-356.761] * (-357.003) (-358.791) (-360.306) [-356.211] -- 0:00:16 728500 -- [-357.633] (-358.474) (-357.480) (-357.223) * [-356.985] (-357.821) (-356.819) (-357.224) -- 0:00:16 729000 -- (-360.426) [-356.919] (-356.883) (-357.286) * [-358.675] (-362.824) (-358.015) (-356.672) -- 0:00:15 729500 -- (-358.398) (-357.374) [-356.859] (-357.890) * (-362.900) (-366.933) (-358.954) [-359.757] -- 0:00:15 730000 -- (-358.132) [-358.457] (-358.960) (-356.179) * (-357.802) (-357.221) [-357.899] (-356.701) -- 0:00:16 Average standard deviation of split frequencies: 0.009637 730500 -- (-359.315) (-358.256) (-361.088) [-357.268] * (-357.255) (-357.426) (-356.852) [-357.953] -- 0:00:16 731000 -- (-358.131) (-358.781) [-358.997] (-360.956) * [-361.473] (-357.278) (-359.674) (-358.878) -- 0:00:16 731500 -- [-356.852] (-359.668) (-358.031) (-359.736) * (-363.365) [-357.235] (-357.130) (-362.376) -- 0:00:16 732000 -- (-357.395) [-357.069] (-357.082) (-357.225) * (-358.747) [-358.438] (-359.620) (-357.772) -- 0:00:16 732500 -- (-358.405) (-358.117) [-357.905] (-356.651) * (-356.650) (-358.671) [-357.270] (-358.410) -- 0:00:16 733000 -- (-360.565) [-357.651] (-359.818) (-357.363) * [-359.056] (-360.011) (-358.723) (-357.528) -- 0:00:16 733500 -- (-361.674) (-356.714) (-359.854) [-357.853] * (-358.653) (-357.382) [-358.372] (-360.628) -- 0:00:15 734000 -- (-356.712) (-356.238) (-359.205) [-358.610] * (-358.175) [-362.152] (-358.334) (-362.300) -- 0:00:15 734500 -- (-359.917) [-356.198] (-360.115) (-358.776) * (-364.367) (-359.801) [-360.463] (-357.899) -- 0:00:15 735000 -- (-359.340) (-359.659) [-358.551] (-360.148) * (-358.947) [-359.803] (-359.474) (-359.018) -- 0:00:15 Average standard deviation of split frequencies: 0.009647 735500 -- (-356.133) [-356.888] (-359.651) (-362.290) * [-359.136] (-357.956) (-359.589) (-365.541) -- 0:00:15 736000 -- (-356.100) (-357.895) (-359.819) [-356.738] * (-356.488) [-359.485] (-359.325) (-362.454) -- 0:00:15 736500 -- [-357.994] (-357.975) (-356.495) (-367.143) * (-358.316) [-359.743] (-361.177) (-358.121) -- 0:00:15 737000 -- [-357.893] (-358.077) (-356.824) (-357.741) * (-356.998) (-363.037) [-357.263] (-360.430) -- 0:00:15 737500 -- (-359.160) (-358.394) [-358.428] (-357.646) * (-356.579) [-357.598] (-358.279) (-357.675) -- 0:00:15 738000 -- (-359.617) [-359.140] (-357.779) (-361.766) * (-357.024) (-357.850) [-360.818] (-359.510) -- 0:00:15 738500 -- (-358.921) (-356.559) [-359.197] (-357.224) * (-357.053) (-357.601) (-357.841) [-356.166] -- 0:00:15 739000 -- (-358.840) [-356.163] (-357.607) (-358.649) * (-358.361) [-356.470] (-357.320) (-356.016) -- 0:00:15 739500 -- [-358.221] (-357.755) (-358.100) (-362.994) * (-356.419) (-357.949) (-360.137) [-358.186] -- 0:00:15 740000 -- (-359.837) [-356.956] (-367.730) (-358.082) * (-359.031) (-359.013) (-363.332) [-358.929] -- 0:00:15 Average standard deviation of split frequencies: 0.009666 740500 -- (-357.216) (-357.477) [-358.855] (-356.693) * [-357.364] (-357.821) (-359.690) (-357.510) -- 0:00:15 741000 -- [-357.394] (-362.329) (-359.836) (-358.283) * (-357.149) (-356.164) (-356.185) [-356.552] -- 0:00:15 741500 -- (-361.989) (-358.337) [-357.384] (-359.566) * (-357.957) [-356.865] (-358.716) (-362.509) -- 0:00:15 742000 -- [-360.262] (-359.014) (-357.700) (-356.890) * (-357.789) (-358.770) (-356.474) [-358.993] -- 0:00:15 742500 -- (-358.965) (-359.319) (-359.135) [-360.398] * (-357.669) (-358.501) (-357.157) [-357.594] -- 0:00:15 743000 -- [-359.457] (-357.816) (-357.485) (-358.095) * (-358.806) (-357.260) [-358.372] (-357.062) -- 0:00:15 743500 -- (-358.392) (-359.534) (-358.293) [-358.479] * (-357.384) [-356.929] (-357.951) (-361.837) -- 0:00:15 744000 -- (-359.324) (-357.833) (-361.044) [-358.042] * (-362.678) [-356.571] (-359.587) (-356.430) -- 0:00:15 744500 -- (-357.947) [-359.097] (-358.079) (-358.575) * (-357.752) (-358.174) [-359.251] (-359.849) -- 0:00:15 745000 -- (-360.309) [-357.745] (-361.093) (-362.652) * [-357.748] (-363.980) (-358.137) (-357.402) -- 0:00:15 Average standard deviation of split frequencies: 0.009676 745500 -- (-357.556) (-357.684) (-360.632) [-360.927] * (-358.892) (-372.849) (-359.939) [-359.512] -- 0:00:15 746000 -- (-357.984) [-357.492] (-358.896) (-357.319) * (-356.887) (-366.735) [-365.163] (-360.134) -- 0:00:14 746500 -- (-358.389) (-357.191) (-360.531) [-356.905] * (-357.807) (-369.955) [-364.201] (-359.301) -- 0:00:14 747000 -- [-358.766] (-363.781) (-358.228) (-358.388) * (-359.145) (-360.062) (-358.747) [-362.643] -- 0:00:14 747500 -- (-358.681) [-357.257] (-356.996) (-358.188) * [-358.896] (-360.116) (-357.296) (-358.699) -- 0:00:15 748000 -- (-358.195) (-360.426) [-357.187] (-357.504) * (-359.023) (-364.613) (-360.176) [-361.195] -- 0:00:15 748500 -- (-356.824) [-357.914] (-359.018) (-358.224) * (-356.077) (-360.113) (-357.516) [-358.309] -- 0:00:15 749000 -- (-356.980) (-358.503) (-357.746) [-359.334] * (-357.301) [-358.612] (-359.303) (-357.788) -- 0:00:15 749500 -- [-363.863] (-358.669) (-357.015) (-360.487) * (-357.211) (-357.158) (-356.547) [-360.018] -- 0:00:15 750000 -- [-357.970] (-360.986) (-362.336) (-357.750) * (-358.348) [-356.255] (-357.863) (-358.921) -- 0:00:15 Average standard deviation of split frequencies: 0.009380 750500 -- [-358.381] (-356.887) (-356.998) (-357.885) * [-357.584] (-356.251) (-359.211) (-360.296) -- 0:00:14 751000 -- (-357.431) [-358.550] (-358.230) (-358.156) * (-358.266) (-359.647) (-359.095) [-362.980] -- 0:00:14 751500 -- (-358.090) [-355.988] (-363.085) (-359.491) * (-358.802) (-356.342) [-359.054] (-361.246) -- 0:00:14 752000 -- (-357.874) (-358.895) (-358.040) [-360.710] * (-360.597) [-356.165] (-360.687) (-360.403) -- 0:00:14 752500 -- (-359.260) (-361.066) [-357.367] (-357.818) * (-361.372) (-357.466) [-359.859] (-358.690) -- 0:00:14 753000 -- (-357.365) (-357.878) [-357.425] (-357.538) * (-359.988) [-356.236] (-362.686) (-357.155) -- 0:00:14 753500 -- (-358.071) [-357.388] (-357.262) (-360.390) * [-358.321] (-358.977) (-357.569) (-356.885) -- 0:00:14 754000 -- (-359.317) (-356.851) [-357.578] (-356.929) * (-360.050) (-360.311) (-359.080) [-358.604] -- 0:00:14 754500 -- [-357.607] (-360.018) (-358.015) (-356.084) * (-362.614) (-358.099) (-358.529) [-359.853] -- 0:00:14 755000 -- (-360.528) (-356.155) [-357.647] (-357.842) * (-356.203) (-358.956) (-359.317) [-359.089] -- 0:00:14 Average standard deviation of split frequencies: 0.009470 755500 -- (-363.453) [-358.465] (-361.955) (-358.979) * (-356.130) (-360.858) [-364.733] (-356.494) -- 0:00:14 756000 -- (-363.319) [-356.755] (-358.817) (-358.299) * (-356.309) [-360.665] (-362.669) (-357.446) -- 0:00:14 756500 -- [-360.087] (-356.615) (-361.478) (-358.495) * (-359.047) (-358.116) [-360.907] (-359.204) -- 0:00:14 757000 -- (-360.506) (-356.758) [-358.242] (-357.084) * (-358.088) (-358.722) [-358.449] (-362.347) -- 0:00:14 757500 -- (-356.721) [-358.351] (-358.663) (-358.921) * (-359.356) (-357.971) (-359.320) [-359.516] -- 0:00:14 758000 -- (-359.565) [-358.168] (-357.434) (-363.899) * (-358.404) [-358.942] (-359.899) (-358.775) -- 0:00:14 758500 -- (-357.440) [-363.201] (-356.883) (-358.225) * [-356.722] (-358.281) (-357.742) (-357.020) -- 0:00:14 759000 -- [-356.959] (-362.396) (-357.332) (-358.712) * (-357.255) [-357.200] (-360.714) (-358.225) -- 0:00:14 759500 -- (-356.671) [-357.532] (-358.003) (-357.685) * (-362.617) (-357.720) (-358.347) [-362.382] -- 0:00:14 760000 -- (-357.370) [-356.453] (-356.908) (-356.833) * (-358.820) (-357.357) (-360.477) [-360.067] -- 0:00:14 Average standard deviation of split frequencies: 0.009916 760500 -- (-356.395) (-361.482) (-358.647) [-357.869] * (-357.911) (-359.089) [-359.749] (-359.217) -- 0:00:14 761000 -- (-361.003) (-359.086) (-356.541) [-358.372] * [-357.383] (-360.434) (-358.221) (-358.517) -- 0:00:14 761500 -- (-358.402) (-361.277) [-358.965] (-358.869) * (-358.032) [-358.804] (-359.477) (-360.026) -- 0:00:14 762000 -- [-357.765] (-358.900) (-365.281) (-359.962) * (-357.910) [-360.467] (-359.758) (-358.279) -- 0:00:14 762500 -- (-356.055) [-360.443] (-360.623) (-357.886) * (-360.264) [-358.244] (-357.586) (-359.332) -- 0:00:14 763000 -- (-358.723) (-357.884) [-359.398] (-360.363) * (-360.396) (-361.339) (-358.679) [-359.617] -- 0:00:13 763500 -- (-359.618) (-357.777) [-357.522] (-362.153) * [-357.576] (-362.870) (-357.220) (-357.937) -- 0:00:13 764000 -- (-357.238) (-355.959) [-357.475] (-357.427) * (-357.672) [-356.498] (-357.585) (-362.529) -- 0:00:14 764500 -- [-358.639] (-358.191) (-356.618) (-361.083) * (-357.215) (-358.415) (-356.738) [-358.037] -- 0:00:14 765000 -- [-361.871] (-359.520) (-357.926) (-357.822) * (-356.029) [-357.053] (-357.845) (-357.959) -- 0:00:14 Average standard deviation of split frequencies: 0.010000 765500 -- (-361.076) (-358.437) [-356.832] (-358.114) * [-356.834] (-356.436) (-359.318) (-357.331) -- 0:00:14 766000 -- (-360.550) [-358.080] (-362.790) (-358.043) * (-358.726) (-359.329) [-358.809] (-357.501) -- 0:00:14 766500 -- (-356.832) (-356.598) [-358.678] (-359.583) * (-358.921) (-358.521) [-357.388] (-359.242) -- 0:00:14 767000 -- (-359.318) (-357.664) (-357.826) [-361.688] * (-358.528) (-357.530) (-357.632) [-356.504] -- 0:00:13 767500 -- (-358.022) (-363.545) [-357.409] (-358.752) * (-357.255) [-357.055] (-357.133) (-358.062) -- 0:00:13 768000 -- (-357.118) (-359.930) [-359.679] (-361.145) * (-358.809) (-359.072) (-356.810) [-356.184] -- 0:00:13 768500 -- (-357.123) (-361.148) (-356.286) [-356.896] * (-358.055) [-358.437] (-357.508) (-357.046) -- 0:00:13 769000 -- (-359.218) (-366.932) (-356.286) [-357.155] * (-357.518) (-360.714) [-358.040] (-357.188) -- 0:00:13 769500 -- [-358.273] (-362.454) (-357.155) (-362.327) * [-358.338] (-356.226) (-357.836) (-360.302) -- 0:00:13 770000 -- (-358.782) (-358.081) (-359.198) [-357.996] * (-357.315) (-356.413) [-357.190] (-360.328) -- 0:00:13 Average standard deviation of split frequencies: 0.009420 770500 -- [-357.898] (-359.451) (-358.109) (-357.687) * (-366.624) [-356.895] (-358.301) (-358.493) -- 0:00:13 771000 -- (-356.836) (-358.883) (-357.040) [-359.518] * (-363.113) (-359.552) [-356.777] (-357.134) -- 0:00:13 771500 -- (-361.746) (-357.382) [-357.827] (-357.539) * (-356.810) (-361.801) [-357.344] (-362.552) -- 0:00:13 772000 -- (-356.897) [-358.607] (-356.592) (-358.315) * [-358.484] (-357.688) (-356.432) (-357.225) -- 0:00:13 772500 -- [-358.160] (-357.283) (-364.257) (-358.880) * [-358.505] (-361.243) (-358.905) (-357.297) -- 0:00:13 773000 -- (-358.753) [-355.912] (-359.106) (-358.776) * (-356.586) (-358.002) (-358.239) [-356.692] -- 0:00:13 773500 -- [-359.163] (-359.374) (-359.687) (-359.287) * (-358.458) (-357.907) [-359.760] (-358.710) -- 0:00:13 774000 -- (-358.448) (-358.873) (-358.279) [-362.583] * (-358.763) (-359.323) [-359.683] (-357.786) -- 0:00:13 774500 -- (-356.378) [-357.620] (-358.104) (-364.026) * (-356.885) (-359.322) (-359.573) [-358.209] -- 0:00:13 775000 -- (-357.750) (-359.868) [-356.948] (-356.491) * (-357.895) (-358.604) [-358.680] (-357.318) -- 0:00:13 Average standard deviation of split frequencies: 0.009598 775500 -- [-358.561] (-358.663) (-357.706) (-357.917) * (-358.908) (-360.330) (-357.446) [-359.219] -- 0:00:13 776000 -- (-360.342) (-358.815) [-359.529] (-358.998) * (-359.191) (-358.436) (-358.120) [-357.324] -- 0:00:13 776500 -- [-358.668] (-356.667) (-357.383) (-358.057) * [-359.752] (-358.647) (-360.992) (-356.220) -- 0:00:13 777000 -- (-358.458) (-356.566) [-356.663] (-361.933) * (-361.277) (-361.705) (-361.517) [-360.653] -- 0:00:13 777500 -- (-357.253) [-357.344] (-362.488) (-358.469) * (-359.911) (-362.912) [-359.706] (-358.104) -- 0:00:13 778000 -- (-356.330) (-359.044) (-358.418) [-359.972] * (-360.204) [-357.744] (-358.631) (-357.632) -- 0:00:13 778500 -- (-359.567) (-356.874) [-357.046] (-361.284) * (-362.073) [-357.337] (-361.813) (-356.337) -- 0:00:13 779000 -- (-359.336) (-361.759) (-357.281) [-356.360] * [-357.932] (-359.525) (-359.721) (-356.839) -- 0:00:13 779500 -- [-357.822] (-358.672) (-361.993) (-360.617) * (-357.908) (-359.903) (-358.086) [-356.106] -- 0:00:13 780000 -- [-359.018] (-358.520) (-357.071) (-360.536) * (-357.073) (-357.414) (-358.562) [-356.517] -- 0:00:12 Average standard deviation of split frequencies: 0.009581 780500 -- [-357.197] (-358.669) (-359.804) (-357.544) * (-358.838) [-356.799] (-359.971) (-357.510) -- 0:00:12 781000 -- [-359.359] (-358.022) (-358.197) (-362.352) * (-360.414) (-356.305) [-361.283] (-358.656) -- 0:00:12 781500 -- (-359.851) (-362.424) (-357.687) [-358.659] * [-357.373] (-357.741) (-361.839) (-356.375) -- 0:00:13 782000 -- (-357.707) (-360.656) (-364.637) [-358.788] * (-361.279) (-357.496) (-356.484) [-355.997] -- 0:00:13 782500 -- (-359.621) (-360.142) [-361.087] (-356.799) * (-359.650) (-357.110) (-361.458) [-356.305] -- 0:00:13 783000 -- (-361.583) (-357.957) [-357.900] (-359.206) * (-359.133) (-366.730) (-357.878) [-356.858] -- 0:00:13 783500 -- (-358.058) (-361.675) (-358.150) [-359.384] * (-357.753) (-359.827) [-357.884] (-357.459) -- 0:00:12 784000 -- (-358.232) (-357.923) [-356.266] (-358.469) * (-357.966) [-359.449] (-359.188) (-360.999) -- 0:00:12 784500 -- (-357.507) (-358.964) (-356.403) [-356.700] * (-358.278) [-359.770] (-358.054) (-359.355) -- 0:00:12 785000 -- (-357.044) (-357.431) (-359.709) [-357.080] * [-359.526] (-358.692) (-357.412) (-363.028) -- 0:00:12 Average standard deviation of split frequencies: 0.009916 785500 -- (-357.454) (-356.753) (-362.087) [-356.916] * (-360.651) (-359.424) [-359.177] (-361.708) -- 0:00:12 786000 -- (-358.955) (-358.566) (-356.043) [-358.493] * [-358.335] (-357.181) (-356.768) (-358.481) -- 0:00:12 786500 -- [-359.236] (-357.179) (-356.362) (-359.422) * (-357.707) (-360.851) (-357.627) [-359.762] -- 0:00:12 787000 -- [-359.118] (-356.636) (-359.471) (-358.017) * [-359.735] (-356.830) (-359.934) (-359.492) -- 0:00:12 787500 -- (-359.595) [-356.160] (-357.047) (-360.652) * [-356.113] (-361.905) (-357.762) (-358.567) -- 0:00:12 788000 -- (-358.002) [-357.379] (-360.297) (-358.678) * [-356.319] (-358.835) (-360.805) (-361.143) -- 0:00:12 788500 -- [-358.660] (-359.835) (-363.583) (-361.205) * (-360.928) (-356.268) (-357.478) [-357.168] -- 0:00:12 789000 -- (-358.534) [-356.185] (-361.083) (-357.734) * (-358.947) (-357.225) (-360.032) [-357.583] -- 0:00:12 789500 -- (-358.151) [-356.076] (-360.437) (-357.638) * (-357.815) [-357.294] (-361.845) (-358.926) -- 0:00:12 790000 -- [-360.846] (-357.225) (-363.049) (-357.098) * [-358.033] (-358.422) (-363.545) (-356.787) -- 0:00:12 Average standard deviation of split frequencies: 0.009937 790500 -- (-357.093) (-358.303) [-357.401] (-356.761) * (-358.135) (-358.989) [-356.594] (-357.933) -- 0:00:12 791000 -- (-357.961) [-357.277] (-357.486) (-356.598) * (-357.608) (-356.981) [-359.050] (-359.605) -- 0:00:12 791500 -- (-358.700) (-362.577) (-359.333) [-358.404] * (-359.446) (-359.410) (-358.662) [-358.024] -- 0:00:12 792000 -- [-357.666] (-357.293) (-363.088) (-359.309) * (-360.061) [-357.539] (-356.760) (-358.405) -- 0:00:12 792500 -- (-359.863) (-358.986) (-360.071) [-357.727] * [-357.813] (-358.418) (-361.601) (-359.816) -- 0:00:12 793000 -- (-358.199) (-357.970) (-357.896) [-356.216] * (-361.353) (-356.690) (-360.166) [-356.307] -- 0:00:12 793500 -- (-357.549) (-361.591) (-357.482) [-358.645] * (-361.344) (-358.848) (-357.498) [-356.930] -- 0:00:12 794000 -- (-360.049) (-361.064) (-357.961) [-358.638] * (-359.486) (-358.418) [-357.608] (-357.761) -- 0:00:12 794500 -- [-357.373] (-361.442) (-358.591) (-357.331) * (-357.886) [-356.581] (-357.917) (-356.402) -- 0:00:12 795000 -- (-360.545) [-357.108] (-357.631) (-357.241) * (-358.310) (-357.966) [-356.658] (-357.728) -- 0:00:12 Average standard deviation of split frequencies: 0.010384 795500 -- (-357.924) [-358.807] (-356.440) (-358.026) * (-357.350) [-358.030] (-359.535) (-359.562) -- 0:00:12 796000 -- (-359.028) (-356.805) [-357.278] (-359.514) * [-357.275] (-357.456) (-359.796) (-358.437) -- 0:00:12 796500 -- (-358.100) (-358.545) (-360.632) [-357.459] * (-358.686) [-357.547] (-360.229) (-358.458) -- 0:00:12 797000 -- (-360.205) (-358.926) [-360.537] (-357.813) * (-356.506) (-363.897) [-357.481] (-358.838) -- 0:00:11 797500 -- (-358.982) (-358.969) [-357.597] (-357.257) * [-356.653] (-358.355) (-356.726) (-357.311) -- 0:00:11 798000 -- (-357.527) (-357.749) [-360.714] (-361.723) * (-361.424) (-357.866) (-356.724) [-357.345] -- 0:00:11 798500 -- [-357.037] (-359.960) (-357.988) (-360.208) * [-358.815] (-360.068) (-359.799) (-359.510) -- 0:00:12 799000 -- (-357.498) [-360.327] (-356.664) (-358.000) * [-358.878] (-362.781) (-361.776) (-360.112) -- 0:00:12 799500 -- [-357.095] (-359.656) (-356.891) (-356.653) * (-356.984) (-357.188) (-360.555) [-356.563] -- 0:00:12 800000 -- (-359.419) [-364.604] (-361.038) (-365.474) * (-357.178) (-364.247) [-357.687] (-356.441) -- 0:00:12 Average standard deviation of split frequencies: 0.010088 800500 -- [-360.347] (-358.151) (-362.351) (-357.386) * (-357.786) (-358.145) [-358.261] (-356.250) -- 0:00:11 801000 -- (-358.115) (-358.656) [-359.939] (-358.211) * (-356.661) (-360.775) [-359.515] (-360.588) -- 0:00:11 801500 -- (-358.816) (-360.107) [-357.546] (-361.777) * (-360.897) (-360.061) [-356.250] (-361.941) -- 0:00:11 802000 -- (-357.095) [-356.081] (-358.174) (-358.714) * [-361.201] (-357.093) (-361.036) (-359.404) -- 0:00:11 802500 -- (-358.545) [-359.238] (-357.702) (-357.132) * (-360.829) (-358.651) (-362.799) [-357.755] -- 0:00:11 803000 -- (-357.015) [-357.532] (-359.482) (-359.451) * (-356.661) (-358.579) (-359.021) [-356.769] -- 0:00:11 803500 -- [-356.988] (-356.673) (-356.629) (-359.189) * [-358.171] (-358.246) (-358.332) (-361.673) -- 0:00:11 804000 -- (-356.914) [-358.914] (-357.544) (-359.956) * (-357.415) (-356.973) [-358.787] (-360.206) -- 0:00:11 804500 -- [-356.932] (-356.860) (-361.273) (-359.006) * (-357.270) (-359.176) [-362.966] (-359.841) -- 0:00:11 805000 -- [-359.561] (-357.062) (-358.344) (-358.627) * (-356.706) [-356.247] (-358.016) (-357.650) -- 0:00:11 Average standard deviation of split frequencies: 0.009787 805500 -- (-357.850) (-357.244) (-360.104) [-356.824] * (-357.410) [-358.569] (-357.128) (-359.420) -- 0:00:11 806000 -- (-358.435) (-360.595) [-360.607] (-359.041) * (-359.097) (-357.782) [-361.388] (-358.895) -- 0:00:11 806500 -- (-357.314) (-359.977) [-357.110] (-357.071) * (-360.121) (-357.120) [-357.081] (-357.003) -- 0:00:11 807000 -- (-357.500) [-357.092] (-359.374) (-357.860) * (-357.726) [-357.369] (-360.355) (-356.690) -- 0:00:11 807500 -- [-357.424] (-357.238) (-357.035) (-357.790) * [-357.190] (-359.966) (-362.766) (-359.412) -- 0:00:11 808000 -- (-357.575) (-357.250) (-358.356) [-357.868] * (-358.176) (-357.558) [-359.194] (-365.013) -- 0:00:11 808500 -- (-358.137) [-357.596] (-358.196) (-360.406) * (-358.726) (-358.428) (-359.312) [-362.551] -- 0:00:11 809000 -- (-361.004) (-357.082) [-359.049] (-358.080) * (-356.977) (-360.048) (-362.182) [-358.583] -- 0:00:11 809500 -- (-363.199) [-357.253] (-356.925) (-358.626) * (-357.117) (-356.277) (-358.523) [-358.068] -- 0:00:11 810000 -- [-357.637] (-357.039) (-358.591) (-361.963) * (-357.423) (-357.004) (-359.851) [-357.110] -- 0:00:11 Average standard deviation of split frequencies: 0.009343 810500 -- (-359.519) [-356.994] (-359.247) (-357.322) * (-359.090) [-357.277] (-356.932) (-357.748) -- 0:00:11 811000 -- (-358.037) (-356.927) (-359.070) [-360.552] * (-355.897) [-356.728] (-357.893) (-356.019) -- 0:00:11 811500 -- (-358.422) [-357.374] (-358.386) (-356.579) * (-357.450) (-357.629) (-362.091) [-359.004] -- 0:00:11 812000 -- [-362.112] (-358.299) (-358.532) (-356.587) * (-357.865) (-358.745) [-359.109] (-359.136) -- 0:00:11 812500 -- [-357.623] (-360.821) (-360.789) (-356.637) * [-357.153] (-357.600) (-356.979) (-358.584) -- 0:00:11 813000 -- (-358.092) (-360.172) [-357.355] (-356.750) * (-358.756) (-357.772) (-356.137) [-358.281] -- 0:00:11 813500 -- (-358.175) (-360.340) (-357.375) [-357.909] * (-359.249) [-356.700] (-360.243) (-357.938) -- 0:00:11 814000 -- (-358.743) [-361.041] (-361.499) (-357.401) * (-359.948) (-358.114) [-356.742] (-361.290) -- 0:00:10 814500 -- (-356.878) [-357.895] (-361.934) (-358.557) * (-358.108) (-358.059) (-357.953) [-357.578] -- 0:00:10 815000 -- (-360.075) (-358.662) [-358.005] (-358.227) * (-358.813) [-358.173] (-360.652) (-357.200) -- 0:00:10 Average standard deviation of split frequencies: 0.008974 815500 -- (-363.515) (-359.750) [-358.792] (-358.285) * (-357.346) [-358.190] (-357.766) (-361.196) -- 0:00:11 816000 -- [-359.483] (-363.590) (-359.237) (-357.812) * (-357.531) [-356.801] (-363.254) (-365.811) -- 0:00:11 816500 -- (-358.837) (-358.963) [-358.350] (-359.211) * (-358.069) (-358.112) (-357.265) [-363.637] -- 0:00:11 817000 -- (-359.364) [-357.141] (-357.542) (-362.588) * [-356.868] (-362.198) (-358.567) (-359.874) -- 0:00:10 817500 -- (-356.861) (-356.815) [-356.717] (-368.781) * (-359.480) (-357.630) (-358.200) [-360.419] -- 0:00:10 818000 -- (-361.102) (-357.805) [-356.487] (-361.419) * (-356.106) (-360.651) (-358.665) [-359.897] -- 0:00:10 818500 -- (-356.683) [-357.335] (-357.618) (-357.828) * (-356.836) (-358.023) (-358.961) [-357.703] -- 0:00:10 819000 -- [-357.576] (-362.330) (-360.092) (-356.701) * (-357.208) [-357.291] (-364.901) (-359.835) -- 0:00:10 819500 -- (-358.831) [-359.174] (-356.775) (-357.346) * (-356.347) (-359.483) (-358.783) [-360.372] -- 0:00:10 820000 -- [-358.513] (-359.308) (-358.018) (-357.898) * (-356.647) (-357.849) [-358.062] (-359.448) -- 0:00:10 Average standard deviation of split frequencies: 0.009037 820500 -- [-357.345] (-358.124) (-358.700) (-359.156) * (-356.745) (-358.594) [-360.721] (-359.313) -- 0:00:10 821000 -- (-358.863) [-357.283] (-361.884) (-361.705) * (-359.080) (-362.516) (-357.591) [-359.077] -- 0:00:10 821500 -- [-356.892] (-356.888) (-362.763) (-356.441) * (-358.379) (-360.335) (-360.520) [-357.514] -- 0:00:10 822000 -- [-357.458] (-356.519) (-359.522) (-360.106) * (-358.088) [-359.160] (-357.374) (-356.161) -- 0:00:10 822500 -- (-357.579) [-359.968] (-360.075) (-356.555) * (-358.837) (-359.422) [-359.051] (-359.490) -- 0:00:10 823000 -- (-357.282) (-360.950) (-356.637) [-356.722] * (-358.399) [-359.114] (-357.422) (-359.151) -- 0:00:10 823500 -- [-358.862] (-360.588) (-357.237) (-360.846) * (-355.879) (-358.980) (-357.145) [-357.064] -- 0:00:10 824000 -- (-359.505) [-359.561] (-359.813) (-359.740) * (-355.875) (-359.434) [-358.914] (-358.799) -- 0:00:10 824500 -- (-361.660) (-358.930) (-360.402) [-357.284] * [-358.760] (-358.959) (-356.515) (-359.305) -- 0:00:10 825000 -- (-358.184) (-358.798) [-357.163] (-356.663) * (-358.377) [-358.515] (-359.074) (-357.783) -- 0:00:10 Average standard deviation of split frequencies: 0.009131 825500 -- (-358.172) [-361.169] (-357.516) (-356.636) * [-356.556] (-356.673) (-361.088) (-360.468) -- 0:00:10 826000 -- (-362.018) (-358.212) (-357.081) [-356.415] * (-357.327) (-356.946) (-357.355) [-364.958] -- 0:00:10 826500 -- (-358.399) [-359.154] (-357.747) (-356.868) * (-357.365) [-358.402] (-361.438) (-358.897) -- 0:00:10 827000 -- (-358.620) (-361.546) (-356.246) [-358.579] * (-358.537) (-357.673) [-356.319] (-360.255) -- 0:00:10 827500 -- [-360.952] (-359.123) (-359.727) (-360.619) * (-359.207) [-357.303] (-357.868) (-357.985) -- 0:00:10 828000 -- (-357.133) (-360.574) [-356.978] (-359.796) * (-357.097) [-360.612] (-363.482) (-358.205) -- 0:00:10 828500 -- (-358.237) [-358.210] (-357.763) (-356.699) * (-357.859) [-357.097] (-357.141) (-361.029) -- 0:00:10 829000 -- [-358.204] (-363.014) (-359.717) (-357.359) * [-357.203] (-359.106) (-357.569) (-360.626) -- 0:00:10 829500 -- [-358.678] (-358.332) (-357.010) (-360.247) * (-356.692) (-362.877) [-357.330] (-361.269) -- 0:00:10 830000 -- (-358.618) (-358.812) (-358.565) [-357.937] * (-356.659) (-360.904) (-357.111) [-358.824] -- 0:00:10 Average standard deviation of split frequencies: 0.008740 830500 -- (-356.066) [-357.595] (-359.700) (-360.008) * (-360.455) (-359.674) [-357.086] (-357.814) -- 0:00:10 831000 -- (-358.830) (-358.160) [-362.173] (-358.457) * (-361.680) (-358.454) (-356.270) [-356.057] -- 0:00:09 831500 -- (-360.825) (-356.677) (-363.241) [-360.432] * (-360.527) (-356.547) [-357.562] (-357.783) -- 0:00:09 832000 -- (-358.994) (-356.943) (-359.168) [-362.808] * [-357.529] (-357.677) (-358.120) (-360.927) -- 0:00:09 832500 -- (-357.728) (-357.863) [-358.077] (-356.980) * [-358.708] (-358.645) (-357.922) (-359.943) -- 0:00:10 833000 -- (-356.701) [-357.016] (-360.961) (-361.645) * [-356.947] (-357.243) (-364.152) (-362.763) -- 0:00:10 833500 -- [-358.630] (-357.766) (-359.744) (-358.764) * (-357.616) (-359.766) (-359.747) [-359.675] -- 0:00:09 834000 -- [-359.635] (-358.117) (-359.215) (-359.101) * (-359.101) (-356.641) (-357.001) [-358.322] -- 0:00:09 834500 -- (-357.301) (-360.115) [-357.457] (-357.785) * (-357.688) (-358.303) (-360.647) [-358.654] -- 0:00:09 835000 -- (-360.803) (-360.979) (-360.093) [-356.666] * (-357.588) [-358.354] (-359.142) (-359.959) -- 0:00:09 Average standard deviation of split frequencies: 0.009022 835500 -- [-358.916] (-361.263) (-357.321) (-357.051) * [-357.591] (-357.651) (-364.819) (-357.882) -- 0:00:09 836000 -- (-359.529) (-356.551) (-356.418) [-357.331] * (-358.367) [-357.399] (-358.988) (-363.191) -- 0:00:09 836500 -- (-359.025) (-357.738) (-360.566) [-359.018] * (-361.645) (-358.349) [-360.114] (-362.485) -- 0:00:09 837000 -- [-359.684] (-357.077) (-362.159) (-360.220) * (-364.497) [-358.965] (-359.768) (-365.393) -- 0:00:09 837500 -- (-358.211) (-358.648) (-360.248) [-361.173] * (-362.272) [-359.521] (-360.139) (-358.072) -- 0:00:09 838000 -- (-366.161) (-356.667) (-357.335) [-358.853] * (-358.013) (-359.279) (-356.864) [-356.251] -- 0:00:09 838500 -- (-356.516) [-359.018] (-358.697) (-360.155) * [-358.684] (-358.787) (-359.512) (-358.823) -- 0:00:09 839000 -- (-358.252) (-357.986) (-358.639) [-356.713] * (-363.237) [-356.763] (-360.099) (-357.412) -- 0:00:09 839500 -- [-357.421] (-358.156) (-358.514) (-357.920) * (-359.824) (-357.614) (-358.403) [-357.419] -- 0:00:09 840000 -- (-358.367) [-357.465] (-357.709) (-358.114) * (-357.841) [-358.049] (-359.024) (-357.175) -- 0:00:09 Average standard deviation of split frequencies: 0.009533 840500 -- (-356.940) (-357.059) (-356.707) [-362.662] * [-358.756] (-359.022) (-357.226) (-358.327) -- 0:00:09 841000 -- (-357.526) (-359.251) (-356.680) [-358.441] * (-357.482) [-359.066] (-356.287) (-361.831) -- 0:00:09 841500 -- [-362.727] (-360.475) (-357.756) (-359.268) * (-357.464) [-356.899] (-356.884) (-359.536) -- 0:00:09 842000 -- [-357.865] (-359.222) (-361.930) (-357.476) * (-356.556) (-358.210) [-356.583] (-358.103) -- 0:00:09 842500 -- (-359.022) (-365.475) (-358.618) [-356.868] * [-358.811] (-357.252) (-360.569) (-357.495) -- 0:00:09 843000 -- (-358.527) (-362.771) (-357.952) [-355.958] * [-358.394] (-358.747) (-359.944) (-357.609) -- 0:00:09 843500 -- (-360.351) [-360.678] (-359.322) (-359.412) * (-360.653) [-358.286] (-358.592) (-357.656) -- 0:00:09 844000 -- [-357.631] (-356.711) (-360.463) (-357.218) * [-359.210] (-357.015) (-362.658) (-359.551) -- 0:00:09 844500 -- (-360.447) (-360.697) (-360.790) [-359.494] * (-360.423) [-357.931] (-357.438) (-362.703) -- 0:00:09 845000 -- (-358.904) (-362.144) [-363.046] (-358.079) * (-358.896) (-358.865) [-357.230] (-360.595) -- 0:00:09 Average standard deviation of split frequencies: 0.009658 845500 -- (-359.149) (-356.752) (-357.986) [-359.798] * (-357.784) (-359.560) (-358.668) [-357.617] -- 0:00:09 846000 -- (-359.216) [-357.029] (-360.775) (-362.426) * [-357.505] (-358.454) (-358.325) (-358.558) -- 0:00:09 846500 -- [-358.471] (-359.980) (-360.641) (-358.913) * (-358.289) [-359.396] (-357.496) (-357.931) -- 0:00:09 847000 -- (-356.401) (-357.574) (-357.728) [-360.915] * (-357.394) (-357.264) (-358.424) [-356.641] -- 0:00:09 847500 -- (-356.522) (-357.563) (-358.314) [-357.434] * (-359.687) (-358.507) (-357.872) [-357.460] -- 0:00:08 848000 -- (-357.883) (-356.862) [-358.795] (-357.680) * (-358.565) (-358.173) (-356.677) [-356.687] -- 0:00:08 848500 -- (-356.796) [-362.874] (-357.610) (-357.973) * (-361.351) (-356.795) (-359.708) [-357.887] -- 0:00:08 849000 -- (-357.952) [-358.410] (-356.593) (-358.505) * (-358.874) (-356.523) (-356.897) [-357.695] -- 0:00:08 849500 -- [-358.859] (-358.284) (-355.909) (-358.057) * [-357.656] (-360.040) (-364.156) (-357.489) -- 0:00:09 850000 -- (-359.846) (-357.538) [-357.245] (-360.124) * (-357.340) (-358.792) [-357.662] (-356.777) -- 0:00:09 Average standard deviation of split frequencies: 0.010049 850500 -- (-359.314) [-357.894] (-361.155) (-360.581) * (-356.972) (-356.906) (-358.583) [-357.698] -- 0:00:08 851000 -- (-358.840) (-362.321) (-362.287) [-362.427] * (-357.955) (-359.819) [-358.609] (-359.072) -- 0:00:08 851500 -- (-363.471) (-356.954) (-357.925) [-358.858] * (-362.400) [-358.404] (-358.487) (-357.700) -- 0:00:08 852000 -- (-358.510) (-357.171) (-357.259) [-357.904] * (-361.278) (-359.074) (-359.890) [-358.516] -- 0:00:08 852500 -- (-357.714) (-357.207) (-359.166) [-358.127] * [-360.209] (-359.058) (-357.091) (-361.842) -- 0:00:08 853000 -- (-364.735) [-359.217] (-358.366) (-362.062) * (-360.404) (-359.691) [-358.251] (-359.010) -- 0:00:08 853500 -- [-359.325] (-356.595) (-358.471) (-360.332) * (-357.649) [-357.594] (-356.915) (-358.919) -- 0:00:08 854000 -- (-357.829) [-361.705] (-357.071) (-357.228) * (-357.189) [-360.437] (-356.891) (-358.099) -- 0:00:08 854500 -- (-356.657) [-357.153] (-359.305) (-356.325) * [-357.335] (-357.367) (-358.672) (-358.543) -- 0:00:08 855000 -- [-357.433] (-357.195) (-358.520) (-360.697) * (-358.318) (-356.596) (-358.863) [-361.342] -- 0:00:08 Average standard deviation of split frequencies: 0.009913 855500 -- (-361.272) (-359.909) [-358.888] (-357.832) * (-361.347) (-360.716) [-356.679] (-358.219) -- 0:00:08 856000 -- [-358.272] (-357.291) (-359.820) (-358.251) * (-357.694) (-359.443) (-357.230) [-359.791] -- 0:00:08 856500 -- (-358.035) (-356.986) (-356.710) [-357.221] * (-358.460) (-360.309) (-358.661) [-360.237] -- 0:00:08 857000 -- (-357.574) [-356.535] (-357.872) (-359.721) * (-363.901) [-358.068] (-357.288) (-361.548) -- 0:00:08 857500 -- (-359.539) [-356.373] (-358.871) (-360.488) * (-359.011) (-356.806) (-357.425) [-357.023] -- 0:00:08 858000 -- (-357.192) (-357.576) [-357.894] (-358.016) * (-357.481) [-358.126] (-358.588) (-358.987) -- 0:00:08 858500 -- [-358.036] (-356.933) (-357.561) (-357.715) * (-358.112) (-356.180) (-357.069) [-358.002] -- 0:00:08 859000 -- (-360.127) (-356.681) [-356.969] (-357.472) * (-357.925) (-357.068) (-358.458) [-356.758] -- 0:00:08 859500 -- (-361.641) (-359.151) [-356.990] (-359.355) * [-357.882] (-358.909) (-359.147) (-358.753) -- 0:00:08 860000 -- (-357.233) (-357.980) [-357.167] (-357.561) * [-356.623] (-357.809) (-357.299) (-358.217) -- 0:00:08 Average standard deviation of split frequencies: 0.010115 860500 -- [-357.061] (-358.319) (-357.758) (-358.263) * (-357.280) (-357.556) (-357.472) [-357.012] -- 0:00:08 861000 -- (-359.172) (-357.349) (-358.329) [-357.634] * (-358.132) [-358.606] (-359.680) (-356.552) -- 0:00:08 861500 -- [-356.556] (-358.611) (-358.123) (-358.697) * (-359.810) (-357.811) [-357.389] (-356.612) -- 0:00:08 862000 -- (-356.605) (-358.808) (-358.259) [-360.929] * (-359.216) (-360.212) (-357.789) [-357.049] -- 0:00:08 862500 -- (-356.786) (-360.025) (-357.750) [-358.975] * (-358.260) (-361.283) [-357.323] (-359.368) -- 0:00:08 863000 -- (-358.972) (-357.653) (-363.992) [-359.038] * [-356.767] (-359.511) (-360.221) (-364.032) -- 0:00:08 863500 -- (-358.657) (-358.621) (-359.428) [-357.398] * (-356.418) (-357.467) [-357.254] (-357.766) -- 0:00:08 864000 -- [-364.881] (-357.598) (-360.983) (-358.902) * (-356.369) (-356.386) (-361.865) [-356.927] -- 0:00:08 864500 -- (-362.142) [-358.328] (-359.565) (-357.791) * (-356.906) (-357.556) [-356.842] (-358.098) -- 0:00:07 865000 -- (-356.578) [-357.960] (-359.354) (-360.957) * [-361.107] (-359.086) (-359.196) (-365.451) -- 0:00:07 Average standard deviation of split frequencies: 0.010052 865500 -- (-357.117) (-358.821) (-356.892) [-356.894] * (-361.045) (-362.078) (-357.010) [-357.163] -- 0:00:07 866000 -- [-356.144] (-356.376) (-358.889) (-357.881) * (-361.326) [-361.461] (-359.563) (-363.752) -- 0:00:07 866500 -- (-359.012) (-356.957) (-356.962) [-362.001] * (-361.367) [-357.293] (-360.234) (-364.536) -- 0:00:08 867000 -- (-356.655) [-360.799] (-357.981) (-359.103) * (-361.158) (-358.923) (-362.183) [-357.581] -- 0:00:07 867500 -- [-357.358] (-361.156) (-360.669) (-360.837) * (-358.155) (-359.431) [-359.233] (-365.229) -- 0:00:07 868000 -- (-358.294) (-361.248) (-361.172) [-360.303] * (-357.832) (-358.944) [-357.785] (-359.441) -- 0:00:07 868500 -- [-357.858] (-357.062) (-359.049) (-358.398) * [-358.336] (-360.675) (-358.263) (-356.763) -- 0:00:07 869000 -- (-356.715) [-356.407] (-356.913) (-359.205) * (-359.894) (-358.671) (-357.586) [-356.985] -- 0:00:07 869500 -- [-357.021] (-360.759) (-358.260) (-365.649) * (-362.566) (-359.588) (-357.625) [-360.336] -- 0:00:07 870000 -- (-356.571) [-362.821] (-362.060) (-356.945) * (-360.067) (-362.292) [-356.948] (-358.197) -- 0:00:07 Average standard deviation of split frequencies: 0.009674 870500 -- (-356.571) (-359.303) (-358.666) [-356.970] * [-359.243] (-356.840) (-361.512) (-359.047) -- 0:00:07 871000 -- (-358.024) (-358.403) (-356.921) [-357.471] * (-356.078) (-356.104) (-356.753) [-356.192] -- 0:00:07 871500 -- (-358.017) [-356.908] (-361.504) (-358.247) * (-358.117) (-357.963) (-361.429) [-358.163] -- 0:00:07 