--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 17:13:54 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0325/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -357.66          -361.38
2       -357.54          -360.81
--------------------------------------
TOTAL     -357.60          -361.13
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896243    0.090088    0.362521    1.486402    0.859692   1304.86   1340.46    1.000
r(A<->C){all}   0.175273    0.020877    0.000072    0.457714    0.138481     99.13    140.99    1.018
r(A<->G){all}   0.181522    0.023705    0.000069    0.499833    0.140704    116.62    170.95    1.000
r(A<->T){all}   0.159703    0.019039    0.000001    0.436356    0.121572     56.92    135.00    1.001
r(C<->G){all}   0.157666    0.017880    0.000022    0.414003    0.121123    239.69    241.98    1.003
r(C<->T){all}   0.165805    0.018743    0.000077    0.431658    0.132110    192.24    219.46    1.001
r(G<->T){all}   0.160031    0.018163    0.000006    0.433201    0.124703    217.10    237.86    1.005
pi(A){all}      0.169932    0.000539    0.127435    0.216924    0.169193   1416.22   1427.68    1.000
pi(C){all}      0.260254    0.000714    0.207450    0.311879    0.259647   1032.67   1241.17    1.000
pi(G){all}      0.313465    0.000816    0.256586    0.366743    0.313187   1301.24   1315.33    1.000
pi(T){all}      0.256349    0.000711    0.207947    0.311414    0.255557   1213.15   1357.07    1.000
alpha{1,2}      0.411468    0.225909    0.000177    1.382476    0.238897   1202.76   1351.88    1.000
alpha{3}        0.435563    0.223610    0.000318    1.381044    0.276053   1333.63   1342.50    1.000
pinvar{all}     0.993478    0.000063    0.977174    0.999998    0.996087   1171.04   1304.09    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-336.442078
Model 2: PositiveSelection	-336.442078
Model 0: one-ratio	-336.442081
Model 7: beta	-336.442084
Model 8: beta&w>1	-336.442072


Model 0 vs 1	5.999999984851456E-6

Model 2 vs 1	0.0

Model 8 vs 7	2.4000000053092663E-5
>C1
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C2
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C3
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C4
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C5
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C6
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=87 

C1              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C2              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C3              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C4              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C5              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C6              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
                **************************************************

C1              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C2              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C3              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C4              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C5              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C6              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
                *************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2610]--->[2610]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.609 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C2              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C3              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C4              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C5              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
C6              VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
                **************************************************

C1              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C2              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C3              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C4              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C5              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
C6              LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
                *************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
C2              GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
C3              GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
C4              GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
C5              GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
C6              GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
                **************************************************

C1              CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
C2              CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
C3              CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
C4              CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
C5              CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
C6              CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
                **************************************************

C1              CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
C2              CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
C3              CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
C4              CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
C5              CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
C6              CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
                **************************************************

C1              CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
C2              CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
C3              CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
C4              CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
C5              CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
C6              CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
                **************************************************

C1              CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
C2              CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
C3              CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
C4              CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
C5              CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
C6              CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
                **************************************************

C1              GCCTTATGGGA
C2              GCCTTATGGGA
C3              GCCTTATGGGA
C4              GCCTTATGGGA
C5              GCCTTATGGGA
C6              GCCTTATGGGA
                ***********



>C1
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>C2
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>C3
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>C4
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>C5
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>C6
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>C1
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C2
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C3
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C4
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C5
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>C6
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 261 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579799559
      Setting output file names to "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 104194655
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0771709338
      Seed = 1254296529
      Swapseed = 1579799559
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -584.130510 -- -24.965149
         Chain 2 -- -584.130476 -- -24.965149
         Chain 3 -- -584.130510 -- -24.965149
         Chain 4 -- -584.130476 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -584.130510 -- -24.965149
         Chain 2 -- -584.130476 -- -24.965149
         Chain 3 -- -584.130510 -- -24.965149
         Chain 4 -- -584.130510 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-584.131] (-584.130) (-584.131) (-584.130) * [-584.131] (-584.130) (-584.131) (-584.131) 
        500 -- (-365.403) [-360.080] (-371.189) (-371.757) * (-367.959) [-370.722] (-366.825) (-365.231) -- 0:00:00
       1000 -- (-369.927) (-365.098) (-368.252) [-367.934] * (-369.430) [-372.170] (-368.422) (-366.403) -- 0:00:00
       1500 -- (-370.864) (-363.069) (-362.399) [-363.424] * (-363.394) (-365.441) [-364.661] (-374.636) -- 0:00:00
       2000 -- (-366.697) (-369.399) [-370.607] (-367.339) * [-362.738] (-365.097) (-372.296) (-367.868) -- 0:00:00
       2500 -- (-367.593) (-368.418) (-373.026) [-367.054] * (-366.072) [-369.479] (-373.170) (-363.934) -- 0:00:00
       3000 -- (-361.287) (-368.867) [-362.377] (-365.107) * (-366.064) [-367.353] (-366.722) (-367.455) -- 0:00:00
       3500 -- (-372.210) (-365.096) [-368.032] (-365.335) * (-371.646) (-365.592) [-365.786] (-365.293) -- 0:04:44
       4000 -- (-368.616) [-366.408] (-368.030) (-392.669) * (-368.446) [-365.480] (-368.987) (-366.373) -- 0:04:09
       4500 -- [-364.503] (-366.928) (-369.553) (-378.756) * (-374.302) (-364.941) (-368.395) [-367.870] -- 0:03:41
       5000 -- (-364.511) (-364.338) (-364.862) [-359.292] * (-368.969) [-364.018] (-367.668) (-365.468) -- 0:03:19

      Average standard deviation of split frequencies: 0.088815

       5500 -- (-370.624) (-368.540) (-366.253) [-358.225] * (-369.861) (-374.138) (-364.854) [-367.404] -- 0:03:00
       6000 -- [-364.676] (-369.568) (-371.482) (-360.818) * [-370.878] (-377.804) (-363.717) (-368.373) -- 0:02:45
       6500 -- (-370.276) [-368.442] (-369.492) (-357.974) * (-372.705) (-375.993) (-367.570) [-369.594] -- 0:02:32
       7000 -- (-366.596) (-371.683) (-360.512) [-356.432] * [-363.385] (-373.388) (-375.549) (-367.196) -- 0:02:21
       7500 -- [-367.628] (-367.800) (-366.405) (-356.465) * (-362.797) (-366.337) (-367.643) [-365.255] -- 0:02:12
       8000 -- (-365.897) (-368.206) (-368.262) [-357.915] * [-368.360] (-362.442) (-371.401) (-367.600) -- 0:02:04
       8500 -- (-364.592) (-372.994) (-374.255) [-358.869] * [-370.512] (-361.161) (-373.979) (-368.966) -- 0:01:56
       9000 -- [-368.639] (-376.698) (-374.572) (-357.801) * (-376.729) (-357.530) [-369.779] (-368.961) -- 0:01:50
       9500 -- (-377.373) (-360.554) [-365.006] (-362.354) * (-367.860) (-359.651) [-365.522] (-367.490) -- 0:01:44
      10000 -- (-372.938) (-364.882) (-366.655) [-356.487] * (-373.997) (-358.470) [-358.549] (-371.135) -- 0:01:39

      Average standard deviation of split frequencies: 0.078344

      10500 -- (-369.420) [-364.145] (-379.084) (-356.646) * (-372.603) (-362.023) (-360.579) [-362.828] -- 0:01:34
      11000 -- (-363.665) [-366.971] (-369.525) (-363.243) * (-374.778) (-358.470) [-356.869] (-370.737) -- 0:01:29
      11500 -- (-367.168) [-367.879] (-370.477) (-358.628) * (-374.030) (-356.326) [-357.069] (-377.707) -- 0:01:25
      12000 -- (-370.414) (-371.235) (-373.964) [-358.545] * (-363.415) (-360.984) [-357.154] (-372.893) -- 0:01:22
      12500 -- (-375.739) (-365.651) (-376.454) [-357.914] * (-369.924) (-358.569) [-357.539] (-371.594) -- 0:01:19
      13000 -- (-367.070) [-362.351] (-364.178) (-357.938) * (-369.209) (-361.299) (-358.694) [-367.533] -- 0:01:15
      13500 -- (-370.290) (-367.755) [-367.609] (-356.948) * (-373.251) (-357.283) [-360.991] (-370.964) -- 0:01:13
      14000 -- (-365.583) (-367.693) (-365.096) [-358.567] * (-363.848) (-357.663) [-360.472] (-367.615) -- 0:01:10
      14500 -- [-360.174] (-363.897) (-367.095) (-357.902) * (-368.372) (-357.997) [-356.725] (-370.868) -- 0:01:07
      15000 -- (-369.373) (-373.427) (-375.917) [-360.328] * (-364.655) (-358.169) [-356.606] (-365.587) -- 0:01:05

      Average standard deviation of split frequencies: 0.060329

      15500 -- (-379.498) (-372.362) (-378.482) [-356.627] * (-365.288) (-358.347) (-357.202) [-366.987] -- 0:01:03
      16000 -- [-364.963] (-374.494) (-359.926) (-356.494) * (-376.024) (-361.194) [-359.260] (-374.688) -- 0:01:01
      16500 -- (-364.704) (-379.471) [-357.913] (-358.496) * (-368.917) (-357.229) (-357.911) [-363.452] -- 0:00:59
      17000 -- (-358.549) (-364.115) [-357.247] (-357.021) * (-370.611) (-361.050) (-357.519) [-370.086] -- 0:00:57
      17500 -- (-357.662) [-356.815] (-356.882) (-357.649) * (-366.106) (-357.052) (-357.362) [-366.147] -- 0:00:56
      18000 -- (-357.216) (-356.991) (-358.173) [-357.213] * (-372.376) [-356.830] (-358.268) (-366.906) -- 0:00:54
      18500 -- (-364.852) (-360.620) (-357.466) [-356.796] * [-366.507] (-356.966) (-359.223) (-366.672) -- 0:00:53
      19000 -- (-364.223) (-356.627) [-359.432] (-356.840) * (-376.895) (-360.771) [-361.224] (-371.021) -- 0:00:51
      19500 -- [-357.624] (-358.197) (-364.055) (-362.201) * (-358.082) (-361.819) [-359.370] (-375.833) -- 0:00:50
      20000 -- (-358.922) (-360.024) [-358.866] (-360.885) * (-357.969) [-360.675] (-357.757) (-365.126) -- 0:00:49

      Average standard deviation of split frequencies: 0.051622

      20500 -- (-357.503) [-357.642] (-357.449) (-357.590) * [-358.141] (-356.859) (-357.826) (-377.079) -- 0:01:35
      21000 -- (-359.358) (-357.204) [-359.279] (-360.149) * (-362.196) (-356.523) (-358.012) [-358.440] -- 0:01:33
      21500 -- [-359.840] (-359.614) (-358.011) (-357.421) * (-356.622) [-360.113] (-361.194) (-359.234) -- 0:01:31
      22000 -- (-357.178) (-360.273) [-357.277] (-359.999) * (-357.262) [-357.903] (-364.513) (-358.641) -- 0:01:28
      22500 -- (-361.835) [-359.037] (-357.996) (-357.414) * (-364.309) [-357.730] (-356.320) (-365.686) -- 0:01:26
      23000 -- [-357.820] (-358.484) (-358.095) (-359.141) * (-357.355) [-363.378] (-356.763) (-362.048) -- 0:01:24
      23500 -- [-360.300] (-359.926) (-360.708) (-361.586) * (-358.075) (-358.739) [-358.131] (-359.398) -- 0:01:23
      24000 -- (-361.283) (-357.193) (-357.457) [-358.336] * (-357.617) (-364.967) [-359.131] (-358.781) -- 0:01:21
      24500 -- (-360.155) [-357.916] (-359.481) (-360.612) * (-359.303) (-359.217) [-361.936] (-360.211) -- 0:01:19
      25000 -- (-358.922) [-357.095] (-358.047) (-357.375) * [-358.282] (-357.013) (-362.256) (-358.038) -- 0:01:18

      Average standard deviation of split frequencies: 0.045759

      25500 -- (-361.096) (-358.991) (-359.755) [-358.429] * (-357.039) (-357.917) [-362.128] (-360.945) -- 0:01:16
      26000 -- (-361.579) (-360.109) [-356.912] (-361.431) * (-357.750) [-357.206] (-359.186) (-364.039) -- 0:01:14
      26500 -- (-364.031) (-357.589) (-357.470) [-359.090] * (-356.499) (-359.580) [-357.621] (-356.852) -- 0:01:13
      27000 -- [-359.352] (-356.924) (-356.484) (-363.104) * (-359.442) (-359.358) (-357.450) [-359.072] -- 0:01:12
      27500 -- (-356.935) [-357.232] (-357.165) (-358.708) * [-357.926] (-358.867) (-357.418) (-357.571) -- 0:01:10
      28000 -- (-357.058) [-356.805] (-357.967) (-358.351) * (-356.463) (-361.196) (-355.953) [-358.550] -- 0:01:09
      28500 -- (-358.585) (-357.194) (-360.407) [-358.287] * (-358.918) (-357.865) (-357.297) [-358.986] -- 0:01:08
      29000 -- (-359.066) [-359.285] (-357.990) (-356.753) * (-358.543) (-358.187) [-358.385] (-358.165) -- 0:01:06
      29500 -- (-358.527) [-357.917] (-357.241) (-357.048) * [-359.151] (-363.835) (-358.819) (-359.517) -- 0:01:05
      30000 -- (-361.392) [-356.092] (-359.126) (-359.171) * [-356.995] (-358.332) (-361.192) (-359.627) -- 0:01:04

      Average standard deviation of split frequencies: 0.043689

      30500 -- (-357.711) (-357.299) [-356.678] (-361.088) * (-356.480) (-358.675) [-358.570] (-360.099) -- 0:01:03
      31000 -- (-356.235) (-356.553) (-358.691) [-356.414] * [-357.579] (-358.571) (-360.051) (-356.748) -- 0:01:02
      31500 -- (-357.730) [-357.412] (-357.419) (-356.580) * (-357.893) [-361.797] (-359.563) (-356.883) -- 0:01:01
      32000 -- (-361.147) (-357.575) (-358.566) [-357.878] * (-357.334) (-358.039) (-363.345) [-357.821] -- 0:01:00
      32500 -- (-360.971) (-360.254) (-359.029) [-358.472] * (-358.695) [-358.812] (-357.801) (-358.596) -- 0:00:59
      33000 -- (-359.152) [-356.769] (-361.192) (-359.463) * [-357.468] (-360.498) (-357.804) (-358.679) -- 0:00:58
      33500 -- [-357.742] (-359.466) (-361.575) (-359.912) * (-361.249) (-357.431) (-356.101) [-360.330] -- 0:00:57
      34000 -- (-359.158) (-360.769) [-358.190] (-356.849) * (-358.456) (-358.395) (-357.669) [-358.671] -- 0:00:56
      34500 -- [-360.600] (-358.522) (-358.482) (-358.963) * (-356.986) (-356.852) (-358.169) [-358.620] -- 0:00:55
      35000 -- (-360.441) (-358.811) (-359.477) [-358.326] * (-358.936) (-361.159) [-359.378] (-356.943) -- 0:00:55

      Average standard deviation of split frequencies: 0.039284

      35500 -- [-359.053] (-357.932) (-356.931) (-362.233) * (-361.783) (-360.766) [-360.839] (-357.893) -- 0:00:54
      36000 -- (-362.956) [-356.925] (-357.405) (-358.960) * (-356.171) [-358.548] (-359.645) (-357.952) -- 0:00:53
      36500 -- (-356.692) (-359.506) (-357.430) [-358.548] * (-357.602) (-360.244) [-357.796] (-361.246) -- 0:00:52
      37000 -- (-358.390) (-357.473) (-358.363) [-356.885] * (-357.497) (-359.660) (-359.339) [-359.359] -- 0:00:52
      37500 -- (-357.830) (-359.466) (-358.693) [-357.891] * [-358.385] (-361.669) (-358.822) (-358.834) -- 0:01:17
      38000 -- (-357.771) (-361.339) [-357.094] (-356.708) * (-360.363) (-360.475) [-358.834] (-357.012) -- 0:01:15
      38500 -- (-359.770) (-360.045) [-357.270] (-358.319) * (-359.597) (-360.453) (-358.215) [-356.728] -- 0:01:14
      39000 -- [-357.016] (-359.173) (-357.557) (-357.323) * (-358.157) (-357.518) [-356.809] (-356.982) -- 0:01:13
      39500 -- (-360.246) (-362.569) [-357.684] (-356.926) * (-359.205) (-365.515) (-356.049) [-356.372] -- 0:01:12
      40000 -- (-359.989) (-364.312) [-360.528] (-357.880) * [-359.697] (-359.734) (-360.120) (-357.575) -- 0:01:12

      Average standard deviation of split frequencies: 0.034776

      40500 -- (-356.578) (-359.036) [-359.167] (-356.343) * (-357.644) (-359.783) (-357.961) [-356.606] -- 0:01:11
      41000 -- (-358.032) [-358.271] (-358.337) (-356.949) * (-360.723) (-356.873) [-359.277] (-359.240) -- 0:01:10
      41500 -- (-357.052) (-357.497) [-358.652] (-358.031) * (-358.530) [-360.083] (-363.083) (-356.927) -- 0:01:09
      42000 -- (-358.399) [-358.055] (-359.416) (-358.064) * (-358.003) (-360.328) [-358.069] (-358.362) -- 0:01:08
      42500 -- (-358.586) (-357.450) [-357.912] (-359.413) * (-358.458) (-358.947) (-356.491) [-356.614] -- 0:01:07
      43000 -- (-359.497) [-357.789] (-356.944) (-358.176) * [-359.473] (-356.471) (-358.210) (-358.811) -- 0:01:06
      43500 -- (-359.276) [-359.499] (-358.521) (-358.811) * (-357.177) [-356.572] (-356.224) (-361.775) -- 0:01:05
      44000 -- (-359.180) [-357.742] (-359.954) (-359.768) * [-357.787] (-358.889) (-360.308) (-358.471) -- 0:01:05
      44500 -- (-358.158) (-357.684) [-358.022] (-357.591) * (-356.695) (-357.223) (-362.803) [-357.043] -- 0:01:04
      45000 -- (-361.644) [-358.299] (-357.550) (-359.637) * [-357.430] (-358.780) (-360.317) (-361.538) -- 0:01:03

      Average standard deviation of split frequencies: 0.025620

      45500 -- [-359.593] (-357.277) (-356.937) (-358.077) * [-358.231] (-360.409) (-356.281) (-359.157) -- 0:01:02
      46000 -- [-362.115] (-358.561) (-357.852) (-357.483) * (-359.465) (-359.746) [-356.607] (-357.605) -- 0:01:02
      46500 -- (-356.738) (-357.346) (-361.855) [-356.867] * (-357.824) [-357.289] (-358.746) (-360.459) -- 0:01:01
      47000 -- (-358.360) (-360.251) (-356.552) [-356.533] * [-359.561] (-357.415) (-360.012) (-356.920) -- 0:01:00
      47500 -- [-357.033] (-361.352) (-360.120) (-356.484) * (-359.027) (-357.724) (-356.802) [-357.236] -- 0:01:00
      48000 -- [-358.987] (-358.882) (-359.339) (-357.008) * (-358.181) (-357.306) [-358.284] (-358.310) -- 0:00:59
      48500 -- [-359.779] (-358.133) (-359.799) (-357.799) * (-358.209) (-358.150) [-358.597] (-358.421) -- 0:00:58
      49000 -- (-358.990) (-359.688) (-362.087) [-358.067] * (-359.408) [-360.710] (-357.956) (-360.799) -- 0:00:58
      49500 -- [-357.976] (-357.016) (-359.805) (-358.991) * (-358.420) [-360.439] (-360.682) (-361.553) -- 0:00:57
      50000 -- (-360.492) (-359.528) [-356.506] (-357.957) * (-357.351) (-361.462) (-362.731) [-357.579] -- 0:00:57

      Average standard deviation of split frequencies: 0.029684

      50500 -- [-361.813] (-358.587) (-356.870) (-362.426) * [-360.396] (-362.143) (-360.727) (-358.131) -- 0:00:56
      51000 -- (-358.426) [-359.666] (-357.617) (-357.548) * (-357.458) [-360.883] (-358.540) (-358.998) -- 0:00:55
      51500 -- [-358.113] (-357.433) (-356.720) (-357.485) * (-359.488) (-359.449) [-357.208] (-357.764) -- 0:00:55
      52000 -- [-358.174] (-356.853) (-359.245) (-363.153) * (-362.479) (-359.392) (-357.231) [-360.058] -- 0:00:54
      52500 -- (-360.663) [-357.719] (-357.896) (-359.561) * [-357.602] (-361.944) (-358.807) (-358.093) -- 0:00:54
      53000 -- (-356.614) (-360.453) (-356.580) [-358.307] * (-358.730) (-356.390) (-359.417) [-359.500] -- 0:00:53
      53500 -- (-359.029) (-361.406) (-361.638) [-357.504] * (-357.124) (-357.527) (-358.811) [-357.378] -- 0:00:53
      54000 -- (-361.326) [-357.739] (-356.430) (-358.406) * [-356.473] (-356.605) (-359.161) (-359.669) -- 0:00:52
      54500 -- (-357.435) [-359.697] (-357.533) (-357.926) * (-364.223) [-357.854] (-361.776) (-357.133) -- 0:00:52
      55000 -- (-359.091) (-357.385) (-357.191) [-358.613] * [-356.414] (-356.565) (-363.034) (-356.432) -- 0:01:08