872000 -- (-357.660) (-361.604) (-366.017) [-357.223] * (-359.994) [-357.570] (-359.056) (-359.638) -- 0:00:07 872500 -- (-356.938) (-361.328) (-357.155) [-358.833] * (-357.082) [-359.171] (-359.697) (-357.708) -- 0:00:07 873000 -- (-356.422) (-359.542) (-358.009) [-357.086] * (-358.394) [-356.095] (-361.153) (-357.345) -- 0:00:07 873500 -- [-356.709] (-359.061) (-358.961) (-357.173) * [-358.306] (-358.199) (-362.302) (-357.767) -- 0:00:07 874000 -- (-356.403) (-360.253) (-357.593) [-358.789] * (-356.981) (-356.656) (-359.460) [-357.305] -- 0:00:07 874500 -- [-357.027] (-359.436) (-358.358) (-356.538) * (-356.659) [-357.463] (-357.034) (-358.348) -- 0:00:07 875000 -- (-357.211) (-360.514) (-356.708) [-363.833] * (-359.817) [-356.557] (-358.141) (-359.795) -- 0:00:07 Average standard deviation of split frequencies: 0.009435 875500 -- (-358.720) [-357.443] (-357.537) (-357.951) * (-359.221) (-357.202) (-358.031) [-358.440] -- 0:00:07 876000 -- (-357.340) [-359.194] (-358.372) (-359.195) * (-358.790) (-356.566) [-357.640] (-361.758) -- 0:00:07 876500 -- (-361.891) (-359.350) [-361.022] (-356.994) * (-358.099) (-357.227) (-358.587) [-359.428] -- 0:00:07 877000 -- [-357.127] (-358.314) (-359.126) (-356.358) * [-356.331] (-357.723) (-360.842) (-358.942) -- 0:00:07 877500 -- [-356.710] (-362.271) (-362.734) (-359.609) * [-357.885] (-358.498) (-357.510) (-358.611) -- 0:00:07 878000 -- (-356.324) (-357.117) [-357.771] (-358.244) * (-359.164) (-360.151) (-356.734) [-356.701] -- 0:00:07 878500 -- (-357.149) [-357.814] (-356.505) (-358.022) * [-356.813] (-356.974) (-356.533) (-356.410) -- 0:00:07 879000 -- (-359.868) (-357.055) [-357.476] (-360.203) * (-357.590) (-358.967) (-358.669) [-356.757] -- 0:00:07 879500 -- (-358.146) (-357.273) [-357.798] (-358.485) * (-358.051) [-359.618] (-358.062) (-357.424) -- 0:00:07 880000 -- [-357.612] (-359.146) (-356.333) (-357.044) * [-358.147] (-359.993) (-358.765) (-356.493) -- 0:00:07 Average standard deviation of split frequencies: 0.009171 880500 -- [-357.860] (-357.812) (-359.255) (-357.562) * (-358.427) (-361.434) [-357.256] (-357.746) -- 0:00:07 881000 -- [-357.787] (-360.776) (-360.619) (-357.882) * [-358.878] (-357.839) (-358.775) (-359.052) -- 0:00:07 881500 -- (-359.182) (-360.466) (-360.396) [-356.820] * [-357.433] (-356.561) (-358.409) (-356.537) -- 0:00:06 882000 -- (-356.919) [-360.196] (-360.548) (-356.749) * [-359.146] (-361.361) (-359.407) (-360.572) -- 0:00:06 882500 -- (-356.278) [-357.654] (-360.917) (-357.693) * (-359.302) [-358.736] (-358.827) (-362.427) -- 0:00:06 883000 -- (-356.705) [-360.341] (-358.256) (-358.491) * (-356.680) (-357.509) [-359.240] (-358.839) -- 0:00:07 883500 -- [-358.126] (-357.683) (-359.162) (-359.788) * (-356.827) (-356.376) (-359.359) [-358.370] -- 0:00:06 884000 -- (-362.738) [-357.396] (-358.949) (-359.112) * (-357.956) (-360.021) [-358.047] (-359.630) -- 0:00:06 884500 -- (-359.645) (-358.099) (-357.242) [-360.443] * (-357.952) (-357.891) [-359.712] (-358.379) -- 0:00:06 885000 -- [-358.939] (-356.514) (-359.896) (-357.430) * (-362.544) (-359.025) (-356.418) [-356.785] -- 0:00:06 Average standard deviation of split frequencies: 0.008797 885500 -- (-361.963) [-358.134] (-358.612) (-357.389) * [-356.458] (-360.976) (-356.182) (-360.273) -- 0:00:06 886000 -- (-358.688) [-356.450] (-357.836) (-357.479) * (-359.648) [-358.986] (-358.178) (-358.183) -- 0:00:06 886500 -- (-358.613) [-357.309] (-357.580) (-357.599) * (-358.997) [-359.988] (-357.316) (-357.860) -- 0:00:06 887000 -- (-363.250) (-356.575) (-359.285) [-356.527] * [-359.108] (-360.278) (-357.457) (-359.027) -- 0:00:06 887500 -- (-359.094) (-358.411) [-358.244] (-363.343) * [-356.630] (-361.681) (-357.146) (-356.991) -- 0:00:06 888000 -- [-357.971] (-359.760) (-359.300) (-360.377) * (-357.692) (-361.391) [-356.675] (-360.059) -- 0:00:06 888500 -- (-357.185) (-363.196) [-358.474] (-360.494) * (-359.504) (-358.104) [-358.154] (-356.411) -- 0:00:06 889000 -- (-359.567) [-358.247] (-360.368) (-357.930) * [-357.177] (-357.300) (-358.173) (-356.806) -- 0:00:06 889500 -- (-361.301) (-361.405) (-356.975) [-361.361] * [-357.314] (-357.411) (-356.236) (-357.558) -- 0:00:06 890000 -- (-362.872) (-358.801) (-359.992) [-359.557] * (-358.206) [-356.364] (-357.280) (-356.854) -- 0:00:06 Average standard deviation of split frequencies: 0.008468 890500 -- [-361.357] (-358.281) (-357.709) (-361.685) * (-356.891) (-356.342) (-361.292) [-358.754] -- 0:00:06 891000 -- [-360.077] (-358.012) (-359.212) (-357.930) * [-356.916] (-358.942) (-358.496) (-357.988) -- 0:00:06 891500 -- (-357.897) (-356.237) [-359.115] (-356.995) * (-359.897) (-358.103) [-359.537] (-361.376) -- 0:00:06 892000 -- (-361.066) [-355.940] (-359.663) (-357.781) * (-362.047) [-356.648] (-357.453) (-357.318) -- 0:00:06 892500 -- (-358.638) (-358.398) [-359.655] (-359.049) * (-360.914) (-356.645) (-358.006) [-361.650] -- 0:00:06 893000 -- (-357.169) (-358.031) (-361.567) [-360.416] * (-358.131) (-357.135) [-358.445] (-358.564) -- 0:00:06 893500 -- (-357.937) [-359.669] (-356.360) (-356.674) * (-365.024) (-359.243) (-359.742) [-358.837] -- 0:00:06 894000 -- (-357.176) [-357.575] (-357.004) (-359.679) * (-360.798) (-358.183) (-356.964) [-358.478] -- 0:00:06 894500 -- [-356.839] (-357.812) (-357.014) (-357.510) * (-360.184) (-360.676) (-362.381) [-357.896] -- 0:00:06 895000 -- (-358.380) [-359.200] (-357.820) (-358.567) * (-357.057) [-358.570] (-357.770) (-356.998) -- 0:00:06 Average standard deviation of split frequencies: 0.008383 895500 -- [-357.218] (-359.023) (-359.180) (-361.187) * (-358.561) (-361.423) (-361.168) [-356.912] -- 0:00:06 896000 -- (-358.059) (-357.085) [-356.446] (-358.173) * (-357.553) [-359.893] (-360.319) (-358.722) -- 0:00:06 896500 -- (-363.331) [-356.206] (-356.400) (-357.195) * (-363.298) (-358.200) (-356.984) [-356.358] -- 0:00:06 897000 -- (-357.567) (-358.394) (-360.893) [-358.096] * (-360.854) [-360.700] (-356.917) (-359.762) -- 0:00:06 897500 -- (-359.555) [-357.540] (-359.907) (-362.347) * [-358.807] (-357.651) (-356.735) (-359.178) -- 0:00:06 898000 -- (-358.556) [-357.324] (-357.301) (-359.462) * [-357.562] (-363.138) (-358.982) (-359.017) -- 0:00:06 898500 -- (-359.290) [-356.571] (-357.340) (-358.165) * (-356.452) (-360.649) [-360.291] (-356.756) -- 0:00:05 899000 -- (-357.352) [-362.306] (-358.497) (-360.316) * (-357.207) (-359.161) (-363.480) [-361.014] -- 0:00:05 899500 -- (-357.289) (-358.487) [-356.878] (-359.703) * (-358.405) (-357.011) [-357.323] (-358.655) -- 0:00:05 900000 -- (-358.593) [-358.880] (-359.108) (-358.518) * (-356.723) [-356.883] (-359.141) (-362.043) -- 0:00:05 Average standard deviation of split frequencies: 0.008479 900500 -- [-358.440] (-359.899) (-359.270) (-359.724) * (-356.511) [-358.440] (-357.982) (-362.545) -- 0:00:05 901000 -- (-356.901) (-357.263) [-357.388] (-357.057) * [-359.216] (-357.703) (-361.838) (-358.056) -- 0:00:05 901500 -- (-356.882) (-357.607) [-360.201] (-359.905) * [-359.707] (-358.578) (-357.419) (-357.210) -- 0:00:05 902000 -- (-359.998) [-358.553] (-357.980) (-357.836) * (-358.802) [-360.261] (-358.523) (-360.127) -- 0:00:05 902500 -- (-367.301) [-360.311] (-359.605) (-356.984) * (-357.523) (-356.194) (-359.796) [-359.354] -- 0:00:05 903000 -- (-359.909) [-360.355] (-358.867) (-358.011) * (-357.065) (-357.779) [-358.554] (-359.449) -- 0:00:05 903500 -- [-363.215] (-358.658) (-357.074) (-358.107) * (-357.112) [-357.949] (-356.421) (-361.782) -- 0:00:05 904000 -- (-356.887) [-359.172] (-356.211) (-359.144) * (-356.999) (-363.159) [-357.150] (-360.075) -- 0:00:05 904500 -- (-357.885) (-356.299) (-357.075) [-357.944] * [-358.117] (-358.280) (-359.046) (-361.270) -- 0:00:05 905000 -- (-360.477) [-358.083] (-357.610) (-358.247) * (-360.928) (-358.129) (-358.961) [-358.044] -- 0:00:05 Average standard deviation of split frequencies: 0.008325 905500 -- (-356.374) (-356.347) (-358.400) [-357.033] * (-362.480) [-360.640] (-357.503) (-358.636) -- 0:00:05 906000 -- (-359.958) (-358.380) [-358.399] (-358.562) * (-359.641) (-362.997) (-357.399) [-360.064] -- 0:00:05 906500 -- (-361.657) [-358.217] (-358.050) (-358.485) * (-357.946) [-358.764] (-357.114) (-358.203) -- 0:00:05 907000 -- [-361.169] (-359.536) (-358.875) (-359.054) * (-357.701) (-358.750) [-357.208] (-357.046) -- 0:00:05 907500 -- (-356.683) (-357.224) (-360.102) [-357.697] * (-358.421) [-356.563] (-359.877) (-363.258) -- 0:00:05 908000 -- (-358.651) (-358.758) (-359.267) [-356.942] * [-356.493] (-356.747) (-356.922) (-357.254) -- 0:00:05 908500 -- (-361.161) (-358.124) [-357.526] (-357.228) * (-359.758) (-359.346) (-357.546) [-357.342] -- 0:00:05 909000 -- (-361.403) (-361.101) (-358.782) [-358.564] * [-360.595] (-356.449) (-358.032) (-357.991) -- 0:00:05 909500 -- (-362.949) (-356.286) [-358.247] (-359.367) * (-358.561) [-358.025] (-359.303) (-357.343) -- 0:00:05 910000 -- (-359.402) [-357.647] (-358.158) (-361.620) * (-359.999) (-357.775) (-359.453) [-356.987] -- 0:00:05 Average standard deviation of split frequencies: 0.008627 910500 -- (-364.900) [-358.125] (-357.782) (-356.891) * (-360.945) [-356.959] (-356.710) (-358.169) -- 0:00:05 911000 -- (-362.831) (-357.007) [-356.350] (-359.867) * (-359.613) [-357.033] (-358.234) (-358.240) -- 0:00:05 911500 -- (-360.871) [-357.193] (-357.424) (-359.515) * (-356.912) [-360.783] (-362.121) (-358.866) -- 0:00:05 912000 -- (-363.886) [-357.192] (-360.979) (-358.717) * (-358.783) [-357.005] (-357.600) (-364.595) -- 0:00:05 912500 -- [-359.064] (-357.128) (-357.233) (-358.292) * [-356.421] (-357.158) (-356.941) (-360.937) -- 0:00:05 913000 -- [-358.839] (-362.035) (-356.994) (-359.482) * (-360.783) [-356.847] (-357.337) (-360.932) -- 0:00:05 913500 -- (-357.741) [-359.775] (-357.237) (-361.639) * [-356.432] (-356.655) (-357.732) (-361.473) -- 0:00:05 914000 -- (-359.864) [-357.141] (-357.470) (-360.099) * (-356.256) [-360.696] (-358.031) (-360.028) -- 0:00:05 914500 -- (-359.011) (-362.166) (-359.678) [-358.820] * [-357.144] (-360.854) (-357.881) (-358.535) -- 0:00:05 915000 -- (-358.479) (-357.430) [-358.309] (-359.221) * (-357.926) (-357.480) (-358.102) [-356.601] -- 0:00:05 Average standard deviation of split frequencies: 0.008440 915500 -- [-358.562] (-357.187) (-358.264) (-356.249) * (-356.489) (-358.210) (-359.832) [-357.980] -- 0:00:04 916000 -- (-358.726) [-356.714] (-356.830) (-361.661) * [-358.417] (-357.349) (-361.592) (-356.778) -- 0:00:04 916500 -- [-356.421] (-361.524) (-357.588) (-358.812) * (-356.752) [-356.207] (-360.840) (-357.293) -- 0:00:04 917000 -- (-357.356) (-357.314) [-360.634] (-363.881) * (-358.590) (-357.155) (-357.983) [-357.789] -- 0:00:04 917500 -- (-359.376) [-356.574] (-358.375) (-360.447) * (-357.701) (-359.089) (-356.832) [-359.385] -- 0:00:04 918000 -- (-357.268) [-357.796] (-358.431) (-359.220) * [-356.004] (-358.614) (-357.891) (-359.293) -- 0:00:04 918500 -- (-358.366) [-357.296] (-357.349) (-360.480) * (-356.639) (-358.881) [-360.787] (-360.731) -- 0:00:04 919000 -- (-357.633) (-358.612) (-357.519) [-356.427] * (-357.756) [-360.155] (-359.833) (-361.102) -- 0:00:04 919500 -- [-358.410] (-357.155) (-359.778) (-357.097) * (-357.747) (-357.289) (-358.468) [-361.362] -- 0:00:04 920000 -- (-359.651) (-358.209) [-357.832] (-358.524) * (-360.179) (-358.465) (-358.004) [-357.390] -- 0:00:04 Average standard deviation of split frequencies: 0.008431 920500 -- (-357.509) [-362.633] (-356.883) (-356.847) * [-357.476] (-359.675) (-358.083) (-357.757) -- 0:00:04 921000 -- [-364.214] (-359.258) (-359.220) (-356.842) * (-359.903) [-358.981] (-356.589) (-359.082) -- 0:00:04 921500 -- (-363.896) (-357.522) (-367.565) [-362.777] * (-361.491) (-358.434) (-358.220) [-358.139] -- 0:00:04 922000 -- [-360.001] (-358.043) (-360.502) (-363.528) * (-359.406) (-360.867) (-358.788) [-357.951] -- 0:00:04 922500 -- [-359.221] (-357.436) (-358.615) (-359.268) * (-358.092) (-358.367) (-359.552) [-357.934] -- 0:00:04 923000 -- (-357.548) (-358.234) (-357.241) [-361.676] * (-359.946) (-358.632) (-359.971) [-358.856] -- 0:00:04 923500 -- (-358.953) (-357.568) (-360.079) [-361.932] * (-356.646) [-361.733] (-358.193) (-356.918) -- 0:00:04 924000 -- [-357.730] (-358.482) (-361.337) (-359.153) * (-356.700) [-361.206] (-357.915) (-358.555) -- 0:00:04 924500 -- [-357.393] (-357.596) (-356.218) (-361.072) * (-356.408) (-365.826) (-357.468) [-357.964] -- 0:00:04 925000 -- [-357.260] (-360.724) (-357.601) (-366.377) * (-356.401) (-356.734) [-359.450] (-357.419) -- 0:00:04 Average standard deviation of split frequencies: 0.008383 925500 -- (-359.534) (-360.110) (-359.534) [-359.224] * (-357.604) [-356.977] (-357.412) (-359.027) -- 0:00:04 926000 -- (-356.598) (-360.947) [-357.667] (-358.426) * (-357.169) [-357.620] (-358.133) (-358.682) -- 0:00:04 926500 -- (-358.847) (-362.040) [-356.521] (-359.626) * (-357.405) (-360.145) (-357.585) [-356.839] -- 0:00:04 927000 -- (-358.054) (-357.566) (-356.884) [-358.103] * (-357.141) (-357.723) (-361.004) [-356.153] -- 0:00:04 927500 -- (-361.769) (-357.787) [-359.578] (-357.481) * [-358.733] (-357.242) (-358.699) (-356.403) -- 0:00:04 928000 -- (-358.602) (-358.318) [-360.487] (-358.332) * [-360.809] (-358.165) (-359.186) (-359.077) -- 0:00:04 928500 -- (-358.209) [-357.117] (-358.273) (-359.028) * (-358.930) [-356.358] (-359.565) (-360.259) -- 0:00:04 929000 -- [-359.178] (-359.038) (-359.684) (-361.807) * (-366.173) (-358.914) [-357.187] (-358.271) -- 0:00:04 929500 -- [-360.566] (-360.111) (-358.520) (-357.665) * (-357.250) (-360.503) [-361.548] (-359.927) -- 0:00:04 930000 -- (-359.886) (-357.851) [-356.961] (-360.604) * (-359.173) (-357.217) [-358.649] (-357.009) -- 0:00:04 Average standard deviation of split frequencies: 0.008239 930500 -- (-357.531) (-362.030) [-357.338] (-359.148) * [-356.768] (-357.439) (-356.495) (-357.258) -- 0:00:04 931000 -- (-360.622) [-357.477] (-358.237) (-364.866) * [-362.229] (-357.816) (-357.252) (-357.812) -- 0:00:04 931500 -- (-364.255) [-357.891] (-359.848) (-357.121) * [-358.516] (-356.034) (-357.284) (-361.720) -- 0:00:04 932000 -- (-360.165) [-357.533] (-360.398) (-357.846) * (-360.814) (-356.604) [-358.459] (-361.060) -- 0:00:04 932500 -- (-363.245) (-358.722) [-357.078] (-357.730) * (-358.575) [-356.010] (-359.029) (-359.453) -- 0:00:03 933000 -- (-358.617) (-360.441) (-359.320) [-359.374] * (-356.834) [-356.745] (-356.509) (-360.417) -- 0:00:03 933500 -- [-357.359] (-357.796) (-360.667) (-357.710) * (-359.493) (-356.520) (-360.911) [-357.901] -- 0:00:03 934000 -- (-358.105) (-357.858) (-362.200) [-361.671] * (-358.395) (-358.547) [-359.003] (-364.386) -- 0:00:03 934500 -- (-358.152) (-356.430) (-357.557) [-358.741] * (-357.387) (-360.236) [-358.578] (-359.554) -- 0:00:03 935000 -- (-359.902) (-356.935) (-357.552) [-357.968] * (-356.708) (-358.144) (-359.470) [-356.869] -- 0:00:03 Average standard deviation of split frequencies: 0.008394 935500 -- (-356.844) [-356.983] (-359.509) (-360.959) * (-356.838) (-356.580) (-357.260) [-360.616] -- 0:00:03 936000 -- (-358.014) [-359.670] (-357.117) (-358.545) * (-356.508) (-357.344) (-358.537) [-359.177] -- 0:00:03 936500 -- (-356.864) (-357.407) (-360.576) [-357.601] * (-356.837) (-363.947) [-356.601] (-358.152) -- 0:00:03 937000 -- (-356.684) (-360.373) (-361.719) [-357.400] * (-359.543) (-358.797) [-359.365] (-358.899) -- 0:00:03 937500 -- [-357.322] (-360.040) (-360.991) (-358.041) * (-357.739) (-359.160) [-360.277] (-358.286) -- 0:00:03 938000 -- (-356.843) (-359.007) (-364.379) [-360.079] * [-357.685] (-362.597) (-359.185) (-361.529) -- 0:00:03 938500 -- [-358.663] (-357.515) (-360.015) (-360.587) * [-357.209] (-357.808) (-356.412) (-359.742) -- 0:00:03 939000 -- (-358.728) (-357.883) (-358.937) [-358.872] * (-357.639) (-358.079) [-356.445] (-359.274) -- 0:00:03 939500 -- (-358.451) (-365.979) [-361.426] (-360.345) * (-359.799) (-359.389) (-356.567) [-357.762] -- 0:00:03 940000 -- (-363.077) [-357.391] (-357.975) (-360.668) * (-356.033) [-357.514] (-358.140) (-356.562) -- 0:00:03 Average standard deviation of split frequencies: 0.008486 940500 -- (-359.239) [-357.377] (-358.164) (-357.637) * (-356.136) (-358.751) (-358.090) [-358.520] -- 0:00:03 941000 -- (-359.604) [-358.329] (-356.235) (-361.222) * [-357.809] (-363.487) (-359.706) (-359.016) -- 0:00:03 941500 -- [-360.822] (-357.452) (-357.768) (-358.393) * (-359.033) [-358.685] (-358.440) (-357.221) -- 0:00:03 942000 -- (-359.045) [-357.370] (-357.877) (-356.728) * (-361.212) (-358.517) (-358.325) [-358.955] -- 0:00:03 942500 -- [-358.332] (-357.590) (-357.723) (-356.929) * (-358.217) (-356.757) (-356.916) [-362.657] -- 0:00:03 943000 -- [-357.064] (-357.162) (-358.072) (-359.414) * (-357.256) (-359.270) (-356.999) [-358.096] -- 0:00:03 943500 -- (-360.600) (-358.505) [-358.044] (-358.686) * [-359.246] (-356.767) (-358.096) (-359.072) -- 0:00:03 944000 -- (-357.686) (-359.124) [-357.192] (-359.064) * (-358.748) [-357.264] (-358.747) (-358.275) -- 0:00:03 944500 -- (-359.334) (-358.190) (-356.293) [-356.835] * (-357.580) (-361.139) (-356.935) [-360.933] -- 0:00:03 945000 -- (-356.558) (-357.203) (-360.819) [-356.626] * (-357.157) [-356.816] (-358.167) (-364.066) -- 0:00:03 Average standard deviation of split frequencies: 0.008405 945500 -- (-356.890) [-356.475] (-361.197) (-356.794) * [-357.158] (-357.007) (-360.079) (-361.521) -- 0:00:03 946000 -- [-357.491] (-357.730) (-359.013) (-358.216) * (-359.923) (-356.975) (-360.704) [-360.682] -- 0:00:03 946500 -- [-358.785] (-359.007) (-356.897) (-358.114) * [-362.020] (-358.153) (-360.561) (-358.875) -- 0:00:03 947000 -- (-358.460) (-358.789) (-358.402) [-359.040] * (-364.383) (-358.409) [-360.746] (-359.391) -- 0:00:03 947500 -- (-357.845) (-359.163) (-358.232) [-359.047] * [-356.316] (-358.292) (-359.933) (-357.038) -- 0:00:03 948000 -- (-356.543) [-359.567] (-357.534) (-358.663) * (-357.839) (-358.428) (-360.547) [-360.111] -- 0:00:03 948500 -- [-356.886] (-362.551) (-359.683) (-357.207) * (-356.553) [-358.879] (-362.496) (-361.953) -- 0:00:03 949000 -- (-359.510) (-358.649) [-358.531] (-357.235) * (-360.125) [-357.110] (-358.959) (-362.942) -- 0:00:03 949500 -- [-358.446] (-363.090) (-360.345) (-360.251) * (-357.972) (-357.522) [-357.399] (-360.041) -- 0:00:02 950000 -- [-356.916] (-358.305) (-357.721) (-361.120) * (-358.465) (-356.976) [-356.363] (-359.574) -- 0:00:02 Average standard deviation of split frequencies: 0.008231 950500 -- (-357.381) (-360.904) [-358.112] (-359.818) * (-356.625) [-357.213] (-358.621) (-358.428) -- 0:00:02 951000 -- (-357.845) (-359.917) [-356.701] (-358.660) * (-361.555) (-359.021) [-357.692] (-359.280) -- 0:00:02 951500 -- (-358.268) (-359.397) [-356.212] (-358.027) * (-362.184) (-360.276) (-359.375) [-358.200] -- 0:00:02 952000 -- (-357.763) [-364.464] (-356.786) (-358.174) * (-359.497) [-359.409] (-359.025) (-360.346) -- 0:00:02 952500 -- (-360.086) (-359.385) (-356.863) [-360.157] * [-356.814] (-357.429) (-357.290) (-357.263) -- 0:00:02 953000 -- (-359.925) (-357.277) (-362.668) [-358.512] * (-358.465) (-359.420) (-360.899) [-357.844] -- 0:00:02 953500 -- (-357.710) (-357.996) (-358.450) [-360.075] * [-365.348] (-359.978) (-358.743) (-357.839) -- 0:00:02 954000 -- (-356.542) [-360.048] (-357.730) (-359.427) * (-357.807) (-359.210) (-358.541) [-359.258] -- 0:00:02 954500 -- (-357.523) (-357.703) (-357.590) [-359.634] * [-357.950] (-360.686) (-358.579) (-358.363) -- 0:00:02 955000 -- (-358.502) (-360.267) (-360.235) [-360.506] * (-359.629) [-357.846] (-358.688) (-357.651) -- 0:00:02 Average standard deviation of split frequencies: 0.008514 955500 -- (-357.822) (-360.294) (-358.359) [-362.879] * (-362.664) (-357.301) (-356.210) [-357.302] -- 0:00:02 956000 -- (-360.005) [-357.016] (-359.563) (-364.036) * [-361.402] (-357.340) (-356.871) (-359.571) -- 0:00:02 956500 -- (-359.968) (-359.519) (-359.635) [-356.768] * (-357.604) [-356.224] (-359.730) (-359.486) -- 0:00:02 957000 -- (-358.342) (-358.576) [-357.550] (-356.627) * (-357.382) (-357.168) [-357.279] (-357.376) -- 0:00:02 957500 -- (-360.307) [-359.360] (-357.203) (-356.621) * [-360.107] (-357.237) (-359.882) (-359.375) -- 0:00:02 958000 -- (-358.079) (-359.494) (-356.756) [-356.968] * [-357.514] (-357.948) (-356.600) (-359.366) -- 0:00:02 958500 -- (-358.516) (-357.543) [-358.110] (-357.727) * (-357.632) [-359.053] (-359.625) (-357.893) -- 0:00:02 959000 -- (-358.017) (-358.274) [-356.653] (-359.184) * (-359.112) (-357.616) [-359.006] (-357.641) -- 0:00:02 959500 -- (-360.790) (-357.659) [-357.104] (-359.490) * (-358.995) [-357.404] (-357.691) (-358.678) -- 0:00:02 960000 -- (-363.928) (-357.091) [-358.601] (-361.018) * [-357.714] (-358.318) (-357.980) (-358.809) -- 0:00:02 Average standard deviation of split frequencies: 0.008833 960500 -- [-357.897] (-357.613) (-360.752) (-358.695) * (-359.035) (-357.718) (-357.300) [-358.883] -- 0:00:02 961000 -- (-359.357) [-359.344] (-367.429) (-356.510) * (-360.640) [-357.109] (-356.895) (-365.110) -- 0:00:02 961500 -- (-358.313) (-357.214) (-357.290) [-356.421] * (-358.594) [-359.306] (-356.712) (-361.587) -- 0:00:02 962000 -- [-366.210] (-357.966) (-357.951) (-356.809) * (-358.088) (-358.354) [-359.031] (-357.736) -- 0:00:02 962500 -- (-358.791) (-357.568) (-360.824) [-356.323] * (-360.457) [-357.177] (-363.122) (-358.935) -- 0:00:02 963000 -- (-359.414) (-356.408) (-364.233) [-360.750] * (-359.866) [-358.483] (-357.324) (-359.589) -- 0:00:02 963500 -- (-358.286) (-356.414) [-358.558] (-359.610) * (-356.033) [-356.646] (-358.846) (-357.790) -- 0:00:02 964000 -- (-358.237) [-356.669] (-360.258) (-361.581) * (-356.851) (-356.820) [-358.527] (-357.212) -- 0:00:02 964500 -- [-357.097] (-360.880) (-358.663) (-359.442) * (-356.689) [-356.844] (-356.476) (-357.846) -- 0:00:02 965000 -- (-356.697) (-359.974) (-357.840) [-362.488] * [-358.430] (-358.088) (-359.248) (-358.036) -- 0:00:02 Average standard deviation of split frequencies: 0.009142 965500 -- (-357.263) (-361.233) [-358.369] (-361.534) * (-359.241) (-358.554) [-357.419] (-357.546) -- 0:00:02 966000 -- (-356.179) [-359.040] (-362.142) (-364.699) * (-357.230) (-358.570) [-356.244] (-359.172) -- 0:00:02 966500 -- (-356.910) [-361.259] (-359.058) (-362.246) * [-359.636] (-356.663) (-358.031) (-358.977) -- 0:00:01 967000 -- (-360.657) [-357.960] (-362.104) (-360.095) * (-358.419) [-357.603] (-359.737) (-356.421) -- 0:00:01 967500 -- (-357.256) (-357.325) (-359.981) [-359.075] * (-356.866) (-357.786) [-356.988] (-356.336) -- 0:00:01 968000 -- (-363.570) [-358.934] (-358.247) (-358.199) * (-362.519) (-356.664) [-356.415] (-358.707) -- 0:00:01 968500 -- (-360.131) (-360.505) (-357.420) [-358.103] * (-360.383) (-357.889) [-360.407] (-362.482) -- 0:00:01 969000 -- (-360.876) (-358.121) (-360.576) [-358.194] * (-357.132) [-361.402] (-357.514) (-361.651) -- 0:00:01 969500 -- (-358.475) (-360.765) (-357.418) [-359.211] * (-356.714) (-357.077) [-359.560] (-360.455) -- 0:00:01 970000 -- [-357.044] (-362.650) (-363.764) (-361.206) * (-356.328) (-356.542) (-362.121) [-359.423] -- 0:00:01 Average standard deviation of split frequencies: 0.008709 970500 -- [-358.206] (-358.767) (-357.407) (-358.051) * [-357.399] (-356.169) (-361.769) (-357.368) -- 0:00:01 971000 -- (-359.418) [-358.039] (-357.616) (-356.916) * (-357.746) (-357.236) (-361.743) [-357.052] -- 0:00:01 971500 -- (-358.052) (-357.708) [-361.069] (-361.853) * (-358.388) (-358.307) (-356.416) [-358.045] -- 0:00:01 972000 -- (-360.826) (-359.682) (-360.175) [-362.493] * [-357.024] (-357.384) (-358.619) (-357.852) -- 0:00:01 972500 -- [-360.023] (-357.668) (-361.071) (-357.845) * (-357.187) (-357.030) [-357.749] (-356.603) -- 0:00:01 973000 -- (-361.251) [-356.737] (-359.219) (-359.072) * (-356.425) (-357.027) [-357.810] (-358.500) -- 0:00:01 973500 -- [-357.392] (-357.061) (-358.836) (-359.200) * (-357.997) (-360.575) (-357.924) [-360.661] -- 0:00:01 974000 -- (-360.428) [-360.629] (-358.056) (-361.254) * (-358.332) (-358.436) (-357.242) [-358.682] -- 0:00:01 974500 -- (-358.435) (-361.457) (-361.608) [-362.181] * (-359.244) (-359.037) [-357.066] (-357.509) -- 0:00:01 975000 -- (-359.619) (-358.422) [-360.325] (-359.223) * [-356.993] (-359.646) (-356.427) (-357.892) -- 0:00:01 Average standard deviation of split frequencies: 0.008919 975500 -- [-358.120] (-356.949) (-359.973) (-357.641) * (-358.508) [-360.241] (-358.288) (-361.905) -- 0:00:01 976000 -- [-358.634] (-362.864) (-358.268) (-358.041) * (-356.810) [-356.652] (-356.573) (-358.380) -- 0:00:01 976500 -- [-357.117] (-363.487) (-362.157) (-357.645) * [-356.069] (-358.316) (-357.462) (-365.253) -- 0:00:01 977000 -- (-358.107) [-359.969] (-361.618) (-358.094) * (-357.992) (-357.058) (-358.341) [-356.722] -- 0:00:01 977500 -- (-359.406) [-357.466] (-357.386) (-358.200) * (-361.886) (-357.857) (-359.656) [-357.609] -- 0:00:01 978000 -- (-359.205) (-357.050) [-357.669] (-357.151) * (-358.995) (-360.278) [-359.062] (-360.223) -- 0:00:01 978500 -- (-360.082) [-356.310] (-358.524) (-356.636) * (-358.139) (-359.005) [-356.945] (-356.531) -- 0:00:01 979000 -- (-357.093) (-359.736) (-359.193) [-357.250] * (-358.534) (-356.350) (-359.417) [-356.407] -- 0:00:01 979500 -- [-357.476] (-358.987) (-357.276) (-356.719) * (-357.634) (-357.748) [-358.830] (-357.583) -- 0:00:01 980000 -- [-357.090] (-357.519) (-358.028) (-356.857) * (-356.936) (-359.748) [-358.499] (-358.256) -- 0:00:01 Average standard deviation of split frequencies: 0.008909 980500 -- [-360.136] (-357.687) (-360.180) (-357.811) * [-359.902] (-361.210) (-359.536) (-359.693) -- 0:00:01 981000 -- (-360.023) (-359.402) [-356.278] (-357.214) * (-358.837) (-359.038) [-356.939] (-363.429) -- 0:00:01 981500 -- [-358.638] (-360.130) (-357.254) (-356.382) * [-356.733] (-362.260) (-357.414) (-362.473) -- 0:00:01 982000 -- (-359.378) (-359.487) (-360.972) [-359.531] * (-357.622) (-361.500) [-360.382] (-361.215) -- 0:00:01 982500 -- (-357.979) (-361.339) (-362.994) [-357.232] * (-357.565) (-358.731) [-359.663] (-358.269) -- 0:00:01 983000 -- (-356.601) [-356.647] (-360.422) (-358.445) * (-359.167) (-356.600) (-362.244) [-359.446] -- 0:00:01 983500 -- [-357.221] (-357.478) (-356.555) (-356.670) * (-358.775) (-357.959) [-358.760] (-358.384) -- 0:00:00 984000 -- [-358.509] (-356.521) (-360.131) (-357.794) * (-359.839) (-357.205) (-357.794) [-360.809] -- 0:00:00 984500 -- (-361.416) [-356.759] (-363.229) (-359.132) * (-360.460) (-356.465) (-358.580) [-359.362] -- 0:00:00 985000 -- (-357.865) (-356.450) (-358.815) [-356.656] * (-357.456) (-362.499) [-357.341] (-357.811) -- 0:00:00 Average standard deviation of split frequencies: 0.008510 985500 -- (-359.392) (-357.118) [-356.837] (-363.818) * [-356.403] (-358.249) (-356.313) (-357.099) -- 0:00:00 986000 -- (-358.214) (-358.391) [-357.887] (-366.867) * [-357.056] (-359.326) (-356.674) (-357.654) -- 0:00:00 986500 -- (-356.870) [-359.840] (-356.861) (-358.217) * (-356.719) (-361.670) (-357.191) [-360.019] -- 0:00:00 987000 -- (-358.944) [-357.875] (-356.761) (-360.843) * [-358.747] (-359.381) (-357.019) (-360.515) -- 0:00:00 987500 -- (-359.648) (-358.074) (-360.420) [-358.962] * (-362.633) [-359.791] (-357.000) (-361.664) -- 0:00:00 988000 -- (-365.231) (-357.457) (-360.316) [-361.055] * (-358.640) [-356.390] (-358.105) (-360.935) -- 0:00:00 988500 -- (-362.360) (-360.646) [-357.727] (-361.079) * (-356.718) (-362.042) [-357.455] (-360.396) -- 0:00:00 989000 -- (-358.900) [-361.819] (-364.237) (-358.083) * (-357.040) (-359.929) (-358.610) [-361.846] -- 0:00:00 989500 -- (-356.657) (-358.344) [-359.138] (-358.082) * [-356.999] (-358.602) (-357.878) (-362.356) -- 0:00:00 990000 -- (-357.370) (-358.567) [-357.198] (-358.920) * [-358.328] (-362.063) (-359.072) (-357.817) -- 0:00:00 Average standard deviation of split frequencies: 0.008375 990500 -- [-358.196] (-357.012) (-356.942) (-358.526) * (-358.064) (-357.201) (-358.094) [-356.566] -- 0:00:00 991000 -- [-357.708] (-357.194) (-359.113) (-357.779) * (-358.071) (-359.081) [-358.477] (-358.110) -- 0:00:00 991500 -- (-358.565) (-357.827) (-358.673) [-357.023] * (-359.779) (-362.672) (-356.613) [-357.905] -- 0:00:00 992000 -- (-359.720) (-357.652) [-356.664] (-358.214) * (-360.074) (-357.947) (-359.471) [-363.355] -- 0:00:00 992500 -- [-357.211] (-357.360) (-357.519) (-357.855) * (-358.730) [-357.399] (-357.939) (-362.281) -- 0:00:00 993000 -- (-356.682) [-360.576] (-360.122) (-357.835) * (-359.251) [-358.148] (-358.860) (-361.232) -- 0:00:00 993500 -- (-357.950) (-358.167) (-358.157) [-357.412] * (-357.290) [-356.675] (-361.003) (-357.284) -- 0:00:00 994000 -- (-358.396) [-357.503] (-362.488) (-356.665) * (-358.920) (-356.856) [-360.632] (-358.394) -- 0:00:00 994500 -- (-360.344) (-358.722) (-362.878) [-355.918] * (-361.419) (-356.797) (-361.738) [-358.225] -- 0:00:00 995000 -- (-360.505) [-357.541] (-358.050) (-357.023) * (-358.642) [-356.441] (-357.272) (-361.434) -- 0:00:00 Average standard deviation of split frequencies: 0.008267 995500 -- [-358.974] (-358.222) (-357.310) (-356.831) * (-357.679) [-357.236] (-357.991) (-357.840) -- 0:00:00 996000 -- [-358.733] (-357.445) (-357.093) (-362.595) * [-355.991] (-357.879) (-357.982) (-357.354) -- 0:00:00 996500 -- (-357.497) (-360.784) (-356.285) [-357.926] * [-357.291] (-357.676) (-358.801) (-356.387) -- 0:00:00 997000 -- (-357.133) [-358.978] (-356.403) (-359.705) * (-359.553) (-358.004) (-357.699) [-358.339] -- 0:00:00 997500 -- (-356.070) (-358.217) [-357.021] (-362.282) * [-358.802] (-359.039) (-360.736) (-361.233) -- 0:00:00 998000 -- (-360.814) [-357.976] (-361.369) (-358.741) * (-363.739) [-356.881] (-358.630) (-356.286) -- 0:00:00 998500 -- [-359.416] (-359.739) (-361.690) (-356.988) * (-360.432) (-358.491) (-361.881) [-357.305] -- 0:00:00 999000 -- [-357.067] (-357.610) (-356.960) (-359.367) * [-359.381] (-356.618) (-357.736) (-360.546) -- 0:00:00 999500 -- [-361.645] (-360.627) (-356.467) (-359.984) * (-360.463) [-360.258] (-359.596) (-361.042) -- 0:00:00 1000000 -- [-358.677] (-359.258) (-356.513) (-356.852) * (-358.221) [-358.274] (-362.072) (-357.686) -- 0:00:00 Average standard deviation of split frequencies: 0.008166 Analysis completed in 59 seconds Analysis used 57.87 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -355.87 Likelihood of best state for "cold" chain of run 2 was -355.87 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 74.8 % ( 68 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 42.0 % ( 30 %) Dirichlet(Pi{all}) 40.0 % ( 33 %) Slider(Pi{all}) 78.8 % ( 54 %) Multiplier(Alpha{1,2}) 77.9 % ( 46 %) Multiplier(Alpha{3}) 26.1 % ( 25 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.0 % ( 71 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.3 % ( 86 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 26 %) Multiplier(V{all}) 97.4 % ( 98 %) Nodeslider(V{all}) 30.8 % ( 24 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 74.9 % ( 69 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 42.4 % ( 26 %) Dirichlet(Pi{all}) 40.6 % ( 29 %) Slider(Pi{all}) 78.4 % ( 57 %) Multiplier(Alpha{1,2}) 77.1 % ( 49 %) Multiplier(Alpha{3}) 26.1 % ( 25 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.4 % ( 77 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.3 % ( 26 %) Multiplier(V{all}) 97.3 % ( 99 %) Nodeslider(V{all}) 30.5 % ( 22 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 167137 0.83 0.67 3 | 166507 166640 0.84 4 | 166248 166455 167013 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166714 0.82 0.67 3 | 166059 166526 0.84 4 | 167093 167087 166521 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -357.37 | 2 | | | | 2 2 1 2 | | 222 1 2 2 1 | |22 222 1 12 1 1 2 | |1 2 11 11 1 2 1 1 1 1 * 2 2 | | 1 2 2 1 121 2 122 *1 22| | 1 2 1 12 2112 2 1* 1 2 2 1 1 2 2 1| | 22* 11 22 2 2 1 22 1 21 1 *2 1 | | 1 1 1 2 1 * 1 2 | | 1 2 1 2 1 | | 1 1 1 1 | | 2 2 1 | | | | 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -359.49 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -357.66 -361.38 2 -357.54 -360.81 -------------------------------------- TOTAL -357.60 -361.13 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896243 0.090088 0.362521 1.486402 0.859692 1304.86 1340.46 1.000 r(A<->C){all} 0.175273 0.020877 0.000072 0.457714 0.138481 99.13 140.99 1.018 r(A<->G){all} 0.181522 0.023705 0.000069 0.499833 0.140704 116.62 170.95 1.000 r(A<->T){all} 0.159703 0.019039 0.000001 0.436356 0.121572 56.92 135.00 1.001 r(C<->G){all} 0.157666 0.017880 0.000022 0.414003 0.121123 239.69 241.98 1.003 r(C<->T){all} 0.165805 0.018743 0.000077 0.431658 0.132110 192.24 219.46 1.001 r(G<->T){all} 0.160031 0.018163 0.000006 0.433201 0.124703 217.10 237.86 1.005 pi(A){all} 0.169932 0.000539 0.127435 0.216924 0.169193 1416.22 1427.68 1.000 pi(C){all} 0.260254 0.000714 0.207450 0.311879 0.259647 1032.67 1241.17 1.000 pi(G){all} 0.313465 0.000816 0.256586 0.366743 0.313187 1301.24 1315.33 1.000 pi(T){all} 0.256349 0.000711 0.207947 0.311414 0.255557 1213.15 1357.07 1.000 alpha{1,2} 0.411468 0.225909 0.000177 1.382476 0.238897 1202.76 1351.88 1.000 alpha{3} 0.435563 0.223610 0.000318 1.381044 0.276053 1333.63 1342.50 1.000 pinvar{all} 0.993478 0.000063 0.977174 0.999998 0.996087 1171.04 1304.09 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**.** 8 -- .*...* 9 -- ....** 10 -- .**... 11 -- ..*.*. 12 -- ..**** 13 -- .*.*.. 14 -- ...**. 15 -- .***.* 16 -- ...*.* 17 -- .*.*** 18 -- .****. 19 -- ..**.. 20 -- .*..*. 21 -- ..*..* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 451 0.150233 0.004240 0.147235 0.153231 2 8 447 0.148901 0.003298 0.146569 0.151233 2 9 446 0.148568 0.005653 0.144570 0.152565 2 10 438 0.145903 0.014133 0.135909 0.155896 2 11 437 0.145570 0.007066 0.140573 0.150566 2 12 431 0.143571 0.013662 0.133911 0.153231 2 13 424 0.141239 0.001884 0.139907 0.142572 2 14 424 0.141239 0.000000 0.141239 0.141239 2 15 419 0.139574 0.013662 0.129913 0.149234 2 16 418 0.139241 0.003769 0.136576 0.141905 2 17 418 0.139241 0.004711 0.135909 0.142572 2 18 415 0.138241 0.008951 0.131912 0.144570 2 19 415 0.138241 0.011777 0.129913 0.146569 2 20 412 0.137242 0.019786 0.123251 0.151233 2 21 411 0.136909 0.009893 0.129913 0.143904 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.098528 0.009206 0.000035 0.299177 0.069859 1.000 2 length{all}[2] 0.099360 0.010202 0.000014 0.283952 0.068122 1.000 2 length{all}[3] 0.095728 0.009181 0.000059 0.288614 0.067653 1.000 2 length{all}[4] 0.100910 0.009918 0.000047 0.294722 0.071168 1.001 2 length{all}[5] 0.099768 0.009677 0.000009 0.297368 0.071126 1.000 2 length{all}[6] 0.100121 0.009909 0.000008 0.306730 0.066499 1.000 2 length{all}[7] 0.098843 0.009107 0.000315 0.303927 0.065663 0.998 2 length{all}[8] 0.095460 0.008573 0.000201 0.284820 0.067679 1.001 2 length{all}[9] 0.101976 0.008945 0.000770 0.309240 0.073079 1.002 2 length{all}[10] 0.091807 0.008732 0.000037 0.286563 0.065204 0.999 2 length{all}[11] 0.100535 0.009400 0.000029 0.285553 0.076364 0.998 2 length{all}[12] 0.094497 0.008455 0.000204 0.274323 0.065993 0.998 2 length{all}[13] 0.097354 0.010150 0.000000 0.286096 0.067666 1.002 2 length{all}[14] 0.102506 0.011291 0.000007 0.309024 0.071573 0.998 2 length{all}[15] 0.102671 0.010899 0.000074 0.311729 0.074713 0.999 2 length{all}[16] 0.097142 0.010250 0.000121 0.298617 0.060545 0.998 2 length{all}[17] 0.100978 0.010040 0.000009 0.304777 0.072758 0.998 2 length{all}[18] 0.102658 0.008999 0.000041 0.299405 0.072115 0.998 2 length{all}[19] 0.093530 0.007451 0.000162 0.256399 0.067781 1.005 2 length{all}[20] 0.110185 0.013366 0.000384 0.301477 0.075358 1.003 2 length{all}[21] 0.107655 0.010358 0.000214 0.332055 0.079624 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008166 Maximum standard deviation of split frequencies = 0.019786 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.005 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------------- C1 (1) | |--------------------------------------------------------------------- C2 (2) | |-------------------------------------------------------------------- C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 261 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 40 patterns at 87 / 87 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 40 patterns at 87 / 87 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 39040 bytes for conP 3520 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.061198 0.098297 0.071907 0.098225 0.046795 0.016671 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -369.898557 Iterating by ming2 Initial: fx= 369.898557 x= 0.06120 0.09830 0.07191 0.09823 0.04680 0.01667 0.30000 1.30000 1 h-m-p 0.0000 0.0002 207.3370 +++ 361.505367 m 0.0002 14 | 1/8 2 h-m-p 0.0012 0.0097 31.5719 -----------.. | 1/8 3 h-m-p 0.0000 0.0004 189.5397 +++ 348.730119 m 0.0004 46 | 2/8 4 h-m-p 0.0025 0.0132 23.8479 ------------.. | 2/8 5 h-m-p 0.0000 0.0002 170.3439 +++ 343.789734 m 0.0002 79 | 3/8 6 h-m-p 0.0015 0.0194 16.9936 -----------.. | 3/8 7 h-m-p 0.0000 0.0001 147.7472 ++ 341.020920 m 0.0001 110 | 4/8 8 h-m-p 0.0012 0.0277 12.4035 -----------.. | 4/8 9 h-m-p 0.0000 0.0003 120.6826 +++ 336.448328 m 0.0003 142 | 5/8 10 h-m-p 0.0034 0.0475 7.7651 ------------.. | 5/8 11 h-m-p 0.0000 0.0000 85.8068 ++ 336.442081 m 0.0000 174 | 6/8 12 h-m-p 0.0160 8.0000 0.0000 -C 336.442081 0 0.0010 186 | 6/8 13 h-m-p 1.6000 8.0000 0.0000 ------Y 336.442081 0 0.0001 205 Out.. lnL = -336.442081 206 lfun, 206 eigenQcodon, 1236 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.066119 0.107220 0.080471 0.065238 0.061028 0.059594 0.299807 0.882929 0.286785 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 12.158727 np = 9 lnL0 = -373.142163 Iterating by ming2 Initial: fx= 373.142163 x= 0.06612 0.10722 0.08047 0.06524 0.06103 0.05959 0.29981 0.88293 0.28678 1 h-m-p 0.0000 0.0007 199.0783 ++++ 343.575351 m 0.0007 16 | 1/9 2 h-m-p 0.0000 0.0000 139.8669 ++ 342.957034 m 0.0000 28 | 2/9 3 h-m-p 0.0001 0.0005 106.5597 ++ 340.843820 m 0.0005 40 | 3/9 4 h-m-p 0.0000 0.0000 3082.1105 ++ 340.470545 m 0.0000 52 | 4/9 5 h-m-p 0.0001 0.0006 135.4338 ++ 339.109362 m 0.0006 64 | 5/9 6 h-m-p 0.0002 0.0008 107.2274 ++ 336.442086 m 0.0008 76 | 6/9 7 h-m-p 1.6000 8.0000 0.0000 ++ 336.442086 m 8.0000 88 | 6/9 8 h-m-p 0.0035 1.7501 0.3201 +++++ 336.442079 m 1.7501 106 | 7/9 9 h-m-p 0.1458 0.7290 0.3013 ++ 336.442078 m 0.7290 121 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 C 336.442078 0 1.6000 135 | 8/9 11 h-m-p 0.0008 0.4024 1.8650 +++++ 336.442078 m 0.4024 151 | 8/9 12 h-m-p 0.2646 1.3232 0.7557 -----Y 336.442078 0 0.0001 168 | 8/9 13 h-m-p 1.6000 8.0000 0.0000 Y 336.442078 0 1.6000 181 Out.. lnL = -336.442078 182 lfun, 546 eigenQcodon, 2184 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.020424 0.107167 0.036443 0.010437 0.017905 0.022919 0.000100 0.915388 0.480359 0.133352 1.305152 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 10.578178 np = 11 lnL0 = -354.158714 Iterating by ming2 Initial: fx= 354.158714 x= 0.02042 0.10717 0.03644 0.01044 0.01791 0.02292 0.00011 0.91539 0.48036 0.13335 1.30515 1 h-m-p 0.0000 0.0000 195.5735 ++ 353.775058 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0026 47.4704 +++ 348.845632 m 0.0026 31 | 2/11 3 h-m-p 0.0001 0.0003 61.3329 ++ 346.642717 m 0.0003 45 | 3/11 4 h-m-p 0.0000 0.0002 25.8123 ++ 346.505748 m 0.0002 59 | 4/11 5 h-m-p 0.0000 0.0000 1097.2813 ++ 345.927029 m 0.0000 73 | 5/11 6 h-m-p 0.0003 0.0347 34.3874 ++++ 341.730482 m 0.0347 89 | 6/11 7 h-m-p 0.0007 0.0036 94.7499 ++ 338.950083 m 0.0036 103 | 7/11 8 h-m-p 0.0006 0.0038 587.4472 ++ 336.442078 m 0.0038 117 | 8/11 9 h-m-p 1.6000 8.0000 0.0006 -------N 336.442078 0 0.0000 138 | 8/11 10 h-m-p 0.0160 8.0000 0.0000 N 336.442078 0 0.0020 155 Out.. lnL = -336.442078 156 lfun, 624 eigenQcodon, 2808 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -336.444106 S = -336.440662 -0.001316 Calculating f(w|X), posterior probabilities of site classes. did 10 / 40 patterns 0:02 did 20 / 40 patterns 0:02 did 30 / 40 patterns 0:02 did 40 / 40 patterns 0:02 Time used: 0:02 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.038161 0.030850 0.074460 0.100591 0.055394 0.016292 0.000100 0.783037 1.791698 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 15.607183 np = 9 lnL0 = -362.605902 Iterating by ming2 Initial: fx= 362.605902 x= 0.03816 0.03085 0.07446 0.10059 0.05539 0.01629 0.00011 0.78304 1.79170 1 h-m-p 0.0000 0.0000 197.2224 ++ 362.375397 m 0.0000 14 | 1/9 2 h-m-p 0.0001 0.0677 11.7582 ----------.. | 1/9 3 h-m-p 0.0000 0.0002 197.3352 +++ 354.795622 m 0.0002 47 | 2/9 4 h-m-p 0.0035 0.0800 9.9860 ------------.. | 2/9 5 h-m-p 0.0000 0.0002 182.9562 +++ 348.828672 m 0.0002 82 | 3/9 6 h-m-p 0.0041 0.1163 6.9493 ------------.. | 3/9 7 h-m-p 0.0000 0.0001 165.7042 ++ 346.395239 m 0.0001 116 | 4/9 8 h-m-p 0.0025 0.1627 5.0754 ------------.. | 4/9 9 h-m-p 0.0000 0.0002 143.8662 +++ 342.035149 m 0.0002 151 | 5/9 10 h-m-p 0.0068 0.2400 3.6050 -------------.. | 5/9 11 h-m-p 0.0000 0.0002 118.6129 +++ 338.749234 m 0.0002 187 | 6/9 12 h-m-p 0.0097 0.5244 2.0010 -------------.. | 6/9 13 h-m-p 0.0000 0.0003 84.5316 +++ 336.442084 m 0.0003 223 | 7/9 14 h-m-p 0.5852 8.0000 0.0000 ++ 336.442084 m 8.0000 235 | 7/9 15 h-m-p 0.0526 8.0000 0.0004 ++++ 336.442084 m 8.0000 251 | 7/9 16 h-m-p 0.0052 2.6058 4.0695 --------Y 336.442084 0 0.0000 273 | 7/9 17 h-m-p 0.0889 8.0000 0.0000 --C 336.442084 0 0.0014 287 | 7/9 18 h-m-p 0.0853 8.0000 0.0000 +Y 336.442084 0 0.3414 302 Out.. lnL = -336.442084 303 lfun, 3333 eigenQcodon, 18180 P(t) Time used: 0:06 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.085801 0.091345 0.102133 0.030092 0.016932 0.015871 0.000100 0.900000 0.285777 1.564520 1.300027 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 16.453710 np = 11 lnL0 = -363.507150 Iterating by ming2 Initial: fx= 363.507150 x= 0.08580 0.09134 0.10213 0.03009 0.01693 0.01587 0.00011 0.90000 0.28578 1.56452 1.30003 1 h-m-p 0.0000 0.0000 181.9362 ++ 363.391534 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0009 103.8187 ++++ 356.263950 m 0.0009 32 | 2/11 3 h-m-p 0.0000 0.0000 80.1131 ++ 355.795478 m 0.0000 46 | 3/11 4 h-m-p 0.0001 0.0021 49.7407 +++ 352.557233 m 0.0021 61 | 4/11 5 h-m-p 0.0004 0.0020 73.8556 ++ 340.385813 m 0.0020 75 | 5/11 6 h-m-p 0.0003 0.0014 52.7223 ++ 339.357806 m 0.0014 89 | 6/11 7 h-m-p 0.0125 0.2593 2.2582 -------------.. | 6/11 8 h-m-p 0.0000 0.0001 116.8733 ++ 338.311170 m 0.0001 128 | 7/11 9 h-m-p 0.0030 0.1517 2.0701 ------------.. | 7/11 10 h-m-p 0.0000 0.0003 83.1901 +++ 336.442084 m 0.0003 167 | 8/11 11 h-m-p 0.2907 8.0000 0.0000 +++ 336.442084 m 8.0000 182 | 8/11 12 h-m-p 0.0160 8.0000 0.0503 +++++ 336.442078 m 8.0000 202 | 8/11 13 h-m-p 0.4785 2.3927 0.2743 ++ 336.442075 m 2.3927 219 | 9/11 14 h-m-p 1.0464 8.0000 0.4197 ++ 336.442073 m 8.0000 236 | 9/11 15 h-m-p 1.6000 8.0000 0.7739 ++ 336.442073 m 8.0000 252 | 9/11 16 h-m-p 1.6000 8.0000 1.9027 ++ 336.442072 m 8.0000 268 | 9/11 17 h-m-p 1.6000 8.0000 3.0051 ++ 336.442072 m 8.0000 282 | 9/11 18 h-m-p 0.5705 2.8524 17.5210 ----------------.. | 9/11 19 h-m-p 0.0160 8.0000 0.0000 -----N 336.442072 0 0.0000 329 | 9/11 20 h-m-p 1.6000 8.0000 0.0000 -Y 336.442072 0 0.1000 346 Out.. lnL = -336.442072 347 lfun, 4164 eigenQcodon, 22902 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -336.440168 S = -336.440040 -0.000056 Calculating f(w|X), posterior probabilities of site classes. did 10 / 40 patterns 0:12 did 20 / 40 patterns 0:12 did 30 / 40 patterns 0:12 did 40 / 40 patterns 0:12 Time used: 0:12 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=87 NC_011896_1_WP_010907676_1_337_MLBR_RS01640 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV NC_002677_1_NP_301352_1_224_ML0325 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV ************************************************** NC_011896_1_WP_010907676_1_337_MLBR_RS01640 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG NC_002677_1_NP_301352_1_224_ML0325 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825 LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG *************************************
>NC_011896_1_WP_010907676_1_337_MLBR_RS01640 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >NC_002677_1_NP_301352_1_224_ML0325 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA >NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825 GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG GCCTTATGGGA
>NC_011896_1_WP_010907676_1_337_MLBR_RS01640 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >NC_002677_1_NP_301352_1_224_ML0325 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG >NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825 VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