      Average standard deviation of split frequencies: 0.030064

      55500 -- (-357.552) [-358.627] (-358.123) (-360.271) * (-362.030) [-356.358] (-363.110) (-356.577) -- 0:01:08
      56000 -- [-356.439] (-357.669) (-361.319) (-359.383) * (-359.294) [-357.140] (-362.640) (-356.939) -- 0:01:07
      56500 -- (-358.481) [-357.780] (-357.973) (-359.691) * (-359.711) [-357.608] (-362.436) (-358.038) -- 0:01:06
      57000 -- (-360.754) (-358.376) (-357.863) [-359.687] * (-359.292) (-358.007) (-356.467) [-359.465] -- 0:01:06
      57500 -- (-359.389) (-357.136) [-359.008] (-365.063) * [-357.331] (-358.903) (-357.429) (-358.487) -- 0:01:05
      58000 -- (-359.337) (-357.915) [-357.001] (-362.953) * (-357.695) (-357.654) [-357.579] (-357.033) -- 0:01:04
      58500 -- (-359.799) (-360.683) [-358.110] (-358.633) * (-358.221) (-358.233) [-357.686] (-358.945) -- 0:01:04
      59000 -- [-360.526] (-359.780) (-364.384) (-359.017) * (-356.555) (-357.217) [-358.048] (-358.386) -- 0:01:03
      59500 -- (-359.493) (-358.344) (-360.620) [-357.000] * (-357.866) [-359.513] (-357.635) (-358.240) -- 0:01:03
      60000 -- (-358.231) (-357.975) [-360.273] (-359.531) * [-359.091] (-357.540) (-357.335) (-362.476) -- 0:01:02

      Average standard deviation of split frequencies: 0.024088

      60500 -- (-357.460) [-357.308] (-359.939) (-357.680) * (-357.966) (-357.485) [-356.827] (-358.026) -- 0:01:02
      61000 -- (-359.349) [-357.118] (-358.731) (-359.452) * (-361.351) (-357.619) (-360.275) [-363.501] -- 0:01:01
      61500 -- (-357.970) (-358.908) (-357.893) [-357.616] * (-358.877) (-359.457) [-359.864] (-358.604) -- 0:01:01
      62000 -- (-357.677) (-357.890) (-361.691) [-358.051] * (-360.809) (-359.796) [-357.322] (-359.276) -- 0:01:00
      62500 -- (-358.641) [-356.779] (-357.152) (-357.595) * (-357.956) (-357.824) [-356.441] (-358.599) -- 0:01:00
      63000 -- [-357.084] (-356.739) (-365.198) (-360.320) * [-357.326] (-358.106) (-359.797) (-360.385) -- 0:00:59
      63500 -- (-357.773) [-356.672] (-360.314) (-360.386) * (-359.783) (-356.231) [-360.470] (-359.315) -- 0:00:58
      64000 -- (-358.041) [-358.992] (-359.282) (-356.736) * (-357.296) [-356.575] (-361.996) (-357.272) -- 0:00:58
      64500 -- (-358.241) (-356.843) [-357.553] (-356.521) * [-358.210] (-358.536) (-361.476) (-358.007) -- 0:00:58
      65000 -- (-357.897) [-359.140] (-357.802) (-358.328) * (-360.320) (-357.915) [-357.194] (-361.801) -- 0:00:57

      Average standard deviation of split frequencies: 0.028245

      65500 -- (-359.723) (-358.047) [-361.212] (-359.672) * (-357.059) (-357.476) [-356.359] (-356.966) -- 0:00:57
      66000 -- (-360.588) (-358.140) (-358.537) [-358.298] * (-360.947) (-357.436) (-359.068) [-359.598] -- 0:00:56
      66500 -- (-359.398) [-358.031] (-358.397) (-360.526) * (-359.061) [-356.321] (-359.867) (-358.863) -- 0:00:56
      67000 -- (-356.560) (-358.506) [-360.812] (-359.155) * (-358.215) [-356.413] (-358.541) (-363.415) -- 0:00:55
      67500 -- (-357.605) (-361.179) [-360.692] (-357.363) * (-358.386) (-356.421) [-361.082] (-357.223) -- 0:00:55
      68000 -- (-357.723) (-356.566) [-363.057] (-362.851) * (-359.281) (-357.834) [-356.427] (-360.210) -- 0:00:54
      68500 -- (-360.282) [-356.737] (-357.880) (-360.526) * [-358.249] (-357.066) (-358.864) (-356.686) -- 0:00:54
      69000 -- (-359.311) [-357.351] (-363.161) (-360.067) * (-358.173) [-358.487] (-366.543) (-358.380) -- 0:00:53
      69500 -- (-363.144) [-358.036] (-357.652) (-365.728) * (-358.214) (-358.599) (-358.557) [-356.371] -- 0:00:53
      70000 -- (-362.857) [-357.371] (-357.982) (-362.840) * [-356.789] (-360.218) (-356.936) (-356.813) -- 0:00:53

      Average standard deviation of split frequencies: 0.030019

      70500 -- (-357.409) (-356.424) (-357.891) [-358.664] * [-356.293] (-360.136) (-357.944) (-360.592) -- 0:00:52
      71000 -- (-357.360) [-359.240] (-360.244) (-357.577) * (-356.703) (-358.856) [-358.823] (-359.469) -- 0:00:52
      71500 -- (-363.133) (-359.628) (-359.514) [-358.739] * (-358.997) (-356.701) (-358.494) [-359.176] -- 0:01:04
      72000 -- (-357.357) (-359.329) [-358.167] (-360.988) * (-359.741) (-359.633) (-358.987) [-361.019] -- 0:01:04
      72500 -- [-358.421] (-359.082) (-358.420) (-360.974) * (-360.253) (-361.655) (-358.401) [-362.841] -- 0:01:03
      73000 -- (-359.119) (-358.257) (-364.088) [-356.684] * (-357.833) (-361.405) [-356.474] (-359.912) -- 0:01:03
      73500 -- (-359.112) (-363.696) (-360.737) [-359.952] * (-356.866) (-356.918) (-357.729) [-361.911] -- 0:01:03
      74000 -- (-357.969) (-359.991) [-359.471] (-358.107) * (-356.401) (-358.234) [-356.706] (-357.423) -- 0:01:02
      74500 -- (-357.678) (-359.090) (-357.860) [-357.397] * (-356.832) [-362.014] (-357.331) (-361.270) -- 0:01:02
      75000 -- (-361.465) [-358.922] (-359.149) (-357.295) * (-361.783) (-360.034) (-360.528) [-356.942] -- 0:01:01

      Average standard deviation of split frequencies: 0.034604

      75500 -- [-357.537] (-356.466) (-357.870) (-358.728) * (-358.615) (-359.337) (-359.391) [-356.827] -- 0:01:01
      76000 -- [-356.872] (-360.564) (-356.273) (-359.411) * (-359.328) (-357.801) (-358.223) [-358.738] -- 0:01:00
      76500 -- (-356.521) [-357.294] (-357.939) (-359.904) * (-359.422) [-357.307] (-357.903) (-356.914) -- 0:01:00
      77000 -- [-357.886] (-362.149) (-357.034) (-362.895) * (-360.792) (-359.339) (-361.387) [-360.852] -- 0:00:59
      77500 -- (-358.049) (-360.366) (-357.679) [-360.556] * (-360.994) (-356.812) (-356.635) [-358.819] -- 0:00:59
      78000 -- (-360.641) [-357.032] (-356.857) (-361.917) * (-358.796) [-358.332] (-360.043) (-359.690) -- 0:00:59
      78500 -- (-360.163) (-358.487) (-356.166) [-359.580] * (-358.128) [-356.839] (-358.064) (-358.221) -- 0:00:58
      79000 -- [-358.012] (-356.475) (-357.185) (-357.576) * (-358.838) (-357.009) [-357.781] (-360.721) -- 0:00:58
      79500 -- [-362.251] (-358.984) (-358.799) (-356.894) * (-361.838) (-357.203) (-357.164) [-360.240] -- 0:00:57
      80000 -- (-359.001) (-359.318) (-359.541) [-357.911] * (-362.019) (-356.577) [-358.354] (-357.800) -- 0:00:57

      Average standard deviation of split frequencies: 0.033018

      80500 -- (-356.332) [-357.579] (-357.480) (-358.247) * (-358.523) [-356.366] (-359.746) (-360.526) -- 0:00:57
      81000 -- (-357.206) (-357.225) [-357.236] (-356.256) * (-361.350) [-356.906] (-356.021) (-357.680) -- 0:00:56
      81500 -- [-357.924] (-359.729) (-357.826) (-357.381) * (-359.123) [-357.156] (-363.524) (-360.542) -- 0:00:56
      82000 -- (-356.832) (-356.933) (-361.958) [-357.166] * [-358.339] (-356.213) (-365.118) (-357.431) -- 0:00:55
      82500 -- (-357.727) (-356.766) (-358.338) [-360.778] * (-357.873) [-358.304] (-358.196) (-360.971) -- 0:00:55
      83000 -- [-358.580] (-358.477) (-357.815) (-357.890) * (-360.997) (-358.455) (-356.537) [-356.736] -- 0:00:55
      83500 -- (-356.999) (-359.445) (-361.871) [-357.154] * (-356.611) [-357.481] (-358.449) (-356.888) -- 0:00:54
      84000 -- (-356.775) (-360.333) (-357.358) [-358.869] * [-357.001] (-358.158) (-363.021) (-356.604) -- 0:00:54
      84500 -- (-358.950) (-359.952) [-358.483] (-358.685) * [-357.807] (-356.339) (-362.277) (-357.667) -- 0:00:54
      85000 -- (-357.374) [-357.894] (-362.262) (-357.784) * [-357.321] (-356.884) (-361.436) (-357.722) -- 0:00:53

      Average standard deviation of split frequencies: 0.029756

      85500 -- [-362.592] (-358.961) (-357.012) (-360.605) * (-362.981) (-361.498) [-360.001] (-358.435) -- 0:00:53
      86000 -- (-362.286) (-361.054) (-358.894) [-356.512] * (-360.331) (-361.275) [-360.420] (-362.790) -- 0:00:53
      86500 -- (-360.852) (-359.886) (-359.662) [-357.783] * [-357.378] (-361.613) (-359.504) (-362.823) -- 0:00:52
      87000 -- (-363.836) (-360.970) (-357.557) [-357.187] * (-357.350) (-359.477) [-357.041] (-358.526) -- 0:00:52
      87500 -- (-357.520) (-358.976) [-357.450] (-358.012) * [-358.418] (-356.857) (-356.626) (-359.746) -- 0:00:52
      88000 -- (-357.730) [-358.386] (-356.818) (-357.994) * (-358.281) [-361.212] (-362.577) (-359.724) -- 0:00:51
      88500 -- (-359.050) (-358.579) [-358.974] (-359.407) * [-357.156] (-358.986) (-358.758) (-357.405) -- 0:01:01
      89000 -- (-360.408) (-358.851) [-361.287] (-361.022) * [-358.613] (-362.703) (-357.455) (-357.452) -- 0:01:01
      89500 -- (-361.752) (-362.637) (-360.078) [-357.627] * [-358.959] (-360.900) (-359.145) (-357.436) -- 0:01:01
      90000 -- (-363.581) [-361.042] (-359.271) (-358.817) * [-356.699] (-362.480) (-360.431) (-356.991) -- 0:01:00

      Average standard deviation of split frequencies: 0.030156

      90500 -- (-360.124) [-358.112] (-358.439) (-357.237) * (-355.919) (-358.770) [-357.272] (-356.963) -- 0:01:00
      91000 -- (-360.823) (-356.336) [-357.097] (-356.666) * (-357.482) (-358.328) [-357.995] (-359.240) -- 0:00:59
      91500 -- (-358.712) [-359.296] (-356.958) (-358.802) * [-358.157] (-359.603) (-359.770) (-357.711) -- 0:00:59
      92000 -- (-357.310) (-357.423) (-358.794) [-357.428] * (-360.938) (-361.130) (-358.659) [-359.228] -- 0:00:59
      92500 -- (-358.574) (-357.918) [-358.018] (-358.541) * (-359.192) [-357.314] (-356.919) (-358.339) -- 0:00:58
      93000 -- (-358.187) (-356.641) (-357.199) [-357.144] * (-358.167) [-357.607] (-356.481) (-357.150) -- 0:00:58
      93500 -- (-359.242) (-356.879) (-360.292) [-357.127] * [-359.176] (-357.713) (-356.690) (-357.168) -- 0:00:58
      94000 -- (-357.505) [-358.676] (-356.517) (-358.328) * (-357.277) [-358.179] (-357.465) (-358.873) -- 0:00:57
      94500 -- [-359.877] (-360.429) (-358.264) (-357.470) * [-360.858] (-358.442) (-357.543) (-359.963) -- 0:00:57
      95000 -- (-359.814) [-359.715] (-361.486) (-357.180) * [-357.321] (-357.491) (-356.646) (-358.551) -- 0:00:57

      Average standard deviation of split frequencies: 0.036092

      95500 -- (-357.189) [-360.030] (-360.782) (-357.004) * [-358.184] (-359.383) (-356.695) (-358.485) -- 0:00:56
      96000 -- (-358.262) [-362.059] (-358.460) (-358.390) * [-357.752] (-358.402) (-358.413) (-361.407) -- 0:00:56
      96500 -- [-357.060] (-361.295) (-358.686) (-359.407) * (-363.491) [-359.948] (-360.351) (-358.609) -- 0:00:56
      97000 -- (-357.014) [-357.354] (-362.553) (-358.236) * (-359.273) [-357.744] (-357.988) (-357.441) -- 0:00:55
      97500 -- (-359.399) (-358.182) (-360.635) [-358.593] * (-357.965) (-357.174) (-359.058) [-357.966] -- 0:00:55
      98000 -- (-357.235) (-359.568) [-357.327] (-361.008) * (-360.846) (-357.639) [-362.495] (-357.258) -- 0:00:55
      98500 -- (-357.058) (-357.996) [-359.587] (-359.540) * (-357.566) (-357.700) [-359.345] (-359.965) -- 0:00:54
      99000 -- (-357.689) (-360.945) (-356.326) [-357.680] * (-362.132) (-357.466) (-360.335) [-359.443] -- 0:00:54
      99500 -- (-357.589) [-358.122] (-356.943) (-358.148) * (-362.101) (-356.444) [-359.774] (-358.281) -- 0:00:54
      100000 -- (-356.972) (-357.126) [-357.073] (-361.145) * (-358.055) (-358.014) (-358.858) [-359.981] -- 0:00:54

      Average standard deviation of split frequencies: 0.034341

      100500 -- (-359.517) (-359.060) (-358.217) [-357.832] * (-357.557) (-360.127) (-358.177) [-359.403] -- 0:00:53
      101000 -- (-359.516) (-358.433) (-358.713) [-358.398] * [-359.848] (-357.788) (-357.869) (-356.699) -- 0:00:53
      101500 -- (-360.267) (-355.927) (-357.755) [-358.926] * [-360.697] (-357.179) (-357.762) (-360.167) -- 0:00:53
      102000 -- (-359.327) [-359.422] (-359.496) (-359.500) * (-356.450) (-359.113) [-357.715] (-358.124) -- 0:00:52
      102500 -- [-357.995] (-358.295) (-358.172) (-360.623) * (-357.398) [-359.178] (-366.943) (-359.317) -- 0:00:52
      103000 -- (-358.042) (-357.820) [-359.868] (-356.476) * (-356.392) (-357.223) (-361.429) [-359.088] -- 0:00:52
      103500 -- (-358.386) [-356.859] (-357.547) (-356.554) * (-357.746) [-358.828] (-359.808) (-359.524) -- 0:00:51
      104000 -- (-358.782) [-357.611] (-357.395) (-361.546) * (-358.020) [-359.572] (-356.948) (-359.145) -- 0:00:51
      104500 -- (-357.576) (-357.377) (-359.157) [-357.576] * (-358.358) (-357.615) [-359.725] (-357.416) -- 0:00:51
      105000 -- (-356.828) (-359.613) (-360.087) [-361.103] * (-357.881) (-358.082) (-357.647) [-358.524] -- 0:00:51

      Average standard deviation of split frequencies: 0.028907

      105500 -- (-362.583) (-361.226) (-358.540) [-357.836] * (-359.955) (-361.851) (-360.542) [-357.391] -- 0:00:59
      106000 -- (-360.552) (-363.863) [-356.859] (-356.973) * (-357.878) [-359.054] (-358.205) (-359.530) -- 0:00:59
      106500 -- (-358.876) (-360.150) [-356.262] (-360.924) * [-361.678] (-357.587) (-358.198) (-359.640) -- 0:00:58
      107000 -- [-356.947] (-357.008) (-360.022) (-358.427) * [-356.407] (-359.401) (-363.490) (-358.256) -- 0:00:58
      107500 -- (-356.405) [-362.239] (-359.144) (-360.438) * (-356.590) [-357.794] (-357.226) (-357.098) -- 0:00:58
      108000 -- (-356.889) (-357.022) [-361.908] (-357.246) * (-358.298) [-357.756] (-357.625) (-359.281) -- 0:00:57
      108500 -- (-358.621) (-359.021) (-359.940) [-358.479] * (-358.902) (-361.524) (-356.301) [-358.839] -- 0:00:57
      109000 -- (-358.058) (-363.614) [-357.880] (-357.600) * (-359.046) (-357.955) (-358.732) [-357.121] -- 0:00:57
      109500 -- [-360.466] (-359.853) (-357.181) (-356.271) * (-357.721) (-360.480) [-359.535] (-357.107) -- 0:00:56
      110000 -- (-361.991) [-359.645] (-359.304) (-357.117) * (-357.308) (-361.803) [-359.373] (-357.619) -- 0:00:56

      Average standard deviation of split frequencies: 0.025558

      110500 -- (-359.205) (-356.848) [-357.248] (-357.259) * (-357.341) (-358.411) [-358.907] (-361.263) -- 0:00:56
      111000 -- (-364.949) (-358.754) (-358.488) [-357.289] * (-358.544) [-356.139] (-360.166) (-362.303) -- 0:00:56
      111500 -- (-361.613) [-358.947] (-358.322) (-356.673) * (-359.061) [-358.561] (-357.723) (-362.771) -- 0:00:55
      112000 -- (-361.573) (-360.368) (-361.509) [-356.544] * [-356.113] (-360.898) (-359.771) (-362.704) -- 0:00:55
      112500 -- (-358.924) [-358.961] (-357.381) (-356.894) * (-361.311) [-357.765] (-360.114) (-356.245) -- 0:00:55
      113000 -- (-359.148) (-362.820) [-357.555] (-357.698) * (-359.028) (-357.751) (-359.635) [-360.816] -- 0:00:54
      113500 -- (-359.592) [-356.209] (-360.203) (-358.333) * [-362.389] (-360.172) (-358.882) (-357.082) -- 0:00:54
      114000 -- [-359.438] (-356.458) (-361.543) (-361.366) * [-361.674] (-362.611) (-357.307) (-358.973) -- 0:00:54
      114500 -- (-359.331) (-356.132) (-357.450) [-361.168] * (-358.669) [-362.587] (-357.445) (-360.950) -- 0:00:54
      115000 -- (-356.802) [-356.627] (-357.832) (-359.999) * (-361.444) (-360.738) (-358.891) [-357.818] -- 0:00:53

      Average standard deviation of split frequencies: 0.022448

      115500 -- (-360.231) (-360.891) (-362.903) [-359.649] * (-361.438) (-363.940) (-358.892) [-357.315] -- 0:00:53
      116000 -- (-361.430) (-358.843) (-358.814) [-357.843] * [-357.413] (-357.800) (-358.711) (-357.540) -- 0:00:53
      116500 -- [-357.397] (-361.797) (-358.973) (-362.626) * (-360.595) (-356.732) [-359.374] (-356.970) -- 0:00:53
      117000 -- [-356.381] (-358.230) (-358.860) (-360.992) * (-357.994) [-359.937] (-357.001) (-356.759) -- 0:00:52
      117500 -- (-360.129) (-360.730) [-360.644] (-364.969) * [-356.889] (-356.878) (-357.286) (-358.890) -- 0:00:52
      118000 -- (-360.447) (-357.432) [-358.554] (-360.962) * (-357.986) (-361.772) [-360.968] (-357.787) -- 0:00:52
      118500 -- (-357.737) (-356.880) (-357.243) [-357.035] * (-360.132) (-358.474) (-357.895) [-357.990] -- 0:00:52
      119000 -- [-357.396] (-357.550) (-356.604) (-358.907) * [-357.111] (-357.892) (-356.660) (-356.526) -- 0:00:51
      119500 -- (-358.000) (-357.103) [-357.541] (-358.491) * (-359.313) [-357.682] (-356.796) (-357.623) -- 0:00:51
      120000 -- [-357.253] (-358.130) (-357.103) (-356.426) * [-357.497] (-357.821) (-359.464) (-359.098) -- 0:00:51