#NEXUS [ID: 0771709338] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907676_1_337_MLBR_RS01640 NC_002677_1_NP_301352_1_224_ML0325 NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775 NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855 NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745 NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825 ; end; begin trees; translate 1 NC_011896_1_WP_010907676_1_337_MLBR_RS01640, 2 NC_002677_1_NP_301352_1_224_ML0325, 3 NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775, 4 NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855, 5 NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745, 6 NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06985926,2:0.06812233,3:0.06765335,4:0.07116847,5:0.07112611,6:0.06649854); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06985926,2:0.06812233,3:0.06765335,4:0.07116847,5:0.07112611,6:0.06649854); end;
Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -357.66 -361.38 2 -357.54 -360.81 -------------------------------------- TOTAL -357.60 -361.13 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896243 0.090088 0.362521 1.486402 0.859692 1304.86 1340.46 1.000 r(A<->C){all} 0.175273 0.020877 0.000072 0.457714 0.138481 99.13 140.99 1.018 r(A<->G){all} 0.181522 0.023705 0.000069 0.499833 0.140704 116.62 170.95 1.000 r(A<->T){all} 0.159703 0.019039 0.000001 0.436356 0.121572 56.92 135.00 1.001 r(C<->G){all} 0.157666 0.017880 0.000022 0.414003 0.121123 239.69 241.98 1.003 r(C<->T){all} 0.165805 0.018743 0.000077 0.431658 0.132110 192.24 219.46 1.001 r(G<->T){all} 0.160031 0.018163 0.000006 0.433201 0.124703 217.10 237.86 1.005 pi(A){all} 0.169932 0.000539 0.127435 0.216924 0.169193 1416.22 1427.68 1.000 pi(C){all} 0.260254 0.000714 0.207450 0.311879 0.259647 1032.67 1241.17 1.000 pi(G){all} 0.313465 0.000816 0.256586 0.366743 0.313187 1301.24 1315.33 1.000 pi(T){all} 0.256349 0.000711 0.207947 0.311414 0.255557 1213.15 1357.07 1.000 alpha{1,2} 0.411468 0.225909 0.000177 1.382476 0.238897 1202.76 1351.88 1.000 alpha{3} 0.435563 0.223610 0.000318 1.381044 0.276053 1333.63 1342.50 1.000 pinvar{all} 0.993478 0.000063 0.977174 0.999998 0.996087 1171.04 1304.09 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0325/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 87 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0 TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0 Leu TTA 2 2 2 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0 CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 1 1 1 1 1 1 CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0 CTG 1 1 1 1 1 1 | CCG 1 1 1 1 1 1 | CAG 0 0 0 0 0 0 | CGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0 ATC 1 1 1 1 1 1 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0 ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1 Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 4 4 4 4 4 4 | Ala GCT 2 2 2 2 2 2 | Asp GAT 5 5 5 5 5 5 | Gly GGT 2 2 2 2 2 2 GTC 6 6 6 6 6 6 | GCC 5 5 5 5 5 5 | GAC 1 1 1 1 1 1 | GGC 5 5 5 5 5 5 GTA 3 3 3 3 3 3 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1 GTG 5 5 5 5 5 5 | GCG 3 3 3 3 3 3 | GAG 2 2 2 2 2 2 | GGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907676_1_337_MLBR_RS01640 position 1: T:0.17241 C:0.16092 A:0.13793 G:0.52874 position 2: T:0.36782 C:0.25287 A:0.21839 G:0.16092 position 3: T:0.22989 C:0.36782 A:0.14943 G:0.25287 Average T:0.25670 C:0.26054 A:0.16858 G:0.31418 #2: NC_002677_1_NP_301352_1_224_ML0325 position 1: T:0.17241 C:0.16092 A:0.13793 G:0.52874 position 2: T:0.36782 C:0.25287 A:0.21839 G:0.16092 position 3: T:0.22989 C:0.36782 A:0.14943 G:0.25287 Average T:0.25670 C:0.26054 A:0.16858 G:0.31418 #3: NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775 position 1: T:0.17241 C:0.16092 A:0.13793 G:0.52874 position 2: T:0.36782 C:0.25287 A:0.21839 G:0.16092 position 3: T:0.22989 C:0.36782 A:0.14943 G:0.25287 Average T:0.25670 C:0.26054 A:0.16858 G:0.31418 #4: NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855 position 1: T:0.17241 C:0.16092 A:0.13793 G:0.52874 position 2: T:0.36782 C:0.25287 A:0.21839 G:0.16092 position 3: T:0.22989 C:0.36782 A:0.14943 G:0.25287 Average T:0.25670 C:0.26054 A:0.16858 G:0.31418 #5: NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745 position 1: T:0.17241 C:0.16092 A:0.13793 G:0.52874 position 2: T:0.36782 C:0.25287 A:0.21839 G:0.16092 position 3: T:0.22989 C:0.36782 A:0.14943 G:0.25287 Average T:0.25670 C:0.26054 A:0.16858 G:0.31418 #6: NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825 position 1: T:0.17241 C:0.16092 A:0.13793 G:0.52874 position 2: T:0.36782 C:0.25287 A:0.21839 G:0.16092 position 3: T:0.22989 C:0.36782 A:0.14943 G:0.25287 Average T:0.25670 C:0.26054 A:0.16858 G:0.31418 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 0 TTC 18 | TCC 12 | TAC 6 | TGC 0 Leu L TTA 12 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 6 | TCG 6 | TAG 0 | Trp W TGG 0 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 0 CTC 12 | CCC 0 | CAC 0 | CGC 6 CTA 0 | CCA 6 | Gln Q CAA 6 | CGA 0 CTG 6 | CCG 6 | CAG 0 | CGG 24 ------------------------------------------------------------------------------ Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 0 ATC 6 | ACC 18 | AAC 12 | AGC 0 ATA 6 | ACA 0 | Lys K AAA 0 | Arg R AGA 6 Met M ATG 6 | ACG 0 | AAG 18 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 24 | Ala A GCT 12 | Asp D GAT 30 | Gly G GGT 12 GTC 36 | GCC 30 | GAC 6 | GGC 30 GTA 18 | GCA 0 | Glu E GAA 12 | GGA 6 GTG 30 | GCG 18 | GAG 12 | GGG 0 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.17241 C:0.16092 A:0.13793 G:0.52874 position 2: T:0.36782 C:0.25287 A:0.21839 G:0.16092 position 3: T:0.22989 C:0.36782 A:0.14943 G:0.25287 Average T:0.25670 C:0.26054 A:0.16858 G:0.31418 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -336.442081 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299807 1.300027 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29981 omega (dN/dS) = 1.30003 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 183.1 77.9 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 183.1 77.9 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 183.1 77.9 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 183.1 77.9 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 183.1 77.9 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 183.1 77.9 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -336.442078 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.999951 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.00001 0.99999 w: 0.99995 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 186.3 74.7 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 186.3 74.7 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 186.3 74.7 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 186.3 74.7 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 186.3 74.7 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 186.3 74.7 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -336.442078 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.179714 0.604812 0.000001 2.096016 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.17971 0.60481 0.21547 w: 0.00000 1.00000 2.09602 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 186.3 74.7 1.0564 0.0000 0.0000 0.0 0.0 7..2 0.000 186.3 74.7 1.0564 0.0000 0.0000 0.0 0.0 7..3 0.000 186.3 74.7 1.0564 0.0000 0.0000 0.0 0.0 7..4 0.000 186.3 74.7 1.0564 0.0000 0.0000 0.0 0.0 7..5 0.000 186.3 74.7 1.0564 0.0000 0.0000 0.0 0.0 7..6 0.000 186.3 74.7 1.0564 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907676_1_337_MLBR_RS01640) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907676_1_337_MLBR_RS01640) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:02 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -336.442084 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.783109 1.788708 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.78311 q = 1.78871 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.01178 0.04871 0.09554 0.15068 0.21420 0.28712 0.37158 0.47175 0.59682 0.77775 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 186.3 74.7 0.3026 0.0000 0.0000 0.0 0.0 7..2 0.000 186.3 74.7 0.3026 0.0000 0.0000 0.0 0.0 7..3 0.000 186.3 74.7 0.3026 0.0000 0.0000 0.0 0.0 7..4 0.000 186.3 74.7 0.3026 0.0000 0.0000 0.0 0.0 7..5 0.000 186.3 74.7 0.3026 0.0000 0.0000 0.0 0.0 7..6 0.000 186.3 74.7 0.3026 0.0000 0.0000 0.0 0.0 Time used: 0:06 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -336.442072 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.581270 50.976149 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.00001 p = 0.00500 q = 1.58127 (p1 = 0.99999) w = 50.97615 MLEs of dN/dS (w) for site classes (K=11) p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 50.97615 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 186.3 74.7 50.9756 0.0000 0.0000 0.0 0.0 7..2 0.000 186.3 74.7 50.9756 0.0000 0.0000 0.0 0.0 7..3 0.000 186.3 74.7 50.9756 0.0000 0.0000 0.0 0.0 7..4 0.000 186.3 74.7 50.9756 0.0000 0.0000 0.0 0.0 7..5 0.000 186.3 74.7 50.9756 0.0000 0.0000 0.0 0.0 7..6 0.000 186.3 74.7 50.9756 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907676_1_337_MLBR_RS01640) Pr(w>1) post mean +- SE for w 1 V 1.000** 50.976 2 L 1.000** 50.976 3 R 1.000** 50.976 4 G 1.000** 50.976 5 N 1.000** 50.976 6 K 1.000** 50.976 7 I 1.000** 50.976 8 V 1.000** 50.976 9 V 1.000** 50.976 10 L 1.000** 50.976 11 P 1.000** 50.976 12 E 1.000** 50.976 13 V 1.000** 50.976 14 F 1.000** 50.976 15 A 1.000** 50.976 16 L 1.000** 50.976 17 T 1.000** 50.976 18 D 1.000** 50.976 19 Y 1.000** 50.976 20 Y 1.000** 50.976 21 L 1.000** 50.976 22 A 1.000** 50.976 23 D 1.000** 50.976 24 V 1.000** 50.976 25 R 1.000** 50.976 26 F 1.000** 50.976 27 N 1.000** 50.976 28 I 1.000** 50.976 29 E 1.000** 50.976 30 T 1.000** 50.976 31 K 1.000** 50.976 32 V 1.000** 50.976 33 A 1.000** 50.976 34 A 1.000** 50.976 35 D 1.000** 50.976 36 R 1.000** 50.976 37 P 1.000** 50.976 38 A 1.000** 50.976 39 V 1.000** 50.976 40 S 1.000** 50.976 41 V 1.000** 50.976 42 F 1.000** 50.976 43 S 1.000** 50.976 44 Q 1.000** 50.976 45 E 1.000** 50.976 46 F 1.000** 50.976 47 V 1.000** 50.976 48 D 1.000** 50.976 49 V 1.000** 50.976 50 V 1.000** 50.976 51 L 1.000** 50.976 52 A 1.000** 50.976 53 V 1.000** 50.976 54 V 1.000** 50.976 55 R 1.000** 50.976 56 S 1.000** 50.976 57 V 1.000** 50.976 58 G 1.000** 50.976 59 K 1.000** 50.976 60 V 1.000** 50.976 61 D 1.000** 50.976 62 R 1.000** 50.976 63 V 1.000** 50.976 64 A 1.000** 50.976 65 S 1.000** 50.976 66 P 1.000** 50.976 67 G 1.000** 50.976 68 E 1.000** 50.976 69 R 1.000** 50.976 70 P 1.000** 50.976 71 A 1.000** 50.976 72 D 1.000** 50.976 73 G 1.000** 50.976 74 A 1.000** 50.976 75 S 1.000** 50.976 76 G 1.000** 50.976 77 L 1.000** 50.976 78 A 1.000** 50.976 79 V 1.000** 50.976 80 Y 1.000** 50.976 81 T 1.000** 50.976 82 V 1.000** 50.976 83 G 1.000** 50.976 84 G 1.000** 50.976 85 L 1.000** 50.976 86 M 1.000** 50.976 87 G 1.000** 50.976 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907676_1_337_MLBR_RS01640) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Time used: 0:12
Model 1: NearlyNeutral -336.442078 Model 2: PositiveSelection -336.442078 Model 0: one-ratio -336.442081 Model 7: beta -336.442084 Model 8: beta&w>1 -336.442072 Model 0 vs 1 5.999999984851456E-6 Model 2 vs 1 0.0 Model 8 vs 7 2.4000000053092663E-5