      Average standard deviation of split frequencies: 0.024184

      120500 -- (-356.403) (-356.643) (-360.651) [-356.530] * (-356.993) (-358.411) (-356.942) [-357.931] -- 0:00:51
      121000 -- (-358.413) (-356.886) [-358.212] (-358.012) * (-356.714) (-365.687) (-356.694) [-356.777] -- 0:00:50
      121500 -- (-360.131) (-358.511) (-360.077) [-356.976] * (-358.543) (-360.958) (-359.704) [-357.783] -- 0:00:50
      122000 -- (-356.281) (-356.297) (-357.018) [-359.345] * (-361.508) (-359.273) (-365.048) [-357.732] -- 0:00:50
      122500 -- [-359.280] (-358.352) (-357.101) (-359.367) * (-358.064) (-357.508) [-360.725] (-359.154) -- 0:00:57
      123000 -- (-359.025) [-358.467] (-358.608) (-357.244) * (-358.853) (-363.547) (-356.412) [-356.083] -- 0:00:57
      123500 -- (-358.898) (-357.723) (-356.923) [-359.365] * (-359.187) (-359.461) [-358.743] (-358.487) -- 0:00:56
      124000 -- (-357.886) (-359.915) (-362.678) [-357.750] * (-363.568) (-361.056) (-356.265) [-361.265] -- 0:00:56
      124500 -- [-358.170] (-358.900) (-361.816) (-356.294) * [-359.810] (-360.976) (-361.229) (-358.779) -- 0:00:56
      125000 -- [-359.219] (-358.831) (-356.853) (-360.403) * [-359.015] (-360.586) (-356.796) (-358.565) -- 0:00:56

      Average standard deviation of split frequencies: 0.021379

      125500 -- [-360.750] (-358.146) (-358.507) (-358.661) * [-359.724] (-359.113) (-357.750) (-357.354) -- 0:00:55
      126000 -- (-358.479) [-358.945] (-358.422) (-360.169) * (-357.269) [-357.104] (-357.069) (-363.616) -- 0:00:55
      126500 -- (-360.065) [-359.416] (-359.185) (-358.671) * (-356.882) (-357.886) (-356.902) [-361.926] -- 0:00:55
      127000 -- (-360.354) (-357.193) [-356.559] (-358.960) * [-357.049] (-359.235) (-362.038) (-356.737) -- 0:00:54
      127500 -- (-362.364) (-358.490) [-359.031] (-358.232) * (-357.507) (-356.753) [-360.604] (-361.272) -- 0:00:54
      128000 -- (-359.010) (-357.338) [-357.643] (-359.463) * (-356.004) (-357.352) [-356.944] (-358.095) -- 0:00:54
      128500 -- (-365.374) (-358.009) (-359.616) [-357.604] * (-358.354) (-357.921) [-357.693] (-358.832) -- 0:00:54
      129000 -- (-360.616) (-358.989) (-358.400) [-357.594] * [-357.537] (-359.184) (-357.632) (-361.875) -- 0:00:54
      129500 -- (-357.390) (-360.586) [-360.011] (-359.355) * (-360.798) (-357.869) [-357.122] (-361.831) -- 0:00:53
      130000 -- [-358.377] (-357.912) (-358.522) (-361.198) * [-357.289] (-356.897) (-358.823) (-360.366) -- 0:00:53

      Average standard deviation of split frequencies: 0.021446

      130500 -- [-360.074] (-358.627) (-358.678) (-359.159) * [-357.286] (-359.349) (-360.119) (-357.149) -- 0:00:53
      131000 -- (-359.012) [-358.716] (-357.977) (-362.613) * (-359.440) (-356.470) (-360.758) [-359.113] -- 0:00:53
      131500 -- (-359.680) (-359.557) (-358.116) [-359.341] * (-359.971) (-360.389) (-361.878) [-356.992] -- 0:00:52
      132000 -- (-357.775) (-357.802) (-356.260) [-358.650] * [-360.214] (-357.470) (-360.149) (-359.412) -- 0:00:52
      132500 -- (-356.392) (-358.295) [-356.737] (-360.015) * (-357.569) [-358.490] (-361.430) (-360.950) -- 0:00:52
      133000 -- (-359.751) [-357.925] (-356.864) (-357.385) * [-357.777] (-359.555) (-357.763) (-360.315) -- 0:00:52
      133500 -- (-361.885) [-357.866] (-357.038) (-359.863) * (-359.837) [-356.747] (-359.750) (-356.779) -- 0:00:51
      134000 -- (-358.755) (-363.103) [-356.554] (-362.050) * (-357.760) (-359.249) (-356.796) [-356.929] -- 0:00:51
      134500 -- [-356.647] (-357.815) (-358.470) (-358.914) * (-359.169) [-358.093] (-358.366) (-356.603) -- 0:00:51
      135000 -- [-357.595] (-357.946) (-358.278) (-358.037) * (-357.022) (-357.710) [-358.360] (-358.966) -- 0:00:51

      Average standard deviation of split frequencies: 0.021709

      135500 -- (-356.862) [-358.499] (-358.952) (-358.218) * (-358.821) [-360.377] (-357.985) (-360.452) -- 0:00:51
      136000 -- (-362.824) (-358.681) [-358.403] (-357.721) * (-358.203) (-358.969) (-356.820) [-356.922] -- 0:00:50
      136500 -- [-356.995] (-358.903) (-358.227) (-359.524) * [-361.991] (-357.074) (-357.106) (-361.663) -- 0:00:50
      137000 -- (-358.897) [-357.371] (-360.827) (-356.943) * (-357.165) [-356.825] (-358.337) (-357.796) -- 0:00:50
      137500 -- (-360.651) (-362.354) (-364.320) [-358.216] * (-356.481) (-356.408) (-357.940) [-359.901] -- 0:00:50
      138000 -- (-359.072) (-360.216) (-359.611) [-359.453] * (-362.789) (-362.513) (-358.948) [-357.255] -- 0:00:49
      138500 -- [-357.428] (-359.905) (-356.510) (-362.312) * (-363.096) (-364.139) [-356.352] (-356.596) -- 0:00:49
      139000 -- [-359.193] (-357.278) (-362.040) (-357.940) * [-359.457] (-360.476) (-356.675) (-357.095) -- 0:00:49
      139500 -- (-359.760) [-358.273] (-359.116) (-359.946) * (-360.851) [-356.602] (-356.528) (-357.066) -- 0:00:55
      140000 -- (-359.659) (-357.033) (-363.351) [-356.977] * (-363.069) (-357.271) [-358.303] (-358.269) -- 0:00:55

      Average standard deviation of split frequencies: 0.022155

      140500 -- (-359.786) (-356.938) [-357.522] (-358.078) * (-357.112) (-357.043) [-356.877] (-361.519) -- 0:00:55
      141000 -- (-359.017) [-357.133] (-358.289) (-356.998) * (-358.068) (-356.711) [-359.073] (-359.033) -- 0:00:54
      141500 -- (-356.773) (-359.463) (-358.646) [-357.202] * (-359.288) [-357.725] (-358.516) (-358.887) -- 0:00:54
      142000 -- [-357.813] (-358.891) (-360.956) (-360.160) * [-360.718] (-357.063) (-359.891) (-358.195) -- 0:00:54
      142500 -- [-357.064] (-358.336) (-358.368) (-357.789) * (-359.705) (-357.431) [-356.604] (-361.076) -- 0:00:54
      143000 -- [-356.873] (-361.018) (-357.723) (-358.927) * [-357.044] (-358.319) (-357.912) (-364.462) -- 0:00:53
      143500 -- [-357.902] (-358.783) (-356.733) (-356.965) * (-356.482) [-357.774] (-357.160) (-358.750) -- 0:00:53
      144000 -- (-355.892) [-357.005] (-356.509) (-359.677) * (-358.051) (-358.625) [-359.184] (-358.939) -- 0:00:53
      144500 -- (-357.030) (-359.419) [-356.673] (-357.632) * [-358.667] (-360.863) (-356.378) (-358.803) -- 0:00:53
      145000 -- (-355.918) (-358.233) (-356.497) [-360.073] * [-360.015] (-359.000) (-357.818) (-357.965) -- 0:00:53

      Average standard deviation of split frequencies: 0.022279

      145500 -- (-361.027) [-356.148] (-356.903) (-362.488) * [-359.528] (-356.354) (-361.090) (-357.051) -- 0:00:52
      146000 -- (-359.318) (-357.386) [-356.799] (-359.934) * (-357.489) [-356.398] (-357.534) (-357.832) -- 0:00:52
      146500 -- (-356.620) (-356.946) [-357.099] (-356.363) * (-358.672) (-356.501) (-362.367) [-357.718] -- 0:00:52
      147000 -- (-358.149) [-361.721] (-357.565) (-357.556) * (-360.877) [-357.943] (-356.437) (-356.971) -- 0:00:52
      147500 -- (-357.476) (-358.994) (-359.910) [-357.225] * (-357.108) (-356.527) [-356.958] (-359.883) -- 0:00:52
      148000 -- (-362.268) [-358.785] (-362.217) (-357.561) * (-359.277) (-357.077) [-359.777] (-358.486) -- 0:00:51
      148500 -- (-359.048) [-357.650] (-360.590) (-357.018) * (-361.713) (-357.010) (-360.141) [-357.717] -- 0:00:51
      149000 -- (-358.309) (-356.245) (-359.119) [-358.430] * (-358.287) (-357.606) [-357.932] (-357.029) -- 0:00:51
      149500 -- (-357.470) (-358.159) (-359.705) [-359.980] * (-358.488) (-356.830) (-358.512) [-357.406] -- 0:00:51
      150000 -- (-356.930) (-359.093) [-357.396] (-361.285) * (-356.593) [-356.788] (-357.663) (-361.511) -- 0:00:51

      Average standard deviation of split frequencies: 0.023466

      150500 -- [-357.280] (-356.858) (-356.299) (-357.807) * (-358.429) (-358.369) (-358.690) [-359.064] -- 0:00:50
      151000 -- (-362.279) (-358.128) [-359.336] (-357.649) * (-363.570) (-359.577) (-360.026) [-360.403] -- 0:00:50
      151500 -- (-357.668) [-363.120] (-356.935) (-357.550) * (-365.543) (-359.363) (-359.318) [-357.644] -- 0:00:50
      152000 -- (-358.015) (-361.078) (-358.149) [-356.730] * [-360.217] (-356.312) (-361.866) (-357.879) -- 0:00:50
      152500 -- (-357.082) (-359.361) (-358.359) [-358.785] * (-360.689) [-357.000] (-357.705) (-358.791) -- 0:00:50
      153000 -- (-357.533) [-360.888] (-359.186) (-356.164) * (-360.782) (-358.440) [-359.208] (-357.259) -- 0:00:49
      153500 -- (-356.634) (-356.766) (-357.608) [-357.027] * (-361.305) (-356.444) [-357.574] (-359.568) -- 0:00:49
      154000 -- [-359.784] (-356.911) (-358.102) (-360.039) * [-361.428] (-356.392) (-360.536) (-358.676) -- 0:00:49
      154500 -- (-356.655) [-358.327] (-358.966) (-359.145) * (-357.620) (-357.642) [-357.656] (-358.713) -- 0:00:49
      155000 -- (-357.232) (-359.221) (-358.614) [-359.959] * (-358.210) [-355.962] (-357.879) (-357.107) -- 0:00:49

      Average standard deviation of split frequencies: 0.021312

      155500 -- (-357.348) (-358.967) (-359.599) [-357.282] * (-360.967) [-358.242] (-361.133) (-358.593) -- 0:00:48
      156000 -- (-357.685) (-358.840) (-357.243) [-358.001] * (-357.016) [-359.182] (-358.519) (-358.182) -- 0:00:54
      156500 -- (-363.208) (-359.646) (-357.973) [-358.834] * (-357.380) (-358.932) [-358.252] (-357.205) -- 0:00:53
      157000 -- (-362.492) [-357.836] (-357.004) (-359.745) * (-361.195) (-356.819) [-358.798] (-358.841) -- 0:00:53
      157500 -- [-360.577] (-361.674) (-357.730) (-360.513) * (-357.042) [-357.961] (-356.786) (-359.142) -- 0:00:53
      158000 -- (-373.074) [-363.395] (-358.366) (-359.786) * (-358.644) (-357.966) [-358.357] (-360.777) -- 0:00:53
      158500 -- (-360.930) (-357.085) (-359.444) [-357.679] * (-356.664) (-356.845) (-359.401) [-360.056] -- 0:00:53
      159000 -- [-357.598] (-360.192) (-358.262) (-358.332) * (-358.655) (-357.681) [-361.879] (-356.373) -- 0:00:52
      159500 -- (-360.739) (-357.651) [-357.924] (-357.928) * (-358.946) (-361.429) (-359.304) [-357.286] -- 0:00:52
      160000 -- [-356.221] (-356.460) (-358.246) (-359.573) * (-356.611) [-358.195] (-356.458) (-357.325) -- 0:00:52

      Average standard deviation of split frequencies: 0.020075

      160500 -- (-357.573) (-359.436) [-356.674] (-359.354) * (-357.173) (-358.153) [-356.710] (-359.281) -- 0:00:52
      161000 -- (-356.693) (-356.683) [-358.113] (-361.537) * (-363.705) [-356.560] (-365.088) (-357.107) -- 0:00:52
      161500 -- (-358.452) (-356.057) [-360.750] (-360.287) * [-358.292] (-359.224) (-355.894) (-357.621) -- 0:00:51
      162000 -- (-358.185) (-357.294) [-358.212] (-357.666) * (-358.006) [-356.411] (-356.339) (-357.055) -- 0:00:51
      162500 -- [-355.944] (-356.164) (-359.486) (-357.901) * (-356.781) [-359.882] (-357.855) (-358.897) -- 0:00:51
      163000 -- (-357.203) (-359.030) (-358.993) [-357.833] * (-361.156) (-362.639) (-357.157) [-359.235] -- 0:00:51
      163500 -- (-359.710) [-356.855] (-360.154) (-355.994) * (-359.641) (-359.233) [-356.383] (-361.049) -- 0:00:51
      164000 -- (-358.049) (-357.416) (-358.552) [-357.412] * (-359.310) (-359.213) [-357.873] (-356.187) -- 0:00:50
      164500 -- [-357.711] (-356.902) (-357.652) (-357.988) * (-358.083) (-360.493) (-358.733) [-356.334] -- 0:00:50
      165000 -- (-364.129) (-356.895) (-359.141) [-356.327] * [-356.590] (-356.089) (-358.865) (-359.289) -- 0:00:50

      Average standard deviation of split frequencies: 0.019737

      165500 -- (-357.053) (-358.367) [-358.406] (-359.766) * [-359.697] (-357.900) (-361.140) (-360.237) -- 0:00:50
      166000 -- (-358.960) (-358.507) (-357.407) [-359.320] * (-359.395) (-360.683) [-359.354] (-358.726) -- 0:00:50
      166500 -- (-356.964) (-360.976) (-358.226) [-358.488] * [-361.188] (-358.405) (-358.277) (-361.636) -- 0:00:50
      167000 -- (-359.325) (-356.377) [-361.256] (-358.328) * [-358.643] (-358.672) (-358.975) (-358.934) -- 0:00:49
      167500 -- (-357.088) [-357.433] (-361.713) (-356.520) * (-357.448) (-358.098) [-359.829] (-360.879) -- 0:00:49
      168000 -- (-364.108) (-356.802) [-357.116] (-358.794) * [-360.428] (-363.817) (-360.930) (-358.257) -- 0:00:49
      168500 -- (-361.144) (-360.318) [-356.364] (-357.645) * (-357.799) (-357.073) [-357.119] (-356.631) -- 0:00:49
      169000 -- (-358.637) (-359.275) (-357.973) [-357.876] * (-361.609) [-358.945] (-360.403) (-361.035) -- 0:00:49
      169500 -- (-356.836) (-357.726) [-358.738] (-358.781) * (-362.204) (-356.090) (-357.779) [-359.525] -- 0:00:48
      170000 -- (-361.554) [-357.540] (-360.458) (-356.627) * (-356.504) (-357.683) (-361.767) [-358.377] -- 0:00:48

      Average standard deviation of split frequencies: 0.018092

      170500 -- (-359.064) (-357.384) (-358.422) [-360.860] * (-358.560) (-362.214) [-360.700] (-357.226) -- 0:00:48
      171000 -- (-357.340) [-356.596] (-357.119) (-365.540) * (-358.247) (-356.667) (-358.134) [-357.974] -- 0:00:48
      171500 -- (-359.825) (-356.693) [-358.033] (-359.907) * (-356.121) (-360.024) [-358.697] (-358.135) -- 0:00:48
      172000 -- (-356.378) (-361.396) [-358.502] (-360.369) * [-359.979] (-357.489) (-357.328) (-359.632) -- 0:00:48
      172500 -- [-357.047] (-358.569) (-359.271) (-360.139) * [-357.456] (-359.047) (-357.093) (-361.266) -- 0:00:52
      173000 -- [-356.622] (-358.815) (-359.374) (-359.766) * (-358.783) (-359.497) (-357.472) [-357.843] -- 0:00:52
      173500 -- (-360.837) (-359.640) [-357.652] (-359.449) * [-358.257] (-358.673) (-360.033) (-357.009) -- 0:00:52
      174000 -- (-358.822) (-356.995) (-356.819) [-359.595] * (-359.888) (-358.244) [-357.002] (-357.150) -- 0:00:52
      174500 -- (-360.022) [-357.038] (-357.626) (-362.945) * (-359.936) [-360.820] (-358.162) (-359.423) -- 0:00:52
      175000 -- (-357.239) [-358.237] (-358.455) (-362.072) * (-359.100) [-358.405] (-358.978) (-362.879) -- 0:00:51

      Average standard deviation of split frequencies: 0.017276

      175500 -- (-360.530) [-360.258] (-360.081) (-358.728) * (-358.734) (-359.533) [-358.687] (-364.362) -- 0:00:51
      176000 -- (-361.068) (-357.179) (-361.298) [-357.479] * (-358.330) (-356.795) (-361.574) [-358.459] -- 0:00:51
      176500 -- (-358.354) [-358.586] (-360.632) (-358.494) * (-361.547) [-358.417] (-360.748) (-356.826) -- 0:00:51
      177000 -- [-359.210] (-364.075) (-357.761) (-358.781) * (-358.859) (-357.800) (-358.940) [-356.887] -- 0:00:51
      177500 -- [-358.464] (-359.847) (-359.243) (-358.116) * (-358.889) (-356.345) [-359.500] (-359.366) -- 0:00:50
      178000 -- [-360.332] (-359.337) (-367.300) (-359.447) * [-356.953] (-357.289) (-359.597) (-360.274) -- 0:00:50
      178500 -- (-358.351) (-358.545) (-369.917) [-358.340] * (-359.375) (-358.184) [-358.178] (-358.248) -- 0:00:50
      179000 -- (-357.920) (-358.286) (-358.471) [-358.897] * [-358.402] (-356.697) (-357.568) (-357.829) -- 0:00:50
      179500 -- [-358.092] (-359.641) (-359.719) (-362.702) * (-360.016) (-357.765) [-356.886] (-359.279) -- 0:00:50
      180000 -- (-357.046) [-359.241] (-357.017) (-362.158) * (-358.551) (-358.618) (-358.726) [-356.295] -- 0:00:50

      Average standard deviation of split frequencies: 0.017091

      180500 -- (-358.899) (-361.498) (-358.446) [-359.674] * (-360.315) [-357.807] (-357.039) (-357.249) -- 0:00:49
      181000 -- (-359.487) [-357.939] (-356.123) (-358.299) * [-361.568] (-357.644) (-358.019) (-357.031) -- 0:00:49
      181500 -- [-356.291] (-356.385) (-358.504) (-357.463) * (-358.539) [-358.282] (-363.998) (-357.170) -- 0:00:49
      182000 -- (-358.876) (-358.028) [-357.579] (-357.791) * (-358.102) (-358.248) (-359.586) [-362.130] -- 0:00:49
      182500 -- [-360.297] (-357.718) (-359.178) (-357.035) * (-356.581) (-356.749) (-361.817) [-359.903] -- 0:00:49
      183000 -- (-360.375) (-357.671) (-358.717) [-356.862] * [-357.940] (-357.467) (-360.725) (-357.022) -- 0:00:49
      183500 -- (-357.735) (-358.419) (-360.653) [-357.007] * (-362.799) [-356.646] (-358.761) (-360.669) -- 0:00:48
      184000 -- (-357.187) [-357.681] (-358.803) (-357.489) * (-361.289) [-358.131] (-359.011) (-358.250) -- 0:00:48
      184500 -- (-357.860) (-359.865) [-357.286] (-359.786) * (-357.442) [-360.521] (-362.103) (-356.850) -- 0:00:48
      185000 -- (-359.593) [-357.413] (-358.528) (-359.019) * [-357.114] (-361.911) (-357.355) (-364.802) -- 0:00:48

      Average standard deviation of split frequencies: 0.017341

      185500 -- [-357.542] (-360.666) (-360.431) (-358.537) * (-358.325) (-358.469) [-359.185] (-358.983) -- 0:00:48
      186000 -- (-364.702) [-356.883] (-356.549) (-358.742) * [-359.339] (-359.021) (-359.844) (-359.992) -- 0:00:48
      186500 -- (-358.782) (-358.984) (-358.703) [-358.468] * (-362.196) (-359.713) [-357.417] (-359.107) -- 0:00:47
      187000 -- (-365.534) (-358.786) [-358.239] (-357.484) * (-357.153) (-356.860) [-358.173] (-359.634) -- 0:00:47
      187500 -- (-358.179) (-357.699) (-357.886) [-356.784] * (-358.764) (-358.017) (-357.823) [-357.655] -- 0:00:47
      188000 -- [-356.747] (-360.199) (-357.563) (-357.507) * [-357.505] (-358.203) (-359.737) (-356.127) -- 0:00:47
      188500 -- (-357.707) [-358.510] (-360.293) (-357.420) * [-357.714] (-360.117) (-359.961) (-359.760) -- 0:00:47
      189000 -- (-356.171) (-359.017) [-361.382] (-360.786) * (-356.639) (-357.871) [-356.392] (-360.192) -- 0:00:51
      189500 -- (-359.222) [-363.047] (-360.318) (-357.413) * (-358.717) (-358.155) [-356.995] (-359.603) -- 0:00:51
      190000 -- [-358.882] (-358.204) (-358.077) (-357.878) * [-359.949] (-359.132) (-356.105) (-359.479) -- 0:00:51

      Average standard deviation of split frequencies: 0.017697

      190500 -- (-358.607) (-356.302) (-359.441) [-359.605] * [-356.797] (-357.528) (-357.692) (-356.770) -- 0:00:50
      191000 -- (-360.751) (-360.160) (-358.481) [-357.922] * (-357.219) (-357.917) (-357.804) [-357.008] -- 0:00:50
      191500 -- (-362.658) (-360.025) (-359.046) [-357.794] * (-356.725) (-361.965) [-357.097] (-356.513) -- 0:00:50
      192000 -- (-358.476) (-360.274) (-357.169) [-361.519] * (-358.549) (-359.255) (-358.175) [-356.517] -- 0:00:50
      192500 -- [-360.014] (-358.962) (-358.245) (-358.238) * (-356.549) [-357.842] (-359.996) (-357.038) -- 0:00:50
      193000 -- (-360.753) (-358.141) [-356.737] (-359.124) * (-359.652) [-359.882] (-357.654) (-359.156) -- 0:00:50
      193500 -- [-356.862] (-356.533) (-357.208) (-358.331) * [-358.159] (-357.003) (-362.528) (-359.514) -- 0:00:50
      194000 -- (-357.246) (-361.010) [-357.482] (-359.832) * (-356.532) [-358.115] (-356.177) (-358.959) -- 0:00:49
      194500 -- (-358.869) [-358.607] (-357.588) (-357.636) * [-358.326] (-361.041) (-356.832) (-356.914) -- 0:00:49
      195000 -- (-359.369) (-357.083) [-358.945] (-357.739) * (-360.784) [-357.365] (-357.249) (-360.594) -- 0:00:49

      Average standard deviation of split frequencies: 0.017089

      195500 -- (-358.681) (-356.695) [-358.488] (-357.891) * [-358.614] (-357.779) (-358.715) (-356.461) -- 0:00:49
      196000 -- (-360.032) (-357.079) (-356.843) [-358.109] * (-357.982) (-358.708) (-357.656) [-358.392] -- 0:00:49
      196500 -- (-356.429) (-356.679) (-363.826) [-360.730] * (-357.951) (-361.048) (-357.803) [-357.484] -- 0:00:49
      197000 -- (-358.772) [-356.262] (-362.970) (-359.343) * [-358.639] (-357.016) (-357.307) (-358.284) -- 0:00:48
      197500 -- (-356.735) (-360.185) [-356.807] (-356.992) * (-358.978) (-361.623) [-357.220] (-358.332) -- 0:00:48
      198000 -- [-357.942] (-357.280) (-356.545) (-357.142) * (-357.515) (-359.295) [-357.402] (-356.798) -- 0:00:48
      198500 -- (-360.467) (-357.476) [-357.411] (-359.773) * [-360.311] (-359.450) (-360.402) (-357.040) -- 0:00:48
      199000 -- (-359.432) (-360.005) [-356.998] (-358.090) * (-358.303) [-358.048] (-359.744) (-357.786) -- 0:00:48
      199500 -- [-358.129] (-358.002) (-362.846) (-360.929) * (-358.975) (-361.197) (-360.375) [-359.567] -- 0:00:48
      200000 -- (-361.465) [-359.176] (-363.007) (-362.152) * (-358.086) [-357.956] (-358.217) (-360.049) -- 0:00:48

      Average standard deviation of split frequencies: 0.015009

      200500 -- [-360.951] (-358.775) (-357.801) (-358.520) * (-356.840) (-363.026) (-360.817) [-357.231] -- 0:00:47
      201000 -- (-359.331) (-357.412) [-358.512] (-358.510) * [-362.200] (-359.175) (-357.078) (-362.431) -- 0:00:47
      201500 -- (-357.281) [-356.983] (-357.479) (-356.863) * (-358.450) (-357.644) (-358.903) [-357.525] -- 0:00:47
      202000 -- [-361.160] (-357.993) (-357.859) (-359.005) * (-357.086) (-357.847) (-361.294) [-361.562] -- 0:00:47
      202500 -- (-358.050) (-357.844) (-358.108) [-358.699] * [-357.219] (-362.405) (-359.715) (-357.453) -- 0:00:47
      203000 -- [-359.665] (-357.066) (-363.112) (-356.924) * (-357.749) (-357.131) (-356.900) [-358.777] -- 0:00:47
      203500 -- (-357.713) (-357.470) (-358.154) [-359.741] * (-358.915) (-359.980) (-359.215) [-357.851] -- 0:00:46
      204000 -- (-358.854) [-359.481] (-358.671) (-357.708) * (-358.977) (-357.171) (-358.352) [-358.897] -- 0:00:50
      204500 -- (-359.866) (-359.610) [-357.509] (-357.669) * (-356.796) (-360.262) (-356.119) [-359.486] -- 0:00:50
      205000 -- [-357.229] (-358.440) (-362.096) (-356.450) * (-356.329) (-359.056) (-359.878) [-359.128] -- 0:00:50

      Average standard deviation of split frequencies: 0.015296

      205500 -- [-356.922] (-358.022) (-361.043) (-357.814) * (-357.362) (-358.114) (-359.034) [-360.622] -- 0:00:50
      206000 -- (-357.448) [-360.138] (-360.162) (-358.118) * [-359.584] (-357.161) (-360.239) (-356.996) -- 0:00:50
      206500 -- (-360.268) (-360.627) (-357.072) [-358.322] * [-358.382] (-359.908) (-359.261) (-359.042) -- 0:00:49
      207000 -- (-359.375) (-359.614) (-356.743) [-357.043] * (-358.818) (-361.823) [-356.545] (-358.058) -- 0:00:49
      207500 -- (-358.105) [-358.174] (-357.074) (-356.828) * [-357.345] (-358.701) (-358.721) (-360.184) -- 0:00:49
      208000 -- (-357.500) (-361.772) [-356.514] (-361.237) * (-358.678) (-356.842) [-359.202] (-358.237) -- 0:00:49
      208500 -- (-357.641) (-361.204) [-358.765] (-357.845) * (-359.114) [-359.045] (-358.814) (-357.167) -- 0:00:49
      209000 -- (-357.128) [-361.315] (-358.381) (-359.491) * (-359.240) (-369.729) (-357.437) [-357.434] -- 0:00:49
      209500 -- (-356.891) (-356.461) [-360.389] (-362.286) * [-362.192] (-358.128) (-357.004) (-362.229) -- 0:00:49
      210000 -- (-356.736) (-357.848) [-362.051] (-359.016) * (-357.521) (-359.110) (-356.224) [-358.618] -- 0:00:48

      Average standard deviation of split frequencies: 0.015415

      210500 -- (-359.049) (-361.720) (-361.587) [-359.287] * (-360.356) (-358.610) [-358.111] (-360.862) -- 0:00:48
      211000 -- (-359.295) (-358.764) (-356.967) [-359.289] * (-362.337) (-356.931) [-357.488] (-364.003) -- 0:00:48
      211500 -- (-360.872) [-357.382] (-359.567) (-361.610) * (-359.991) (-357.260) [-358.024] (-357.098) -- 0:00:48
      212000 -- (-357.018) (-357.505) [-357.343] (-359.206) * (-358.659) (-357.831) (-360.354) [-357.983] -- 0:00:48
      212500 -- (-357.734) [-357.134] (-357.713) (-358.323) * (-358.332) (-361.306) [-358.604] (-357.132) -- 0:00:48
      213000 -- (-361.609) (-361.855) [-360.790] (-360.482) * [-357.960] (-360.254) (-363.161) (-358.121) -- 0:00:48
      213500 -- (-356.908) (-359.129) [-357.634] (-359.205) * (-360.348) [-358.236] (-358.994) (-357.093) -- 0:00:47
      214000 -- (-359.509) [-356.771] (-357.716) (-356.480) * (-359.730) (-357.837) (-360.767) [-357.803] -- 0:00:47
      214500 -- (-359.660) [-357.668] (-357.195) (-360.788) * (-357.858) (-358.647) (-357.164) [-361.991] -- 0:00:47
      215000 -- [-361.984] (-357.584) (-357.776) (-359.971) * (-357.779) (-356.597) (-359.249) [-358.049] -- 0:00:47

      Average standard deviation of split frequencies: 0.016176

      215500 -- [-358.481] (-357.001) (-362.480) (-358.377) * (-360.931) (-358.103) [-357.161] (-359.509) -- 0:00:47
      216000 -- (-360.007) [-358.093] (-356.995) (-360.523) * (-356.799) (-358.829) (-358.359) [-359.343] -- 0:00:47
      216500 -- (-359.389) (-356.670) [-356.511] (-356.309) * [-360.515] (-357.114) (-359.144) (-358.455) -- 0:00:47
      217000 -- (-359.033) (-359.520) (-359.399) [-356.268] * (-360.900) (-356.261) (-356.716) [-358.994] -- 0:00:46
      217500 -- [-356.723] (-359.592) (-359.020) (-362.632) * [-360.335] (-357.397) (-356.810) (-360.148) -- 0:00:46
      218000 -- (-359.225) (-360.966) (-356.133) [-359.563] * (-356.925) (-358.373) [-357.493] (-357.287) -- 0:00:46
      218500 -- [-356.521] (-357.652) (-358.397) (-362.010) * (-360.791) [-358.807] (-357.426) (-359.126) -- 0:00:46
      219000 -- (-358.382) (-358.175) (-363.979) [-357.457] * (-360.487) (-361.198) [-357.262] (-358.383) -- 0:00:46
      219500 -- [-357.431] (-360.010) (-358.169) (-358.550) * (-359.997) [-358.394] (-356.211) (-356.306) -- 0:00:46
      220000 -- [-356.565] (-359.126) (-357.703) (-359.132) * (-358.081) (-356.669) [-357.458] (-357.523) -- 0:00:46

      Average standard deviation of split frequencies: 0.014828

      220500 -- (-357.615) (-359.847) (-356.740) [-357.606] * (-359.106) [-356.396] (-358.157) (-357.750) -- 0:00:45
      221000 -- (-356.630) [-358.898] (-356.717) (-356.919) * (-358.022) (-357.616) (-359.338) [-357.430] -- 0:00:45
      221500 -- [-356.785] (-356.323) (-357.223) (-357.806) * (-360.844) (-358.774) [-360.778] (-357.421) -- 0:00:49
      222000 -- [-356.844] (-356.304) (-358.341) (-358.241) * (-359.035) [-358.121] (-358.759) (-359.826) -- 0:00:49
      222500 -- (-357.766) (-357.844) [-357.580] (-358.907) * (-358.390) (-358.645) (-359.080) [-360.020] -- 0:00:48
      223000 -- (-358.056) (-358.527) [-356.642] (-357.564) * (-358.095) (-360.555) (-360.070) [-359.549] -- 0:00:48
      223500 -- (-357.445) (-359.512) [-356.176] (-357.629) * (-356.662) (-357.006) (-357.704) [-357.751] -- 0:00:48
      224000 -- (-356.620) (-359.196) (-360.811) [-360.024] * (-357.223) [-360.541] (-356.628) (-360.815) -- 0:00:48
      224500 -- (-357.702) (-358.678) (-364.524) [-357.649] * (-357.123) (-358.125) [-357.351] (-360.389) -- 0:00:48
      225000 -- (-366.151) (-361.063) (-356.679) [-357.248] * (-356.906) (-357.617) (-358.991) [-357.708] -- 0:00:48

      Average standard deviation of split frequencies: 0.013988

      225500 -- (-360.563) [-361.089] (-364.191) (-357.226) * (-358.389) (-358.996) (-356.982) [-358.922] -- 0:00:48
      226000 -- (-358.414) (-358.586) (-367.696) [-357.328] * (-357.840) (-356.289) [-359.562] (-362.630) -- 0:00:47
      226500 -- (-361.507) (-359.300) (-364.993) [-357.171] * (-359.757) (-359.421) [-357.870] (-359.897) -- 0:00:47
      227000 -- (-359.137) (-360.825) (-359.683) [-359.026] * (-358.057) [-360.882] (-358.211) (-359.368) -- 0:00:47
      227500 -- (-356.870) (-357.728) (-358.308) [-358.462] * [-358.829] (-360.971) (-357.096) (-357.101) -- 0:00:47
      228000 -- (-358.407) (-359.528) (-362.597) [-358.452] * [-356.919] (-362.161) (-361.703) (-358.947) -- 0:00:47
      228500 -- (-358.678) (-357.121) (-362.639) [-357.716] * [-357.014] (-356.730) (-360.225) (-356.746) -- 0:00:47
      229000 -- (-358.529) [-357.667] (-362.338) (-357.488) * (-357.994) (-358.627) [-357.463] (-358.478) -- 0:00:47
      229500 -- (-358.747) (-357.649) [-362.660] (-357.930) * (-360.677) (-358.313) (-356.099) [-359.044] -- 0:00:47
      230000 -- [-358.015] (-360.148) (-356.967) (-361.734) * [-356.885] (-359.217) (-357.268) (-358.693) -- 0:00:46

      Average standard deviation of split frequencies: 0.016349

      230500 -- (-359.502) [-362.377] (-358.799) (-364.897) * [-356.875] (-357.049) (-359.459) (-357.961) -- 0:00:46
      231000 -- (-356.675) (-362.053) (-358.655) [-360.316] * [-357.796] (-360.724) (-357.202) (-358.294) -- 0:00:46
      231500 -- (-356.802) (-358.203) (-358.133) [-357.942] * (-357.189) (-362.224) [-356.691] (-358.586) -- 0:00:46
      232000 -- (-358.192) (-356.990) [-356.932] (-358.437) * (-356.604) (-360.150) [-358.629] (-360.043) -- 0:00:46
      232500 -- [-358.827] (-359.650) (-357.603) (-356.923) * [-360.132] (-360.153) (-358.995) (-358.414) -- 0:00:46
      233000 -- (-357.904) (-363.203) [-356.989] (-361.440) * (-357.933) [-359.732] (-359.223) (-361.171) -- 0:00:46
      233500 -- (-358.676) (-358.638) [-357.103] (-358.087) * (-357.356) [-357.669] (-358.126) (-356.748) -- 0:00:45
      234000 -- [-356.489] (-358.375) (-358.572) (-361.959) * (-357.201) (-356.359) (-361.156) [-358.939] -- 0:00:45
      234500 -- [-357.633] (-360.137) (-362.185) (-358.293) * (-359.598) (-357.479) [-362.212] (-360.608) -- 0:00:45
      235000 -- (-358.624) (-356.808) (-364.708) [-358.395] * (-357.390) (-358.364) (-358.139) [-356.855] -- 0:00:45

      Average standard deviation of split frequencies: 0.017200

      235500 -- (-356.947) [-356.407] (-364.336) (-357.921) * [-357.314] (-358.806) (-357.382) (-358.073) -- 0:00:45
      236000 -- (-357.527) [-356.497] (-358.135) (-357.771) * (-356.683) (-361.031) (-356.868) [-359.556] -- 0:00:45
      236500 -- (-359.318) (-360.912) (-359.107) [-357.041] * [-356.825] (-358.285) (-361.749) (-356.689) -- 0:00:45
      237000 -- (-358.880) [-357.048] (-359.630) (-358.417) * [-359.029] (-359.908) (-357.217) (-356.865) -- 0:00:45
      237500 -- (-358.625) (-357.337) (-358.186) [-356.481] * (-358.151) (-356.895) [-357.277] (-357.974) -- 0:00:44
      238000 -- [-359.361] (-363.613) (-357.429) (-357.688) * (-358.627) (-356.634) (-357.415) [-356.519] -- 0:00:44
      238500 -- (-359.613) [-356.887] (-356.452) (-357.885) * [-358.984] (-358.216) (-357.005) (-357.653) -- 0:00:47
      239000 -- (-357.867) (-357.367) (-357.402) [-356.250] * (-357.823) (-361.401) [-357.400] (-359.671) -- 0:00:47
      239500 -- (-357.736) [-356.235] (-356.737) (-358.963) * (-356.708) (-358.951) [-356.779] (-359.417) -- 0:00:47
      240000 -- [-357.810] (-356.915) (-357.007) (-357.784) * (-361.349) (-356.832) [-359.349] (-360.313) -- 0:00:47

      Average standard deviation of split frequencies: 0.018390

      240500 -- (-357.497) [-357.253] (-357.973) (-358.332) * (-359.683) (-356.869) [-358.745] (-358.305) -- 0:00:47
      241000 -- [-357.181] (-358.495) (-359.668) (-358.256) * [-356.954] (-357.234) (-359.325) (-356.820) -- 0:00:47
      241500 -- (-357.648) (-358.808) (-360.488) [-356.073] * (-356.303) (-358.795) (-358.983) [-357.746] -- 0:00:47
      242000 -- [-359.714] (-357.184) (-357.695) (-358.153) * (-359.146) [-357.497] (-358.161) (-359.891) -- 0:00:46
      242500 -- (-357.436) [-360.665] (-357.315) (-358.074) * (-356.149) (-360.934) [-357.477] (-362.344) -- 0:00:46
      243000 -- (-360.866) (-358.238) [-356.582] (-357.437) * [-362.148] (-361.863) (-362.286) (-359.706) -- 0:00:46
      243500 -- (-356.384) (-359.084) (-358.198) [-357.383] * [-356.927] (-359.727) (-358.553) (-357.507) -- 0:00:46
      244000 -- [-356.945] (-361.378) (-357.235) (-359.455) * (-356.662) [-358.118] (-359.883) (-357.629) -- 0:00:46
      244500 -- (-358.259) [-359.579] (-357.153) (-357.585) * (-362.678) (-358.464) [-359.076] (-358.191) -- 0:00:46
      245000 -- (-358.562) (-357.378) (-357.306) [-357.128] * (-356.272) [-356.772] (-358.170) (-359.047) -- 0:00:46

      Average standard deviation of split frequencies: 0.018950

      245500 -- (-360.468) (-356.155) [-356.343] (-360.178) * (-356.788) [-359.901] (-358.771) (-356.937) -- 0:00:46
      246000 -- (-358.945) (-357.961) [-357.617] (-357.952) * [-357.850] (-359.720) (-356.725) (-360.407) -- 0:00:45
      246500 -- (-357.305) [-356.975] (-359.055) (-360.503) * (-357.657) (-360.880) [-357.627] (-357.113) -- 0:00:45
      247000 -- (-357.585) (-361.481) (-358.721) [-358.083] * (-358.945) (-357.421) (-357.854) [-356.704] -- 0:00:45
      247500 -- (-357.130) (-360.969) (-359.378) [-366.271] * (-359.149) [-358.259] (-358.973) (-356.964) -- 0:00:45
      248000 -- (-362.310) [-357.908] (-360.334) (-360.192) * (-356.426) (-359.436) [-359.956] (-356.893) -- 0:00:45
      248500 -- (-356.451) [-359.184] (-359.526) (-358.649) * (-360.813) (-357.213) (-358.138) [-359.155] -- 0:00:45
      249000 -- [-356.583] (-358.916) (-362.116) (-356.323) * (-360.282) (-360.286) [-359.617] (-359.617) -- 0:00:45
      249500 -- (-357.243) [-357.237] (-361.134) (-357.184) * (-360.143) [-359.561] (-359.527) (-359.747) -- 0:00:45
      250000 -- [-361.051] (-356.766) (-365.018) (-356.326) * (-359.035) (-356.255) [-357.696] (-357.492) -- 0:00:45

      Average standard deviation of split frequencies: 0.018806

      250500 -- (-359.339) [-356.498] (-362.276) (-356.841) * (-359.506) (-358.275) [-358.078] (-358.329) -- 0:00:44
      251000 -- [-357.296] (-358.344) (-357.182) (-358.999) * (-358.919) (-358.137) [-358.569] (-360.967) -- 0:00:44
      251500 -- (-363.195) (-357.954) [-357.622] (-357.501) * (-362.245) (-356.630) (-359.573) [-360.978] -- 0:00:44
      252000 -- (-361.578) (-357.927) [-360.250] (-362.444) * (-359.380) (-357.215) (-359.892) [-356.729] -- 0:00:44
      252500 -- [-358.633] (-356.925) (-361.819) (-358.495) * (-360.738) (-359.123) [-357.714] (-358.783) -- 0:00:44
      253000 -- (-359.913) (-357.298) (-359.600) [-357.070] * [-358.573] (-357.766) (-361.748) (-360.104) -- 0:00:44
      253500 -- (-359.261) (-358.871) (-360.180) [-357.583] * [-358.347] (-358.446) (-360.098) (-356.715) -- 0:00:44
      254000 -- [-357.119] (-359.867) (-357.866) (-357.987) * (-357.986) [-357.448] (-356.500) (-356.587) -- 0:00:44
      254500 -- (-356.348) (-360.441) (-357.276) [-357.689] * (-357.218) (-358.391) [-359.839] (-358.757) -- 0:00:43
      255000 -- (-356.551) [-357.629] (-357.553) (-358.794) * [-358.304] (-356.460) (-359.342) (-358.234) -- 0:00:43

      Average standard deviation of split frequencies: 0.018210

      255500 -- (-357.461) [-357.805] (-362.128) (-359.423) * (-358.731) [-356.781] (-363.928) (-356.750) -- 0:00:46
      256000 -- (-356.286) (-359.785) [-357.026] (-359.015) * (-357.731) [-356.988] (-357.450) (-357.010) -- 0:00:46
      256500 -- (-358.942) [-358.390] (-356.768) (-360.091) * [-357.226] (-358.719) (-358.013) (-356.490) -- 0:00:46
      257000 -- (-356.325) [-358.938] (-358.713) (-360.453) * [-357.264] (-358.510) (-356.784) (-359.610) -- 0:00:46
      257500 -- [-358.659] (-359.663) (-358.656) (-359.225) * (-359.673) [-360.937] (-357.771) (-357.498) -- 0:00:46
      258000 -- (-358.674) (-361.124) (-357.411) [-357.014] * (-358.984) [-359.959] (-358.759) (-359.067) -- 0:00:46
      258500 -- [-357.406] (-357.245) (-362.108) (-364.872) * [-356.299] (-358.009) (-356.825) (-356.794) -- 0:00:45
      259000 -- (-356.611) (-359.749) (-356.937) [-357.524] * [-356.381] (-358.680) (-361.137) (-361.784) -- 0:00:45
      259500 -- (-357.878) (-360.641) [-357.874] (-360.828) * (-356.435) [-356.476] (-361.944) (-359.557) -- 0:00:45
      260000 -- [-358.800] (-360.226) (-360.072) (-363.316) * (-356.668) (-359.534) (-361.405) [-358.939] -- 0:00:45

      Average standard deviation of split frequencies: 0.016778

      260500 -- (-364.622) [-358.330] (-364.483) (-356.633) * (-356.785) (-357.369) [-356.676] (-362.514) -- 0:00:45
      261000 -- (-359.498) (-358.201) [-360.531] (-357.701) * [-357.630] (-362.563) (-359.816) (-358.577) -- 0:00:45
      261500 -- (-358.105) (-359.985) [-356.912] (-359.184) * (-357.463) [-357.395] (-358.650) (-362.084) -- 0:00:45
      262000 -- [-359.129] (-359.713) (-365.677) (-356.696) * [-359.313] (-357.346) (-357.152) (-361.477) -- 0:00:45
      262500 -- [-356.500] (-360.638) (-365.270) (-360.857) * (-357.523) [-356.766] (-356.808) (-358.555) -- 0:00:44
      263000 -- (-359.309) [-356.971] (-356.801) (-357.573) * (-358.295) (-357.904) (-357.790) [-358.946] -- 0:00:44
      263500 -- (-361.306) (-357.685) (-357.634) [-359.820] * (-356.066) (-357.947) (-358.784) [-358.248] -- 0:00:44
      264000 -- (-357.454) (-357.071) (-359.161) [-356.455] * (-357.697) [-360.612] (-361.181) (-357.899) -- 0:00:44
      264500 -- (-361.308) [-357.622] (-359.141) (-358.066) * [-358.054] (-360.480) (-357.432) (-361.312) -- 0:00:44
      265000 -- (-358.294) [-358.479] (-357.144) (-357.595) * (-363.703) [-357.378] (-359.782) (-357.198) -- 0:00:44

      Average standard deviation of split frequencies: 0.017230

      265500 -- (-357.385) (-361.445) [-356.686] (-358.399) * (-364.911) (-358.828) (-358.547) [-357.097] -- 0:00:44
      266000 -- (-358.814) [-357.173] (-357.173) (-358.826) * (-357.533) (-364.200) (-361.114) [-356.977] -- 0:00:44
      266500 -- (-357.540) (-358.638) (-356.924) [-359.020] * [-358.512] (-361.427) (-356.600) (-356.911) -- 0:00:44
      267000 -- (-356.776) [-363.504] (-358.327) (-361.222) * (-359.066) [-360.715] (-359.635) (-357.000) -- 0:00:43
      267500 -- [-360.411] (-358.037) (-360.012) (-359.026) * (-357.377) (-357.374) (-359.000) [-361.377] -- 0:00:43
      268000 -- (-362.551) (-363.803) [-357.021] (-356.902) * [-356.206] (-358.922) (-359.257) (-363.172) -- 0:00:43
      268500 -- (-359.391) (-360.486) [-361.685] (-357.116) * [-357.565] (-359.366) (-363.126) (-357.836) -- 0:00:43
      269000 -- [-356.917] (-360.085) (-357.802) (-357.450) * (-357.957) [-357.281] (-365.658) (-359.723) -- 0:00:43
      269500 -- (-356.508) (-359.243) (-360.737) [-357.305] * (-356.843) (-359.124) (-358.376) [-357.885] -- 0:00:43
      270000 -- [-358.247] (-357.463) (-357.052) (-357.253) * (-356.628) [-357.237] (-359.387) (-358.371) -- 0:00:43

      Average standard deviation of split frequencies: 0.017724

      270500 -- (-356.300) [-356.271] (-358.113) (-356.771) * [-356.624] (-357.495) (-356.762) (-358.121) -- 0:00:43
      271000 -- [-360.272] (-356.716) (-356.752) (-358.698) * [-356.373] (-357.910) (-357.033) (-356.598) -- 0:00:43
      271500 -- (-357.404) [-359.584] (-356.897) (-359.959) * [-356.844] (-357.396) (-356.957) (-358.768) -- 0:00:42
      272000 -- [-357.424] (-357.853) (-355.945) (-357.385) * [-358.836] (-356.322) (-358.566) (-361.051) -- 0:00:45
      272500 -- (-357.880) [-358.400] (-357.018) (-357.343) * (-360.373) (-358.659) [-361.262] (-362.364) -- 0:00:45
      273000 -- (-358.036) (-356.979) (-357.294) [-358.096] * (-359.408) (-366.351) [-357.222] (-358.759) -- 0:00:45
      273500 -- (-359.206) (-356.787) (-363.568) [-358.234] * (-357.145) (-358.989) (-358.784) [-358.417] -- 0:00:45
      274000 -- (-357.080) [-359.315] (-364.223) (-356.504) * [-356.805] (-359.102) (-361.634) (-357.936) -- 0:00:45
      274500 -- [-358.745] (-361.607) (-361.411) (-362.782) * [-357.880] (-359.476) (-360.109) (-359.264) -- 0:00:44
      275000 -- [-358.803] (-363.021) (-359.012) (-356.722) * [-357.676] (-358.140) (-359.122) (-359.918) -- 0:00:44

      Average standard deviation of split frequencies: 0.018386

      275500 -- [-360.950] (-358.026) (-357.614) (-357.909) * [-356.991] (-357.462) (-357.614) (-358.215) -- 0:00:44
      276000 -- (-356.747) (-357.287) [-359.330] (-357.184) * (-358.911) (-359.088) (-358.329) [-356.398] -- 0:00:44
      276500 -- [-356.223] (-357.504) (-357.859) (-357.668) * (-359.031) (-360.190) [-359.416] (-356.704) -- 0:00:44
      277000 -- (-358.549) (-360.073) [-357.143] (-359.878) * (-361.668) (-361.490) [-360.133] (-359.912) -- 0:00:44
      277500 -- (-359.105) [-358.628] (-358.808) (-357.377) * [-357.403] (-357.562) (-358.203) (-362.060) -- 0:00:44
      278000 -- (-357.972) [-356.984] (-358.158) (-358.948) * (-360.935) (-365.053) (-360.818) [-356.806] -- 0:00:44
      278500 -- (-357.078) [-360.286] (-358.190) (-357.901) * [-358.311] (-360.002) (-371.420) (-361.053) -- 0:00:44
      279000 -- (-356.651) (-359.990) [-359.229] (-357.895) * (-360.202) (-357.654) (-359.710) [-358.333] -- 0:00:43
      279500 -- (-357.633) (-363.464) [-360.402] (-357.240) * (-357.482) (-358.948) [-359.733] (-360.664) -- 0:00:43
      280000 -- (-358.162) (-357.227) [-359.258] (-356.799) * (-357.987) (-357.049) [-358.108] (-359.409) -- 0:00:43

      Average standard deviation of split frequencies: 0.017846

      280500 -- [-359.253] (-357.563) (-359.396) (-359.368) * [-359.853] (-358.594) (-358.288) (-357.754) -- 0:00:43
      281000 -- [-358.763] (-360.786) (-362.498) (-360.446) * (-359.586) (-360.905) (-361.433) [-357.802] -- 0:00:43
      281500 -- (-359.671) (-359.895) [-358.513] (-361.055) * (-358.002) (-357.260) (-359.232) [-357.581] -- 0:00:43
      282000 -- [-363.604] (-362.202) (-358.703) (-365.530) * (-358.749) (-359.893) (-357.320) [-356.331] -- 0:00:43
      282500 -- (-358.907) [-360.370] (-361.410) (-361.307) * [-358.333] (-361.014) (-358.252) (-359.683) -- 0:00:43
      283000 -- [-356.361] (-358.636) (-357.102) (-356.492) * (-357.478) (-360.442) [-356.292] (-357.872) -- 0:00:43
      283500 -- [-359.872] (-361.859) (-358.460) (-360.399) * (-358.986) (-360.641) (-357.013) [-357.544] -- 0:00:42
      284000 -- (-359.787) [-360.227] (-359.189) (-357.331) * (-357.035) (-356.538) (-357.919) [-357.728] -- 0:00:42
      284500 -- (-357.697) (-359.456) (-357.173) [-357.825] * (-358.740) (-363.201) [-357.678] (-356.973) -- 0:00:42
      285000 -- [-361.089] (-363.296) (-357.543) (-356.634) * [-358.967] (-358.530) (-356.309) (-357.539) -- 0:00:42

      Average standard deviation of split frequencies: 0.016580

      285500 -- [-359.404] (-361.016) (-357.530) (-357.491) * (-360.388) [-357.122] (-358.402) (-361.053) -- 0:00:42
      286000 -- [-358.347] (-356.892) (-360.389) (-359.525) * (-359.918) [-356.703] (-357.628) (-360.496) -- 0:00:42
      286500 -- (-362.588) [-357.338] (-365.667) (-360.263) * (-356.440) [-362.771] (-359.588) (-359.321) -- 0:00:42
      287000 -- (-358.483) (-361.467) [-357.348] (-365.076) * (-357.544) (-358.605) [-358.879] (-358.358) -- 0:00:42
      287500 -- (-358.205) (-363.838) [-357.998] (-364.319) * [-359.679] (-359.431) (-358.759) (-357.990) -- 0:00:42
      288000 -- (-357.083) [-358.816] (-357.713) (-358.554) * (-364.686) (-357.535) [-357.162] (-361.872) -- 0:00:42
      288500 -- (-358.260) (-362.469) [-359.179] (-360.278) * (-358.664) [-359.562] (-362.394) (-358.503) -- 0:00:41
      289000 -- (-356.348) (-357.523) [-357.340] (-360.040) * [-358.217] (-361.931) (-361.510) (-358.713) -- 0:00:44
      289500 -- (-358.086) (-360.919) [-356.946] (-357.900) * [-356.907] (-361.465) (-358.148) (-359.212) -- 0:00:44
      290000 -- (-357.217) (-359.779) (-359.013) [-357.170] * (-357.823) [-359.633] (-358.652) (-360.344) -- 0:00:44

      Average standard deviation of split frequencies: 0.016027

      290500 -- [-357.536] (-356.369) (-361.164) (-356.800) * (-360.855) (-357.916) [-359.479] (-360.367) -- 0:00:43
      291000 -- [-363.266] (-361.365) (-362.434) (-359.885) * (-360.921) (-356.771) (-358.010) [-362.135] -- 0:00:43
      291500 -- (-361.131) (-360.646) [-362.985] (-367.695) * (-360.522) (-359.318) [-359.550] (-356.359) -- 0:00:43
      292000 -- (-358.815) [-359.159] (-364.134) (-358.428) * (-361.689) [-358.080] (-361.022) (-357.308) -- 0:00:43
      292500 -- (-357.822) (-357.019) (-359.697) [-361.140] * [-356.585] (-360.892) (-359.073) (-357.686) -- 0:00:43
      293000 -- (-358.713) (-360.166) [-356.945] (-358.217) * (-357.609) (-361.246) (-356.968) [-358.351] -- 0:00:43
      293500 -- (-358.288) [-362.756] (-358.833) (-356.997) * [-356.768] (-362.986) (-359.651) (-357.793) -- 0:00:43
      294000 -- (-356.471) (-358.600) [-360.383] (-361.121) * (-356.100) (-359.608) (-365.752) [-359.666] -- 0:00:43
      294500 -- [-357.529] (-357.654) (-357.639) (-357.247) * [-358.950] (-363.603) (-366.480) (-358.895) -- 0:00:43
      295000 -- (-358.218) [-361.302] (-360.432) (-359.426) * (-357.013) (-357.830) [-360.748] (-357.346) -- 0:00:43

      Average standard deviation of split frequencies: 0.016956

      295500 -- (-359.984) [-358.534] (-360.566) (-364.210) * (-360.948) (-358.980) [-356.866] (-358.909) -- 0:00:42
      296000 -- (-359.725) [-359.700] (-358.957) (-360.986) * (-359.060) [-357.048] (-362.389) (-359.058) -- 0:00:42
      296500 -- [-359.088] (-361.384) (-361.556) (-365.887) * (-355.995) (-358.030) (-357.108) [-359.118] -- 0:00:42
      297000 -- (-358.293) (-356.177) (-357.456) [-363.777] * [-356.862] (-359.977) (-357.729) (-358.815) -- 0:00:42
      297500 -- (-362.236) (-356.693) (-357.719) [-363.290] * (-357.825) (-361.461) (-356.517) [-357.941] -- 0:00:42
      298000 -- [-357.157] (-357.903) (-360.785) (-359.436) * (-357.110) (-357.721) [-358.665] (-362.139) -- 0:00:42
      298500 -- [-357.118] (-358.624) (-357.374) (-358.217) * (-360.226) (-358.867) [-357.051] (-357.107) -- 0:00:42
      299000 -- [-360.923] (-359.592) (-358.076) (-357.122) * (-358.725) [-360.232] (-359.514) (-358.874) -- 0:00:42
      299500 -- (-357.595) (-365.798) (-360.412) [-356.530] * (-357.712) (-357.471) (-356.345) [-359.274] -- 0:00:42
      300000 -- [-356.791] (-360.672) (-358.910) (-361.828) * (-359.015) (-357.046) (-356.810) [-361.139] -- 0:00:42

      Average standard deviation of split frequencies: 0.017149

      300500 -- [-357.672] (-361.575) (-361.091) (-357.083) * (-361.002) (-360.341) [-357.289] (-363.056) -- 0:00:41
      301000 -- (-359.935) (-357.641) [-362.829] (-359.106) * (-361.073) (-362.851) [-358.063] (-361.708) -- 0:00:41
      301500 -- (-360.807) (-359.657) (-364.608) [-357.922] * [-359.037] (-359.272) (-358.459) (-357.440) -- 0:00:41
      302000 -- (-359.349) (-357.084) (-364.798) [-357.863] * (-360.005) (-359.538) (-357.680) [-357.267] -- 0:00:41
      302500 -- (-359.400) [-357.477] (-359.946) (-356.865) * [-356.164] (-359.430) (-357.469) (-357.582) -- 0:00:41
      303000 -- (-359.020) [-359.562] (-359.232) (-356.210) * (-358.581) (-360.240) (-360.106) [-356.539] -- 0:00:41
      303500 -- [-360.432] (-358.561) (-359.301) (-356.291) * (-357.150) (-362.031) (-358.486) [-357.911] -- 0:00:41
      304000 -- (-363.319) (-358.040) (-357.313) [-359.670] * (-357.699) (-360.775) [-361.153] (-358.401) -- 0:00:41
      304500 -- [-363.868] (-357.915) (-359.701) (-359.889) * (-357.919) [-358.007] (-357.089) (-357.623) -- 0:00:41
      305000 -- (-358.123) (-356.776) [-357.117] (-357.746) * [-357.137] (-358.091) (-357.067) (-357.419) -- 0:00:41

      Average standard deviation of split frequencies: 0.016272

      305500 -- (-357.273) (-360.988) [-359.136] (-356.896) * [-359.402] (-357.750) (-362.164) (-357.915) -- 0:00:40
      306000 -- (-356.630) [-359.716] (-359.823) (-357.161) * (-357.098) (-360.281) [-358.177] (-357.517) -- 0:00:43
      306500 -- (-356.385) (-357.868) (-358.619) [-356.673] * (-356.998) (-361.404) (-358.518) [-356.854] -- 0:00:42
      307000 -- (-361.076) (-357.890) (-356.937) [-358.767] * (-356.563) [-357.461] (-357.427) (-357.604) -- 0:00:42
      307500 -- (-360.107) [-357.968] (-358.275) (-356.032) * (-357.321) [-359.780] (-356.150) (-363.673) -- 0:00:42
      308000 -- (-357.235) (-360.568) [-359.395] (-367.482) * (-358.257) (-358.209) (-356.588) [-362.855] -- 0:00:42
      308500 -- (-357.791) (-359.953) [-358.307] (-364.242) * (-363.157) (-359.016) (-356.093) [-356.370] -- 0:00:42
      309000 -- (-360.959) [-359.256] (-358.073) (-358.909) * [-358.171] (-356.800) (-356.940) (-361.209) -- 0:00:42
      309500 -- (-356.821) [-356.964] (-358.028) (-358.406) * (-360.594) (-356.591) [-357.018] (-365.268) -- 0:00:42
      310000 -- [-357.865] (-357.779) (-357.183) (-357.169) * (-359.040) [-359.757] (-362.045) (-357.874) -- 0:00:42

      Average standard deviation of split frequencies: 0.015263

      310500 -- [-359.312] (-361.116) (-359.528) (-359.125) * (-360.450) (-356.084) [-360.606] (-358.383) -- 0:00:42
      311000 -- (-357.977) (-357.730) [-357.866] (-358.259) * (-357.908) [-356.623] (-360.741) (-357.728) -- 0:00:42
      311500 -- [-359.286] (-357.258) (-360.087) (-359.115) * (-357.400) (-356.742) (-357.998) [-358.846] -- 0:00:41
      312000 -- [-356.938] (-357.589) (-363.411) (-360.404) * [-363.414] (-361.171) (-358.322) (-357.141) -- 0:00:41
      312500 -- [-357.452] (-358.210) (-361.825) (-357.564) * (-360.027) (-360.609) [-358.583] (-360.928) -- 0:00:41
      313000 -- [-357.722] (-358.407) (-366.067) (-357.839) * (-362.380) [-356.293] (-359.031) (-361.225) -- 0:00:41
      313500 -- (-359.406) (-357.353) [-367.915] (-356.190) * (-358.656) [-357.702] (-359.780) (-359.927) -- 0:00:41
      314000 -- [-356.506] (-356.568) (-363.200) (-358.549) * [-358.343] (-358.131) (-357.415) (-358.635) -- 0:00:41
      314500 -- [-359.673] (-362.010) (-360.525) (-356.144) * (-357.169) (-361.752) (-363.293) [-357.873] -- 0:00:41
      315000 -- (-357.393) (-359.224) (-357.874) [-357.284] * (-356.359) (-359.309) (-360.842) [-359.041] -- 0:00:41

      Average standard deviation of split frequencies: 0.014479

      315500 -- (-359.553) [-359.840] (-358.254) (-355.974) * [-356.026] (-361.207) (-361.081) (-362.664) -- 0:00:41
      316000 -- (-360.044) (-360.018) [-358.757] (-356.717) * [-357.131] (-361.569) (-362.063) (-358.053) -- 0:00:41
      316500 -- (-361.074) [-359.908] (-359.846) (-357.474) * (-357.303) (-357.080) [-360.404] (-357.882) -- 0:00:41
      317000 -- (-359.468) (-361.435) (-356.861) [-357.886] * (-360.471) [-357.235] (-363.024) (-358.189) -- 0:00:40
      317500 -- (-358.751) (-360.512) (-358.292) [-359.771] * (-359.533) (-357.720) (-358.940) [-358.841] -- 0:00:40
      318000 -- (-358.449) (-358.527) [-357.554] (-361.762) * (-361.410) [-357.996] (-357.780) (-359.474) -- 0:00:40
      318500 -- (-360.602) (-358.808) (-357.558) [-356.985] * [-359.421] (-359.070) (-357.742) (-358.526) -- 0:00:40
      319000 -- (-361.303) (-357.763) (-358.818) [-358.807] * (-362.942) (-360.738) [-358.138] (-359.460) -- 0:00:40
      319500 -- (-358.633) (-359.627) (-362.266) [-359.863] * [-360.588] (-358.322) (-357.001) (-361.685) -- 0:00:40
      320000 -- [-360.411] (-358.540) (-361.165) (-360.718) * (-358.023) [-358.012] (-356.943) (-359.593) -- 0:00:40

      Average standard deviation of split frequencies: 0.013058

      320500 -- (-361.901) [-357.720] (-357.641) (-358.721) * (-360.316) [-361.251] (-357.883) (-359.517) -- 0:00:40
      321000 -- (-358.338) (-358.319) (-357.622) [-357.430] * [-359.906] (-359.083) (-359.400) (-357.237) -- 0:00:40
      321500 -- [-358.700] (-357.311) (-356.051) (-359.525) * (-358.041) [-357.880] (-359.694) (-358.825) -- 0:00:40
      322000 -- [-357.299] (-357.102) (-357.029) (-357.649) * [-356.747] (-357.296) (-359.449) (-365.770) -- 0:00:40
      322500 -- [-356.935] (-357.025) (-360.010) (-358.215) * [-356.768] (-360.630) (-361.010) (-359.935) -- 0:00:39
      323000 -- (-356.604) (-358.640) [-357.379] (-361.632) * [-357.136] (-359.843) (-357.457) (-360.572) -- 0:00:41
      323500 -- [-357.852] (-360.933) (-357.803) (-360.245) * (-357.673) [-360.638] (-356.267) (-360.719) -- 0:00:41
      324000 -- (-356.979) (-361.139) [-356.268] (-360.356) * (-358.166) [-364.094] (-356.536) (-360.546) -- 0:00:41
      324500 -- (-361.338) (-358.252) [-358.094] (-358.353) * (-356.738) (-360.609) [-357.410] (-358.960) -- 0:00:41
      325000 -- (-356.946) (-356.554) [-357.732] (-357.147) * (-357.251) (-358.600) [-356.079] (-358.897) -- 0:00:41

      Average standard deviation of split frequencies: 0.011398

      325500 -- [-358.201] (-358.590) (-357.794) (-357.885) * [-359.705] (-357.596) (-356.113) (-357.577) -- 0:00:41
      326000 -- (-359.180) (-358.944) (-356.776) [-360.692] * (-362.901) [-357.072] (-357.630) (-358.523) -- 0:00:41
      326500 -- (-357.849) (-358.327) (-358.965) [-363.309] * (-358.011) [-358.674] (-361.853) (-358.845) -- 0:00:41
      327000 -- (-356.729) (-357.390) (-357.065) [-359.415] * (-356.421) [-357.966] (-357.145) (-357.668) -- 0:00:41
      327500 -- (-356.792) (-356.523) [-358.405] (-357.759) * (-357.731) (-357.922) (-357.747) [-357.687] -- 0:00:41
      328000 -- (-357.194) (-359.403) (-357.644) [-358.115] * (-357.568) (-359.308) [-357.795] (-359.877) -- 0:00:40
      328500 -- (-357.346) (-359.895) (-358.088) [-362.509] * (-359.520) (-356.848) [-356.692] (-357.012) -- 0:00:40
      329000 -- (-358.780) (-360.085) (-358.050) [-357.472] * (-359.315) (-356.898) (-359.530) [-356.115] -- 0:00:40
      329500 -- (-358.933) [-360.829] (-356.746) (-356.662) * [-358.665] (-356.909) (-357.125) (-357.803) -- 0:00:40
      330000 -- (-357.430) (-357.829) [-361.230] (-356.599) * [-357.861] (-357.692) (-359.142) (-356.147) -- 0:00:40

      Average standard deviation of split frequencies: 0.012296

      330500 -- (-358.742) (-357.495) [-360.886] (-357.069) * (-357.890) [-356.947] (-359.761) (-358.892) -- 0:00:40
      331000 -- [-358.776] (-356.676) (-356.533) (-357.172) * (-357.033) (-358.550) [-357.294] (-358.225) -- 0:00:40
      331500 -- (-359.303) (-357.435) [-358.273] (-357.112) * (-357.758) (-357.588) (-359.577) [-357.956] -- 0:00:40
      332000 -- (-359.485) (-359.731) (-360.634) [-357.121] * (-360.880) (-359.114) [-358.086] (-362.849) -- 0:00:40
      332500 -- (-358.168) [-359.216] (-356.387) (-361.517) * (-358.905) (-358.224) [-359.544] (-359.727) -- 0:00:40
      333000 -- [-358.058] (-359.171) (-357.169) (-356.964) * (-356.708) (-359.358) (-358.194) [-360.244] -- 0:00:40
      333500 -- (-358.881) (-361.421) [-358.304] (-357.201) * (-359.593) (-360.367) [-358.311] (-361.894) -- 0:00:39
      334000 -- (-358.599) (-358.877) (-357.692) [-358.238] * (-358.997) (-356.763) [-359.350] (-360.142) -- 0:00:39
      334500 -- (-357.174) (-359.504) (-358.290) [-356.916] * (-359.582) [-357.725] (-357.905) (-358.360) -- 0:00:39
      335000 -- [-359.428] (-357.073) (-358.002) (-359.490) * (-356.852) (-361.062) (-356.657) [-356.667] -- 0:00:39

      Average standard deviation of split frequencies: 0.013535

      335500 -- (-359.191) (-359.716) (-359.269) [-359.153] * (-358.200) (-357.747) [-357.528] (-359.177) -- 0:00:39
      336000 -- [-356.594] (-365.735) (-357.450) (-359.325) * (-359.167) (-360.044) [-357.011] (-366.300) -- 0:00:39
      336500 -- (-356.477) [-356.546] (-356.715) (-357.863) * (-359.437) [-357.523] (-359.867) (-360.801) -- 0:00:39
      337000 -- (-361.509) (-358.249) [-356.885] (-357.674) * [-360.808] (-358.654) (-360.166) (-362.232) -- 0:00:39
      337500 -- (-356.604) (-356.547) (-357.313) [-356.994] * (-357.378) [-357.908] (-358.002) (-358.134) -- 0:00:39
      338000 -- (-359.410) (-357.200) [-358.699] (-357.830) * (-359.280) (-356.683) (-359.494) [-357.414] -- 0:00:39
      338500 -- (-361.494) [-356.445] (-357.257) (-361.716) * (-360.160) (-358.790) [-360.262] (-356.596) -- 0:00:39
      339000 -- [-356.945] (-361.668) (-358.043) (-358.845) * (-364.318) (-360.350) [-359.053] (-356.389) -- 0:00:38
      339500 -- [-357.568] (-358.823) (-360.178) (-359.176) * (-358.624) (-357.054) (-358.904) [-360.552] -- 0:00:38
      340000 -- (-359.897) (-356.682) [-358.529] (-357.692) * (-356.728) (-358.766) [-356.910] (-360.124) -- 0:00:38

      Average standard deviation of split frequencies: 0.013838

      340500 -- (-358.406) (-359.035) (-360.347) [-357.962] * (-360.164) (-360.171) (-358.692) [-357.518] -- 0:00:40
      341000 -- (-361.779) (-359.518) [-361.000] (-358.327) * (-358.642) [-358.376] (-357.149) (-356.556) -- 0:00:40
      341500 -- [-359.611] (-358.023) (-358.372) (-357.463) * (-357.212) (-357.373) (-356.731) [-356.879] -- 0:00:40
      342000 -- (-362.163) (-358.381) [-356.239] (-358.341) * (-357.838) [-357.396] (-357.806) (-357.292) -- 0:00:40
      342500 -- (-357.044) (-357.518) (-358.489) [-359.581] * (-357.201) (-360.117) [-357.470] (-358.509) -- 0:00:40
      343000 -- [-358.216] (-358.065) (-362.149) (-359.667) * [-356.252] (-356.910) (-357.105) (-357.614) -- 0:00:40
      343500 -- (-358.960) [-362.900] (-361.457) (-357.032) * [-357.895] (-361.181) (-365.208) (-357.259) -- 0:00:40
      344000 -- [-359.609] (-362.207) (-361.349) (-357.000) * (-357.092) (-358.815) [-361.144] (-357.775) -- 0:00:40
      344500 -- (-357.797) (-357.710) [-357.774] (-359.861) * (-359.449) (-359.415) (-357.921) [-356.115] -- 0:00:39
      345000 -- (-358.108) (-362.816) [-356.839] (-362.140) * [-358.404] (-359.105) (-357.059) (-358.671) -- 0:00:39

      Average standard deviation of split frequencies: 0.014105

      345500 -- (-356.530) (-358.167) [-357.826] (-356.748) * (-360.074) (-357.623) [-356.510] (-362.473) -- 0:00:39
      346000 -- (-359.629) (-360.055) (-360.492) [-358.588] * (-357.387) [-357.998] (-359.204) (-360.834) -- 0:00:39
      346500 -- (-357.018) [-359.820] (-357.405) (-358.595) * [-359.513] (-358.677) (-357.985) (-357.818) -- 0:00:39
      347000 -- (-357.805) [-357.524] (-356.368) (-361.081) * (-359.530) (-359.832) [-357.327] (-358.294) -- 0:00:39
      347500 -- (-358.727) (-358.317) [-356.272] (-359.497) * (-356.726) [-357.749] (-358.263) (-361.929) -- 0:00:39
      348000 -- (-358.153) [-359.490] (-356.344) (-361.704) * [-356.896] (-357.621) (-356.205) (-363.101) -- 0:00:39
      348500 -- (-357.662) (-359.482) (-356.673) [-356.681] * (-362.453) (-360.670) [-359.000] (-359.585) -- 0:00:39
      349000 -- (-356.581) (-358.880) [-357.759] (-358.671) * [-359.486] (-359.857) (-363.903) (-361.282) -- 0:00:39
      349500 -- (-356.540) [-364.389] (-356.140) (-359.264) * (-358.605) (-357.901) (-360.677) [-356.268] -- 0:00:39
      350000 -- (-356.737) (-360.297) [-360.911] (-357.750) * (-358.553) (-362.678) (-358.543) [-357.071] -- 0:00:39

      Average standard deviation of split frequencies: 0.013918

      350500 -- (-358.629) (-358.512) (-360.670) [-357.505] * [-357.046] (-358.839) (-358.075) (-358.608) -- 0:00:38
      351000 -- (-356.296) (-358.867) (-361.137) [-358.249] * (-357.501) (-358.271) (-360.799) [-359.431] -- 0:00:38
      351500 -- [-360.449] (-362.235) (-358.576) (-358.855) * (-357.258) (-359.771) (-360.866) [-358.448] -- 0:00:38
      352000 -- (-364.077) (-363.447) [-360.479] (-357.484) * (-357.978) (-357.435) [-358.572] (-360.173) -- 0:00:38
      352500 -- (-360.120) (-365.466) [-359.602] (-357.567) * (-358.941) [-356.272] (-357.653) (-357.959) -- 0:00:38
      353000 -- (-364.999) (-358.942) [-358.270] (-356.305) * (-362.281) (-358.633) (-363.219) [-358.238] -- 0:00:38
      353500 -- [-358.132] (-361.772) (-356.825) (-362.068) * (-357.024) [-356.826] (-358.592) (-361.754) -- 0:00:38
      354000 -- [-358.083] (-360.074) (-360.913) (-358.099) * [-359.649] (-359.027) (-359.383) (-359.235) -- 0:00:38
      354500 -- (-357.193) (-360.200) (-359.257) [-357.204] * (-358.683) [-356.626] (-361.563) (-363.357) -- 0:00:38
      355000 -- (-357.590) (-359.657) (-360.874) [-358.256] * (-358.549) (-357.337) (-358.484) [-358.458] -- 0:00:38

      Average standard deviation of split frequencies: 0.013987

      355500 -- (-358.546) (-357.521) (-359.189) [-361.679] * (-358.694) [-360.246] (-356.837) (-358.522) -- 0:00:38
      356000 -- (-356.994) [-358.410] (-363.963) (-357.885) * (-358.504) (-359.570) (-356.162) [-360.180] -- 0:00:37
      356500 -- (-359.236) (-363.268) [-358.709] (-357.384) * (-359.087) (-360.977) [-358.022] (-359.678) -- 0:00:37
      357000 -- [-360.135] (-359.258) (-357.092) (-360.274) * (-361.937) (-356.826) [-359.940] (-358.602) -- 0:00:37
      357500 -- (-358.775) (-361.377) (-358.057) [-356.069] * (-356.960) (-356.674) (-357.041) [-356.582] -- 0:00:39
      358000 -- [-359.227] (-359.022) (-360.127) (-358.970) * (-358.707) (-358.921) [-356.839] (-358.464) -- 0:00:39
      358500 -- (-358.712) [-356.655] (-364.522) (-357.699) * (-357.178) [-357.861] (-357.171) (-356.820) -- 0:00:39
      359000 -- (-359.667) [-356.320] (-360.664) (-358.162) * [-357.400] (-358.049) (-359.990) (-363.012) -- 0:00:39
      359500 -- (-359.422) (-359.929) [-358.193] (-357.207) * [-360.000] (-358.881) (-363.373) (-359.328) -- 0:00:39
      360000 -- (-361.693) [-358.510] (-360.090) (-357.494) * (-357.801) (-358.920) [-359.056] (-357.409) -- 0:00:39

      Average standard deviation of split frequencies: 0.013532

      360500 -- (-365.461) [-357.659] (-359.076) (-358.267) * [-356.340] (-361.806) (-358.258) (-362.427) -- 0:00:39
      361000 -- (-359.629) (-357.738) (-360.479) [-357.813] * [-356.950] (-359.843) (-357.747) (-356.956) -- 0:00:38
      361500 -- (-357.821) (-357.868) [-360.283] (-360.212) * (-359.204) (-359.458) [-356.363] (-357.437) -- 0:00:38
      362000 -- (-357.003) (-357.215) [-358.778] (-361.186) * (-359.698) (-357.197) (-356.293) [-359.247] -- 0:00:38
      362500 -- (-359.309) (-356.077) (-356.593) [-358.960] * (-361.394) (-357.997) [-356.848] (-358.513) -- 0:00:38
      363000 -- (-357.719) [-356.021] (-357.362) (-357.930) * (-357.087) (-356.289) [-358.242] (-357.850) -- 0:00:38
      363500 -- (-361.249) (-358.448) [-359.076] (-357.691) * (-357.667) [-357.243] (-356.939) (-356.987) -- 0:00:38
      364000 -- (-356.353) (-357.223) [-359.485] (-358.128) * (-361.541) [-359.296] (-356.993) (-358.732) -- 0:00:38
      364500 -- (-356.693) (-358.466) (-361.284) [-358.305] * [-365.506] (-360.049) (-360.129) (-358.444) -- 0:00:38
      365000 -- (-360.899) (-359.193) (-359.222) [-357.826] * (-363.997) (-360.101) [-356.918] (-358.256) -- 0:00:38

      Average standard deviation of split frequencies: 0.013486

      365500 -- (-361.900) (-356.436) [-359.707] (-356.520) * (-363.602) (-357.568) [-357.332] (-356.485) -- 0:00:38
      366000 -- (-355.993) (-360.387) (-357.836) [-358.375] * (-358.411) (-358.372) (-357.303) [-359.409] -- 0:00:38
      366500 -- (-356.254) [-358.018] (-357.301) (-357.790) * (-357.288) (-358.895) [-357.435] (-358.219) -- 0:00:38
      367000 -- (-358.363) (-357.642) (-356.148) [-360.163] * (-356.623) [-356.580] (-359.677) (-360.292) -- 0:00:37
      367500 -- (-357.619) [-358.639] (-359.114) (-357.781) * (-357.423) [-358.273] (-363.585) (-357.982) -- 0:00:37
      368000 -- (-363.151) (-360.221) [-356.882] (-357.459) * [-360.349] (-357.472) (-360.212) (-359.137) -- 0:00:37
      368500 -- (-358.748) (-359.785) [-359.019] (-357.407) * (-359.383) [-358.092] (-358.330) (-357.923) -- 0:00:37
      369000 -- [-357.839] (-358.739) (-359.526) (-361.277) * (-359.956) (-357.232) [-358.336] (-359.825) -- 0:00:37
      369500 -- (-358.663) (-358.709) (-359.871) [-356.905] * [-358.749] (-357.273) (-359.160) (-358.893) -- 0:00:37
      370000 -- [-357.285] (-356.355) (-358.311) (-356.905) * [-357.800] (-360.397) (-358.068) (-359.415) -- 0:00:37

      Average standard deviation of split frequencies: 0.015977

      370500 -- (-360.653) (-356.613) (-357.025) [-356.449] * (-359.267) [-360.220] (-358.577) (-356.760) -- 0:00:37
      371000 -- [-360.311] (-359.705) (-359.399) (-356.837) * [-357.460] (-357.527) (-358.797) (-356.598) -- 0:00:37
      371500 -- [-356.093] (-359.275) (-358.550) (-358.995) * (-358.808) (-364.964) [-357.905] (-358.016) -- 0:00:37
      372000 -- (-356.818) (-365.090) (-357.444) [-356.775] * (-358.788) (-360.621) [-357.077] (-358.944) -- 0:00:37
      372500 -- [-356.547] (-359.919) (-360.118) (-357.919) * [-361.109] (-357.080) (-356.774) (-358.513) -- 0:00:37
      373000 -- (-356.670) (-357.044) (-359.850) [-360.092] * (-358.022) [-356.735] (-358.522) (-358.930) -- 0:00:36
      373500 -- (-358.057) [-358.510] (-359.765) (-360.823) * [-357.042] (-356.867) (-360.174) (-363.077) -- 0:00:36
      374000 -- (-356.981) (-360.885) [-358.671] (-358.930) * (-363.409) [-356.846] (-359.943) (-363.217) -- 0:00:36
      374500 -- [-358.235] (-357.050) (-359.934) (-357.385) * (-357.770) [-358.516] (-356.756) (-358.718) -- 0:00:38
      375000 -- (-357.761) [-360.041] (-358.119) (-359.708) * [-358.322] (-361.012) (-360.921) (-360.963) -- 0:00:38

      Average standard deviation of split frequencies: 0.014381

      375500 -- [-357.654] (-359.836) (-358.159) (-359.306) * (-357.803) (-356.876) [-356.470] (-358.354) -- 0:00:38
      376000 -- [-360.102] (-356.948) (-360.649) (-357.630) * (-357.390) (-356.030) [-358.321] (-361.284) -- 0:00:38
      376500 -- (-358.785) [-357.370] (-357.190) (-368.932) * (-359.687) [-356.550] (-358.545) (-358.814) -- 0:00:38
      377000 -- (-358.702) [-358.753] (-357.989) (-361.535) * [-357.568] (-357.885) (-364.796) (-359.021) -- 0:00:38
      377500 -- (-358.456) (-359.345) (-357.099) [-357.938] * [-360.298] (-359.677) (-358.760) (-357.119) -- 0:00:37
      378000 -- (-356.915) (-360.833) [-358.270] (-356.499) * (-360.977) [-357.702] (-356.667) (-358.999) -- 0:00:37
      378500 -- (-358.043) (-357.747) (-359.540) [-359.241] * (-356.809) (-358.698) (-358.395) [-358.337] -- 0:00:37
      379000 -- [-357.254] (-358.502) (-358.626) (-357.646) * (-360.788) (-359.178) [-358.697] (-359.742) -- 0:00:37
      379500 -- [-356.191] (-357.747) (-357.432) (-359.242) * (-358.417) (-357.023) (-359.018) [-361.214] -- 0:00:37
      380000 -- [-356.899] (-360.841) (-357.614) (-359.760) * [-357.779] (-356.883) (-358.186) (-358.881) -- 0:00:37

      Average standard deviation of split frequencies: 0.014654

      380500 -- (-357.048) (-358.575) (-359.474) [-360.539] * (-357.402) (-359.036) [-361.027] (-356.427) -- 0:00:37
      381000 -- (-358.424) [-358.194] (-356.332) (-359.112) * [-359.891] (-361.496) (-359.209) (-356.710) -- 0:00:37
      381500 -- (-357.652) [-360.126] (-358.817) (-359.597) * [-360.658] (-356.393) (-359.030) (-356.562) -- 0:00:37
      382000 -- (-362.790) [-356.773] (-360.110) (-358.110) * [-358.029] (-362.999) (-359.275) (-359.111) -- 0:00:37
      382500 -- [-356.613] (-361.084) (-359.905) (-358.661) * (-358.666) [-358.372] (-360.723) (-362.969) -- 0:00:37
      383000 -- (-357.999) (-358.454) (-357.192) [-357.337] * (-358.117) (-357.230) [-361.922] (-356.697) -- 0:00:37
      383500 -- (-358.917) (-362.417) (-358.782) [-356.687] * (-357.193) (-358.481) [-360.389] (-356.658) -- 0:00:36
      384000 -- (-358.588) [-358.675] (-359.032) (-357.794) * [-357.730] (-359.075) (-356.739) (-358.147) -- 0:00:36
      384500 -- [-357.010] (-357.999) (-359.859) (-358.415) * (-359.265) (-357.991) [-359.725] (-357.362) -- 0:00:36
      385000 -- (-360.002) (-358.037) [-357.938] (-357.096) * [-358.094] (-358.126) (-357.505) (-356.568) -- 0:00:36

      Average standard deviation of split frequencies: 0.014316

      385500 -- [-357.819] (-358.432) (-358.185) (-358.192) * (-360.924) (-356.929) (-357.768) [-357.970] -- 0:00:36
      386000 -- (-359.848) (-358.900) (-358.205) [-358.774] * (-359.654) [-359.879] (-361.111) (-356.808) -- 0:00:36
      386500 -- (-360.266) (-357.464) [-359.198] (-359.893) * (-358.706) (-360.547) [-357.268] (-357.656) -- 0:00:36
      387000 -- (-359.250) (-358.295) [-358.676] (-357.450) * (-356.614) [-360.461] (-364.180) (-364.762) -- 0:00:36
      387500 -- (-359.880) (-362.222) (-360.491) [-358.701] * (-357.024) (-358.601) [-362.054] (-367.196) -- 0:00:36
      388000 -- (-358.063) [-358.026] (-359.656) (-359.272) * (-358.418) [-356.242] (-359.838) (-358.009) -- 0:00:36
      388500 -- (-359.528) [-357.418] (-359.504) (-356.950) * (-360.221) [-359.115] (-357.191) (-362.370) -- 0:00:36
      389000 -- (-357.260) (-360.420) (-356.589) [-357.281] * (-356.853) (-360.024) [-362.150] (-358.866) -- 0:00:36
      389500 -- [-356.834] (-359.068) (-360.061) (-359.517) * (-356.793) [-357.168] (-357.433) (-359.111) -- 0:00:36
      390000 -- (-358.897) (-358.546) [-362.381] (-359.346) * (-358.998) [-359.343] (-358.572) (-357.416) -- 0:00:35

      Average standard deviation of split frequencies: 0.013743

      390500 -- (-361.293) [-356.314] (-356.801) (-356.803) * (-357.114) (-362.871) (-357.861) [-358.791] -- 0:00:35
      391000 -- (-357.851) (-359.070) (-364.397) [-358.460] * [-357.466] (-356.308) (-356.783) (-358.855) -- 0:00:35
      391500 -- [-357.992] (-356.376) (-356.999) (-357.844) * [-359.951] (-356.626) (-358.329) (-356.999) -- 0:00:35
      392000 -- (-359.839) (-356.415) (-357.206) [-357.707] * [-359.598] (-357.836) (-362.100) (-359.291) -- 0:00:37
      392500 -- (-358.353) [-357.891] (-366.521) (-356.280) * [-358.916] (-357.844) (-358.269) (-360.678) -- 0:00:37
      393000 -- [-359.598] (-359.465) (-364.934) (-357.030) * [-360.291] (-360.273) (-362.034) (-360.262) -- 0:00:37
      393500 -- [-359.119] (-356.532) (-361.064) (-358.299) * (-360.609) [-356.348] (-366.243) (-356.606) -- 0:00:36
      394000 -- [-359.777] (-357.193) (-362.755) (-361.836) * (-359.453) [-357.164] (-356.947) (-359.277) -- 0:00:36
      394500 -- (-357.426) [-358.950] (-364.448) (-359.145) * (-361.045) (-357.081) (-357.302) [-356.949] -- 0:00:36
      395000 -- (-362.469) [-360.095] (-362.469) (-357.963) * (-360.315) [-362.069] (-356.155) (-357.843) -- 0:00:36

      Average standard deviation of split frequencies: 0.013558

      395500 -- [-357.163] (-358.075) (-357.311) (-356.375) * (-358.888) [-357.351] (-358.157) (-357.896) -- 0:00:36
      396000 -- (-359.736) (-360.526) [-358.446] (-360.040) * [-359.162] (-359.273) (-359.029) (-358.903) -- 0:00:36
      396500 -- (-360.468) (-358.564) [-361.026] (-359.732) * (-357.184) [-358.166] (-358.176) (-357.907) -- 0:00:36
      397000 -- (-357.813) (-357.610) [-359.397] (-360.174) * (-356.084) (-357.534) (-358.245) [-358.228] -- 0:00:36
      397500 -- (-359.843) (-360.585) [-358.560] (-357.917) * [-357.472] (-357.782) (-358.818) (-357.202) -- 0:00:36
      398000 -- (-359.919) [-356.992] (-357.132) (-360.799) * (-358.870) [-357.407] (-356.825) (-357.403) -- 0:00:36
      398500 -- (-358.346) (-356.117) [-357.690] (-358.063) * (-356.603) (-359.929) (-356.241) [-356.939] -- 0:00:36
      399000 -- [-357.764] (-359.827) (-358.057) (-358.499) * (-358.151) (-358.862) (-357.564) [-358.809] -- 0:00:36
      399500 -- (-360.896) [-357.288] (-361.424) (-362.147) * (-356.775) (-357.952) [-356.976] (-356.724) -- 0:00:36
      400000 -- [-359.205] (-357.817) (-360.417) (-359.117) * (-358.530) (-357.577) (-356.926) [-357.300] -- 0:00:36

      Average standard deviation of split frequencies: 0.013661

      400500 -- (-360.640) (-357.028) [-358.822] (-362.517) * [-357.356] (-361.549) (-358.592) (-357.322) -- 0:00:35
      401000 -- (-358.930) (-357.291) [-356.378] (-360.189) * (-363.010) (-361.514) (-358.252) [-359.037] -- 0:00:35
      401500 -- (-357.429) (-361.924) [-356.727] (-359.998) * (-358.104) (-360.889) (-360.214) [-356.560] -- 0:00:35
      402000 -- (-358.296) [-356.604] (-357.364) (-358.735) * (-357.653) [-360.522] (-357.554) (-363.356) -- 0:00:35
      402500 -- (-358.827) (-357.273) (-356.687) [-357.930] * (-357.515) (-361.144) [-365.080] (-360.898) -- 0:00:35
      403000 -- (-358.977) [-358.589] (-359.433) (-357.442) * (-360.073) (-357.796) [-357.838] (-358.541) -- 0:00:35
      403500 -- (-362.479) [-357.434] (-359.203) (-357.178) * (-361.878) (-361.001) (-357.738) [-358.097] -- 0:00:35
      404000 -- (-358.275) (-356.857) (-357.501) [-356.511] * [-356.472] (-362.185) (-356.978) (-357.508) -- 0:00:35
      404500 -- [-358.635] (-359.592) (-359.755) (-359.054) * (-362.133) (-360.227) (-358.960) [-358.420] -- 0:00:35
      405000 -- [-357.238] (-360.280) (-362.727) (-359.276) * (-358.953) (-356.770) (-361.019) [-360.527] -- 0:00:35

      Average standard deviation of split frequencies: 0.014514

      405500 -- (-359.938) [-358.112] (-358.566) (-358.457) * (-357.810) [-358.041] (-360.667) (-359.466) -- 0:00:35
      406000 -- (-357.602) (-357.736) [-358.413] (-359.183) * (-358.329) [-357.234] (-357.109) (-358.895) -- 0:00:35
      406500 -- [-356.836] (-357.545) (-358.347) (-358.479) * (-357.616) [-365.876] (-358.550) (-356.097) -- 0:00:35
      407000 -- [-358.273] (-358.545) (-357.298) (-359.816) * (-356.293) [-358.139] (-358.282) (-357.030) -- 0:00:34
      407500 -- (-360.245) (-357.643) (-358.565) [-360.319] * (-358.974) (-362.105) [-359.346] (-359.965) -- 0:00:34
      408000 -- (-356.260) (-360.883) [-356.644] (-358.545) * (-360.582) (-358.095) (-359.086) [-359.681] -- 0:00:34
      408500 -- (-358.856) [-359.674] (-360.494) (-358.519) * (-356.928) [-356.489] (-358.319) (-356.417) -- 0:00:36
      409000 -- (-360.710) [-357.656] (-359.344) (-359.306) * (-357.036) [-357.575] (-359.379) (-357.406) -- 0:00:36
      409500 -- [-361.558] (-356.234) (-361.467) (-357.928) * (-359.038) (-358.721) (-358.729) [-356.654] -- 0:00:36
      410000 -- (-359.191) [-357.742] (-356.469) (-357.887) * [-356.603] (-359.102) (-360.266) (-359.617) -- 0:00:35

      Average standard deviation of split frequencies: 0.014413

      410500 -- (-364.645) [-357.780] (-362.679) (-357.889) * (-356.618) (-361.280) [-357.463] (-360.226) -- 0:00:35
      411000 -- [-359.006] (-358.365) (-362.530) (-360.537) * (-359.763) (-357.745) (-357.427) [-357.466] -- 0:00:35
      411500 -- (-358.328) [-358.843] (-357.820) (-358.033) * [-360.331] (-359.492) (-356.991) (-357.644) -- 0:00:35
      412000 -- [-358.995] (-361.560) (-356.761) (-357.045) * (-360.487) (-358.129) (-359.997) [-357.197] -- 0:00:35
      412500 -- (-358.979) (-359.997) (-356.475) [-357.850] * [-358.556] (-357.380) (-357.907) (-359.216) -- 0:00:35
      413000 -- (-357.368) (-358.617) [-357.063] (-358.471) * (-357.914) (-357.435) [-357.776] (-362.797) -- 0:00:35
      413500 -- (-358.337) (-357.357) (-359.264) [-358.077] * (-358.590) [-356.789] (-357.303) (-357.120) -- 0:00:35
      414000 -- (-356.923) [-356.684] (-359.733) (-360.181) * [-357.230] (-356.843) (-357.334) (-358.048) -- 0:00:35
      414500 -- (-357.620) (-360.351) (-357.304) [-356.703] * (-359.096) (-359.367) [-357.813] (-358.216) -- 0:00:35
      415000 -- [-357.611] (-358.456) (-359.991) (-364.350) * (-357.035) [-356.241] (-357.321) (-358.136) -- 0:00:35

      Average standard deviation of split frequencies: 0.014731

      415500 -- (-358.706) (-357.096) [-358.255] (-366.238) * (-357.589) [-357.051] (-358.360) (-359.037) -- 0:00:35
      416000 -- [-357.673] (-356.081) (-358.268) (-359.134) * (-361.264) [-358.815] (-358.532) (-357.639) -- 0:00:35
      416500 -- (-357.253) (-361.814) (-367.332) [-357.776] * (-359.162) (-360.146) (-357.045) [-357.629] -- 0:00:35
      417000 -- (-361.535) [-361.057] (-359.384) (-356.457) * [-357.793] (-357.738) (-359.754) (-357.186) -- 0:00:34
      417500 -- (-357.504) (-361.210) (-357.593) [-356.183] * (-357.486) (-361.846) [-359.133] (-357.433) -- 0:00:34
      418000 -- [-359.698] (-361.376) (-356.924) (-358.866) * (-357.157) (-358.954) (-356.748) [-358.276] -- 0:00:34
      418500 -- [-357.551] (-358.552) (-357.076) (-362.652) * [-357.132] (-358.338) (-356.771) (-357.433) -- 0:00:34
      419000 -- [-360.459] (-359.398) (-357.309) (-358.309) * (-356.615) [-357.463] (-359.071) (-361.361) -- 0:00:34
      419500 -- (-362.308) (-362.985) [-357.553] (-357.080) * [-357.139] (-357.167) (-359.617) (-361.180) -- 0:00:34
      420000 -- (-360.756) (-359.868) (-359.901) [-358.862] * [-357.384] (-357.321) (-362.027) (-357.420) -- 0:00:34

      Average standard deviation of split frequencies: 0.014078

      420500 -- (-359.437) [-357.019] (-358.370) (-356.181) * [-357.170] (-357.899) (-358.768) (-356.449) -- 0:00:34
      421000 -- (-358.618) (-358.562) [-357.539] (-357.222) * (-361.513) (-359.376) (-361.206) [-357.953] -- 0:00:34
      421500 -- [-360.294] (-357.232) (-359.255) (-356.079) * (-362.853) [-356.654] (-360.322) (-360.880) -- 0:00:34
      422000 -- (-358.328) (-357.819) [-361.060] (-359.181) * (-360.888) (-356.315) (-358.115) [-358.186] -- 0:00:34
      422500 -- (-360.084) (-360.454) [-358.846] (-361.680) * (-356.995) (-357.787) (-357.202) [-356.779] -- 0:00:34
      423000 -- (-360.211) (-357.369) (-359.138) [-357.122] * [-356.336] (-356.627) (-356.832) (-360.407) -- 0:00:34
      423500 -- [-358.083] (-358.003) (-356.896) (-356.158) * [-358.051] (-357.718) (-360.589) (-357.917) -- 0:00:34
      424000 -- (-357.539) (-358.449) [-356.408] (-359.086) * (-358.094) (-360.530) [-363.008] (-359.910) -- 0:00:33
      424500 -- (-362.159) [-357.267] (-359.885) (-358.728) * [-359.922] (-358.081) (-358.435) (-361.714) -- 0:00:33
      425000 -- (-360.291) (-358.403) [-357.979] (-359.198) * (-359.146) (-356.543) [-358.319] (-358.034) -- 0:00:33

      Average standard deviation of split frequencies: 0.013210

      425500 -- (-358.278) [-359.370] (-359.748) (-357.124) * (-358.422) (-358.289) [-359.889] (-360.508) -- 0:00:35
      426000 -- (-358.542) [-357.949] (-359.393) (-360.499) * [-357.435] (-358.050) (-359.364) (-360.023) -- 0:00:35
      426500 -- [-358.537] (-357.446) (-361.679) (-357.309) * [-358.077] (-359.638) (-356.666) (-358.836) -- 0:00:34
      427000 -- (-356.896) [-358.710] (-363.700) (-358.015) * (-360.266) (-362.638) (-358.010) [-362.802] -- 0:00:34
      427500 -- (-356.571) [-357.705] (-358.578) (-359.704) * (-362.041) (-359.273) [-359.258] (-358.785) -- 0:00:34
      428000 -- (-357.797) (-357.326) [-359.901] (-356.985) * (-357.100) (-360.320) [-357.154] (-360.988) -- 0:00:34
      428500 -- (-357.293) [-359.002] (-357.173) (-357.223) * (-360.207) (-357.636) (-358.883) [-358.068] -- 0:00:34
      429000 -- (-361.723) (-359.266) (-359.220) [-358.716] * (-360.489) [-357.283] (-356.591) (-357.177) -- 0:00:34
      429500 -- (-358.408) (-357.207) (-358.492) [-360.318] * (-360.741) [-356.803] (-357.117) (-357.613) -- 0:00:34
      430000 -- (-358.785) [-361.176] (-359.962) (-359.228) * (-361.708) (-359.729) (-356.814) [-356.608] -- 0:00:34

      Average standard deviation of split frequencies: 0.013067

      430500 -- (-359.804) (-357.471) (-359.669) [-357.295] * (-360.111) (-359.416) (-358.023) [-356.938] -- 0:00:34
      431000 -- (-356.907) (-356.977) (-357.058) [-357.475] * (-359.013) [-356.232] (-357.258) (-359.157) -- 0:00:34
      431500 -- (-356.933) (-358.847) (-356.688) [-360.321] * (-358.847) (-358.523) [-358.153] (-356.739) -- 0:00:34
      432000 -- (-361.105) (-358.340) [-356.383] (-357.613) * (-358.233) (-361.869) [-358.555] (-357.207) -- 0:00:34
      432500 -- (-359.532) (-365.819) [-356.583] (-357.885) * (-357.966) (-360.301) [-357.602] (-360.173) -- 0:00:34
      433000 -- (-359.060) (-356.405) [-358.561] (-356.557) * (-356.968) (-358.213) (-362.396) [-356.175] -- 0:00:34
      433500 -- (-361.501) [-357.951] (-357.436) (-356.573) * (-361.582) (-359.220) (-363.008) [-358.749] -- 0:00:33
      434000 -- (-357.533) (-358.701) [-362.261] (-357.539) * (-359.543) (-359.692) (-360.301) [-356.572] -- 0:00:33
      434500 -- [-358.630] (-357.510) (-360.156) (-356.586) * (-357.360) (-361.418) [-358.192] (-359.488) -- 0:00:33
      435000 -- (-360.509) (-359.943) [-359.747] (-357.099) * [-357.276] (-360.922) (-360.193) (-357.560) -- 0:00:33

      Average standard deviation of split frequencies: 0.012569

      435500 -- (-357.323) (-361.753) (-358.386) [-359.561] * (-359.701) [-358.178] (-359.233) (-358.728) -- 0:00:33
      436000 -- (-359.385) (-357.927) (-358.379) [-358.176] * (-357.570) (-360.164) [-356.380] (-359.192) -- 0:00:33
      436500 -- (-358.005) (-360.100) (-357.458) [-359.263] * (-356.931) [-357.052] (-356.438) (-358.145) -- 0:00:33
      437000 -- (-360.175) (-357.898) [-358.055] (-359.632) * (-358.347) (-360.356) [-357.277] (-364.005) -- 0:00:33
      437500 -- (-357.065) [-357.077] (-357.034) (-359.609) * (-361.093) (-359.855) [-356.846] (-356.960) -- 0:00:33
      438000 -- (-359.087) (-356.232) (-361.987) [-358.790] * (-358.428) [-357.735] (-358.582) (-360.973) -- 0:00:33
      438500 -- (-356.907) (-357.603) (-361.848) [-358.906] * (-356.726) [-358.761] (-358.912) (-357.093) -- 0:00:33
      439000 -- (-362.158) (-358.122) [-358.854] (-358.132) * (-357.026) [-358.051] (-357.903) (-358.960) -- 0:00:33
      439500 -- (-362.731) (-357.186) [-358.216] (-357.032) * (-358.916) (-358.885) (-360.221) [-357.259] -- 0:00:33
      440000 -- (-356.998) (-357.016) (-357.223) [-356.566] * (-357.236) (-358.172) [-356.158] (-358.988) -- 0:00:33

      Average standard deviation of split frequencies: 0.012338

      440500 -- (-358.845) (-357.395) (-361.756) [-357.235] * (-358.506) (-357.527) [-360.058] (-357.306) -- 0:00:33
      441000 -- (-356.795) [-359.048] (-360.562) (-360.482) * (-358.595) [-360.578] (-356.338) (-358.792) -- 0:00:32
      441500 -- (-358.337) [-356.171] (-357.797) (-356.276) * [-357.663] (-359.586) (-358.021) (-360.477) -- 0:00:32
      442000 -- (-362.717) (-357.103) [-357.952] (-363.126) * [-358.684] (-359.497) (-356.623) (-358.105) -- 0:00:32
      442500 -- (-359.703) (-356.974) [-359.523] (-359.714) * (-358.393) (-357.245) [-357.573] (-356.901) -- 0:00:32
      443000 -- (-360.213) (-356.107) (-357.897) [-360.124] * (-358.430) [-356.205] (-357.576) (-362.730) -- 0:00:33
      443500 -- (-359.240) [-356.659] (-357.328) (-360.134) * [-356.970] (-357.431) (-359.982) (-357.163) -- 0:00:33
      444000 -- (-359.587) (-358.579) [-359.268] (-357.651) * (-362.667) [-358.736] (-358.904) (-357.688) -- 0:00:33
      444500 -- (-356.279) (-361.295) (-357.917) [-359.489] * (-357.887) (-361.235) (-358.784) [-357.028] -- 0:00:33
      445000 -- (-357.180) [-359.199] (-359.017) (-359.583) * [-356.024] (-359.483) (-357.084) (-357.789) -- 0:00:33

      Average standard deviation of split frequencies: 0.011891

      445500 -- (-360.001) [-357.840] (-356.420) (-362.542) * (-357.610) (-359.611) (-356.748) [-357.224] -- 0:00:33
      446000 -- (-360.115) [-357.788] (-356.546) (-357.933) * (-360.888) [-356.352] (-358.992) (-357.115) -- 0:00:33
      446500 -- (-357.656) (-360.591) [-356.313] (-356.817) * (-356.687) (-359.778) (-362.203) [-356.428] -- 0:00:33
      447000 -- (-357.720) (-357.667) [-357.304] (-358.344) * (-357.691) (-358.255) [-363.327] (-360.643) -- 0:00:33
      447500 -- [-358.975] (-359.767) (-358.553) (-358.839) * (-359.719) [-359.649] (-359.052) (-361.505) -- 0:00:33
      448000 -- (-359.169) [-358.142] (-357.326) (-361.333) * (-357.976) (-359.788) [-356.548] (-358.995) -- 0:00:33
      448500 -- (-360.070) (-358.905) [-360.274] (-360.797) * (-358.186) (-359.461) (-356.093) [-359.319] -- 0:00:33
      449000 -- (-357.661) [-358.649] (-360.001) (-360.431) * (-358.949) (-359.320) [-356.818] (-358.271) -- 0:00:33
      449500 -- (-364.194) [-356.089] (-359.523) (-358.093) * (-360.177) (-358.198) (-359.564) [-357.756] -- 0:00:33
      450000 -- (-362.702) [-359.870] (-361.324) (-357.375) * (-358.715) [-357.923] (-357.795) (-358.505) -- 0:00:33

      Average standard deviation of split frequencies: 0.011637

      450500 -- (-356.113) [-358.926] (-358.125) (-358.153) * [-358.963] (-360.968) (-358.353) (-359.135) -- 0:00:32
      451000 -- (-358.110) [-358.512] (-358.009) (-358.683) * [-358.094] (-357.020) (-357.346) (-356.597) -- 0:00:32
      451500 -- (-360.078) (-359.661) [-358.035] (-361.666) * [-356.601] (-359.141) (-358.537) (-359.512) -- 0:00:32
      452000 -- (-360.693) (-356.991) (-359.143) [-358.191] * (-356.491) (-357.634) (-356.909) [-358.371] -- 0:00:32
      452500 -- (-361.671) (-357.567) (-359.819) [-359.524] * (-360.341) [-358.027] (-358.820) (-358.853) -- 0:00:32
      453000 -- (-361.135) (-359.780) (-360.600) [-359.180] * (-360.940) (-357.917) (-359.125) [-359.295] -- 0:00:32
      453500 -- (-363.692) (-357.046) [-358.519] (-356.158) * (-361.918) [-362.240] (-358.141) (-361.074) -- 0:00:32
      454000 -- [-358.667] (-359.248) (-358.764) (-364.498) * [-360.716] (-361.469) (-361.604) (-360.595) -- 0:00:32
      454500 -- [-358.919] (-357.632) (-356.717) (-365.523) * (-357.338) (-358.471) [-358.206] (-358.657) -- 0:00:32
      455000 -- (-362.075) (-357.047) [-357.476] (-357.785) * (-357.122) [-357.330] (-359.904) (-358.479) -- 0:00:32

      Average standard deviation of split frequencies: 0.012018

      455500 -- (-359.591) (-358.570) (-357.271) [-359.121] * [-356.447] (-358.318) (-357.490) (-363.543) -- 0:00:32
      456000 -- (-356.087) (-359.074) [-358.243] (-358.456) * (-356.827) (-360.441) (-359.635) [-357.675] -- 0:00:32
      456500 -- (-358.639) (-362.152) (-358.513) [-359.077] * (-359.615) (-357.521) [-360.492] (-358.023) -- 0:00:32
      457000 -- (-359.051) (-360.649) (-356.766) [-357.699] * (-361.587) (-359.258) [-356.638] (-359.781) -- 0:00:32
      457500 -- (-356.671) (-362.717) (-359.420) [-357.684] * [-356.721] (-358.054) (-360.847) (-357.777) -- 0:00:32
      458000 -- [-359.051] (-361.297) (-357.827) (-356.505) * (-359.493) (-360.493) (-356.404) [-357.005] -- 0:00:31
      458500 -- (-358.395) (-358.415) (-359.683) [-357.423] * (-356.333) (-360.706) [-358.999] (-356.830) -- 0:00:31
      459000 -- (-360.920) (-358.103) (-360.456) [-356.292] * (-359.941) [-358.985] (-357.877) (-360.204) -- 0:00:31
      459500 -- (-359.237) (-358.597) (-357.654) [-357.198] * (-357.715) [-358.340] (-361.038) (-359.990) -- 0:00:31
      460000 -- (-357.716) (-358.460) (-359.154) [-358.580] * (-358.187) (-356.931) [-362.344] (-358.566) -- 0:00:32

      Average standard deviation of split frequencies: 0.012088

      460500 -- (-357.328) (-357.126) [-357.816] (-357.478) * (-359.677) (-358.828) [-358.894] (-358.665) -- 0:00:32
      461000 -- [-360.471] (-359.134) (-358.732) (-358.741) * (-358.330) [-356.946] (-358.148) (-357.006) -- 0:00:32
      461500 -- [-359.948] (-357.920) (-359.169) (-357.369) * (-357.165) (-361.198) [-359.494] (-357.378) -- 0:00:32
      462000 -- [-356.785] (-358.342) (-358.023) (-356.781) * (-358.591) (-363.471) (-360.514) [-359.746] -- 0:00:32
      462500 -- (-360.868) (-361.474) [-357.623] (-357.113) * (-357.804) [-358.258] (-359.066) (-360.901) -- 0:00:32
      463000 -- [-358.455] (-356.787) (-356.991) (-359.643) * [-360.277] (-357.060) (-359.597) (-357.780) -- 0:00:32
      463500 -- (-359.004) [-357.266] (-359.200) (-358.362) * (-358.394) (-356.578) (-359.354) [-357.372] -- 0:00:32
      464000 -- [-358.829] (-356.448) (-358.513) (-359.593) * (-356.891) [-357.593] (-363.344) (-356.643) -- 0:00:32
      464500 -- (-356.281) (-358.634) (-358.148) [-360.117] * [-356.657] (-363.220) (-358.717) (-356.899) -- 0:00:32
      465000 -- (-356.310) (-359.066) (-356.768) [-357.752] * (-359.334) (-359.653) (-357.143) [-357.203] -- 0:00:32

      Average standard deviation of split frequencies: 0.012455

      465500 -- [-358.141] (-358.583) (-357.367) (-358.447) * (-359.392) (-362.771) [-357.231] (-357.127) -- 0:00:32
      466000 -- (-356.451) (-359.559) (-359.765) [-358.463] * (-358.600) (-362.879) [-359.136] (-356.684) -- 0:00:32
      466500 -- (-358.971) (-360.499) [-358.421] (-360.796) * (-358.134) (-357.962) (-362.048) [-359.121] -- 0:00:32
      467000 -- (-357.351) (-356.882) (-357.005) [-357.182] * (-358.523) (-356.865) [-358.378] (-364.245) -- 0:00:31
      467500 -- [-357.299] (-356.434) (-357.893) (-358.880) * (-358.687) (-357.622) (-356.185) [-356.436] -- 0:00:31
      468000 -- (-358.897) (-357.349) [-355.974] (-359.154) * (-361.040) (-361.724) [-358.423] (-362.147) -- 0:00:31
      468500 -- [-359.808] (-357.049) (-356.347) (-358.189) * [-357.807] (-359.563) (-357.362) (-357.824) -- 0:00:31
      469000 -- [-358.388] (-358.280) (-356.688) (-358.224) * (-357.032) (-359.779) (-362.779) [-357.673] -- 0:00:31
      469500 -- (-356.839) (-360.932) (-359.467) [-358.197] * (-358.248) (-361.562) (-360.333) [-360.582] -- 0:00:31
      470000 -- (-358.869) [-357.487] (-357.360) (-356.998) * (-363.634) [-359.734] (-359.543) (-358.703) -- 0:00:31

      Average standard deviation of split frequencies: 0.012820

      470500 -- [-361.663] (-357.631) (-357.865) (-358.939) * (-360.162) (-359.891) [-357.243] (-357.372) -- 0:00:31
      471000 -- (-358.195) [-359.737] (-357.544) (-360.591) * (-357.546) (-359.649) (-356.920) [-356.656] -- 0:00:31
      471500 -- (-356.848) (-358.507) (-358.389) [-358.094] * [-360.083] (-357.063) (-358.803) (-356.832) -- 0:00:31
      472000 -- (-360.201) (-358.721) [-357.276] (-359.274) * (-358.444) (-356.581) [-360.328] (-359.761) -- 0:00:31
      472500 -- (-357.861) (-356.750) [-357.558] (-368.465) * (-357.086) (-358.226) [-358.262] (-358.578) -- 0:00:31
      473000 -- (-358.929) [-357.475] (-358.514) (-358.584) * (-356.208) (-358.134) [-358.668] (-357.336) -- 0:00:31
      473500 -- (-360.672) (-357.424) [-359.752] (-356.173) * (-357.055) (-358.267) (-359.240) [-359.137] -- 0:00:31
      474000 -- [-358.038] (-361.898) (-357.211) (-359.139) * (-357.710) (-356.019) (-358.501) [-359.126] -- 0:00:31
      474500 -- (-358.641) (-360.318) (-356.938) [-356.897] * (-356.830) (-357.743) [-358.964] (-366.309) -- 0:00:31
      475000 -- (-361.817) [-361.070] (-359.277) (-358.688) * (-357.555) (-357.593) (-357.500) [-358.147] -- 0:00:30

      Average standard deviation of split frequencies: 0.012676

      475500 -- (-357.617) (-359.634) [-360.232] (-357.297) * [-357.508] (-358.344) (-362.012) (-360.731) -- 0:00:30
      476000 -- [-359.890] (-358.308) (-359.101) (-358.265) * (-358.415) (-359.857) (-357.529) [-360.111] -- 0:00:30
      476500 -- [-357.191] (-359.847) (-358.708) (-359.771) * [-358.111] (-358.283) (-362.681) (-356.470) -- 0:00:30
      477000 -- [-356.699] (-358.575) (-359.367) (-357.131) * (-356.729) (-359.265) [-362.324] (-356.860) -- 0:00:30
      477500 -- (-356.740) (-358.736) (-362.930) [-356.590] * (-358.949) (-357.739) (-357.541) [-357.916] -- 0:00:31
      478000 -- [-357.611] (-360.976) (-359.123) (-356.318) * (-365.152) [-358.375] (-358.290) (-359.368) -- 0:00:31
      478500 -- [-359.682] (-357.215) (-360.186) (-357.380) * (-359.737) [-358.449] (-357.056) (-358.227) -- 0:00:31
      479000 -- (-357.791) (-357.866) (-357.466) [-360.502] * (-360.194) [-358.442] (-356.960) (-356.501) -- 0:00:31
      479500 -- (-357.827) (-357.988) [-358.214] (-359.063) * (-357.564) [-358.608] (-360.436) (-359.642) -- 0:00:31
      480000 -- [-357.124] (-359.997) (-361.644) (-358.557) * (-358.886) (-360.939) (-358.462) [-359.857] -- 0:00:31

      Average standard deviation of split frequencies: 0.012946

      480500 -- (-357.853) (-357.121) (-359.424) [-358.757] * [-359.344] (-360.249) (-360.946) (-356.662) -- 0:00:31
      481000 -- (-361.105) (-361.365) (-361.608) [-359.607] * [-360.830] (-359.812) (-363.558) (-359.008) -- 0:00:31
      481500 -- [-362.706] (-362.012) (-358.886) (-359.148) * (-359.730) (-356.861) (-362.501) [-358.082] -- 0:00:31
      482000 -- (-358.721) (-360.931) (-357.447) [-357.280] * (-358.774) [-357.052] (-357.301) (-357.295) -- 0:00:31
      482500 -- (-357.552) (-359.904) (-359.384) [-356.282] * (-357.941) (-358.373) (-357.327) [-357.513] -- 0:00:31
      483000 -- (-357.767) (-360.946) [-358.370] (-356.225) * (-358.926) [-357.160] (-358.158) (-360.312) -- 0:00:31
      483500 -- (-357.921) [-361.740] (-358.300) (-357.414) * [-356.537] (-356.684) (-357.280) (-358.730) -- 0:00:30
      484000 -- [-359.356] (-358.119) (-357.226) (-361.295) * (-358.569) (-357.466) (-358.154) [-356.812] -- 0:00:30
      484500 -- (-357.883) [-357.621] (-356.504) (-359.808) * (-357.821) (-357.339) [-355.962] (-357.145) -- 0:00:30
      485000 -- [-358.845] (-357.032) (-356.674) (-357.982) * (-356.927) [-356.861] (-357.516) (-356.634) -- 0:00:30

      Average standard deviation of split frequencies: 0.013192

      485500 -- (-359.170) (-359.482) (-358.479) [-357.335] * (-357.035) [-356.665] (-358.535) (-359.527) -- 0:00:30
      486000 -- (-358.692) (-356.764) [-357.582] (-358.014) * [-356.474] (-361.579) (-356.960) (-360.146) -- 0:00:30
      486500 -- (-359.190) (-360.116) (-359.473) [-360.021] * (-356.562) (-359.305) (-357.732) [-357.176] -- 0:00:30
      487000 -- (-362.241) (-362.397) (-358.679) [-360.890] * (-356.379) (-363.462) (-358.738) [-358.404] -- 0:00:30
      487500 -- (-359.158) (-357.399) [-363.740] (-357.600) * (-362.052) [-357.491] (-359.496) (-360.056) -- 0:00:30
      488000 -- [-356.633] (-359.293) (-360.668) (-358.805) * (-361.925) (-359.882) [-358.421] (-359.517) -- 0:00:30
      488500 -- (-357.200) (-358.366) (-358.007) [-359.011] * [-356.545] (-359.038) (-357.434) (-358.802) -- 0:00:30
      489000 -- [-360.727] (-358.609) (-358.589) (-359.533) * (-356.622) [-359.999] (-358.131) (-358.868) -- 0:00:30
      489500 -- (-358.718) [-359.698] (-357.091) (-359.647) * (-358.195) (-358.476) (-361.546) [-357.830] -- 0:00:30
      490000 -- (-359.090) [-356.224] (-357.477) (-358.602) * (-356.603) [-359.404] (-356.881) (-358.017) -- 0:00:30

      Average standard deviation of split frequencies: 0.012426

      490500 -- (-359.006) (-358.086) (-362.130) [-358.730] * (-356.586) [-358.836] (-357.942) (-356.740) -- 0:00:30
      491000 -- (-359.617) (-359.653) (-358.699) [-357.087] * (-356.882) [-357.663] (-359.044) (-359.586) -- 0:00:30
      491500 -- [-362.965] (-356.194) (-358.865) (-360.681) * (-356.813) (-356.039) [-357.378] (-365.117) -- 0:00:30
      492000 -- (-357.998) (-356.896) (-361.551) [-359.367] * (-357.472) (-360.588) [-357.653] (-362.075) -- 0:00:29
      492500 -- [-356.443] (-357.452) (-360.578) (-359.260) * [-357.452] (-359.433) (-358.865) (-359.919) -- 0:00:30
      493000 -- (-359.818) (-357.103) (-356.793) [-359.366] * [-357.568] (-357.114) (-359.145) (-358.083) -- 0:00:30
      493500 -- (-359.234) (-357.658) (-359.341) [-357.942] * (-361.575) [-358.795] (-362.809) (-359.404) -- 0:00:30
      494000 -- [-360.335] (-359.735) (-360.832) (-357.220) * [-357.366] (-359.458) (-358.603) (-357.089) -- 0:00:30
      494500 -- [-357.312] (-360.761) (-358.615) (-356.465) * (-358.387) (-359.908) (-363.426) [-357.332] -- 0:00:30
      495000 -- (-358.296) [-357.562] (-359.015) (-358.897) * (-359.548) [-358.652] (-361.970) (-358.785) -- 0:00:30

      Average standard deviation of split frequencies: 0.012058

      495500 -- [-358.798] (-356.549) (-356.663) (-364.523) * (-361.366) (-359.912) (-359.628) [-357.068] -- 0:00:30
      496000 -- (-361.152) [-357.973] (-357.588) (-359.746) * (-357.574) [-356.712] (-359.975) (-358.671) -- 0:00:30
      496500 -- (-359.237) (-360.527) [-358.779] (-359.767) * (-360.565) [-362.992] (-357.225) (-356.817) -- 0:00:30
      497000 -- (-356.869) [-359.619] (-360.079) (-360.352) * (-357.971) [-358.012] (-357.578) (-357.830) -- 0:00:30
      497500 -- (-358.878) [-358.756] (-357.743) (-359.378) * (-360.053) (-358.051) [-364.939] (-356.324) -- 0:00:30
      498000 -- (-358.862) (-360.231) [-357.279] (-357.615) * (-361.132) (-357.329) (-357.895) [-358.160] -- 0:00:30
      498500 -- [-359.138] (-361.548) (-357.231) (-357.874) * (-357.885) (-358.250) (-364.318) [-359.352] -- 0:00:30
      499000 -- (-357.943) (-357.722) (-358.145) [-357.341] * (-356.724) (-359.212) (-357.643) [-360.000] -- 0:00:30
      499500 -- [-358.721] (-359.041) (-358.657) (-357.857) * (-357.455) (-357.276) (-358.738) [-357.706] -- 0:00:30
      500000 -- (-358.357) [-358.590] (-365.030) (-358.085) * (-359.565) [-357.456] (-358.853) (-358.217) -- 0:00:30

      Average standard deviation of split frequencies: 0.012554

      500500 -- (-358.184) [-357.054] (-357.188) (-358.991) * (-357.850) (-359.914) [-361.374] (-363.487) -- 0:00:29
      501000 -- [-356.516] (-358.481) (-359.669) (-356.710) * (-357.888) (-356.990) (-356.502) [-357.597] -- 0:00:29
      501500 -- [-356.136] (-361.601) (-358.834) (-357.249) * (-358.097) (-360.354) [-357.037] (-360.353) -- 0:00:29
      502000 -- (-357.126) [-358.847] (-360.923) (-358.290) * (-361.306) (-359.968) [-360.745] (-357.872) -- 0:00:29
      502500 -- [-357.645] (-357.233) (-358.716) (-357.326) * (-360.349) (-362.319) [-361.010] (-357.117) -- 0:00:29
      503000 -- (-359.935) [-358.996] (-358.092) (-362.140) * (-358.419) (-357.741) [-360.701] (-361.825) -- 0:00:29
      503500 -- (-359.151) (-358.184) (-358.344) [-358.327] * (-358.082) (-358.374) (-361.201) [-359.531] -- 0:00:29
      504000 -- (-358.740) (-359.791) (-359.665) [-360.134] * (-360.034) (-357.872) [-358.304] (-356.402) -- 0:00:29
      504500 -- (-361.807) [-358.787] (-364.533) (-360.718) * (-356.800) (-357.535) [-357.076] (-360.757) -- 0:00:29
      505000 -- (-360.439) [-359.064] (-357.104) (-357.993) * (-361.576) [-360.629] (-356.877) (-357.139) -- 0:00:29

      Average standard deviation of split frequencies: 0.012461

      505500 -- (-360.883) [-357.049] (-358.437) (-357.739) * (-366.031) (-361.418) (-356.386) [-358.525] -- 0:00:29
      506000 -- (-357.687) [-358.432] (-358.336) (-357.431) * (-357.388) (-363.803) [-360.336] (-357.538) -- 0:00:29
      506500 -- [-356.692] (-358.263) (-356.639) (-359.323) * [-364.364] (-366.373) (-356.911) (-357.300) -- 0:00:29
      507000 -- (-358.458) [-355.870] (-356.904) (-357.238) * [-364.673] (-358.500) (-361.984) (-357.957) -- 0:00:29
      507500 -- (-360.859) (-356.019) (-365.828) [-356.384] * (-360.633) (-357.311) (-361.407) [-357.371] -- 0:00:29
      508000 -- (-357.372) [-356.428] (-360.402) (-356.098) * (-362.892) [-358.541] (-360.212) (-357.782) -- 0:00:29
      508500 -- (-359.387) (-358.464) (-357.319) [-357.893] * (-360.957) (-356.776) [-359.649] (-358.167) -- 0:00:28
      509000 -- (-356.675) (-358.372) (-358.717) [-359.939] * (-361.422) (-357.478) [-359.668] (-357.671) -- 0:00:28
      509500 -- (-357.280) (-357.624) (-357.716) [-356.942] * (-362.200) (-357.798) (-358.143) [-361.596] -- 0:00:29
      510000 -- (-358.961) (-357.133) (-357.307) [-357.527] * (-356.631) (-361.241) [-356.725] (-358.457) -- 0:00:29

      Average standard deviation of split frequencies: 0.012751

      510500 -- (-357.638) [-359.008] (-357.764) (-358.273) * (-358.014) (-359.849) (-358.348) [-358.930] -- 0:00:29
      511000 -- (-357.452) (-358.463) [-357.759] (-359.682) * (-360.585) [-359.113] (-357.885) (-356.907) -- 0:00:29
      511500 -- [-357.558] (-358.688) (-356.945) (-360.118) * [-358.518] (-357.537) (-358.446) (-362.291) -- 0:00:29
      512000 -- (-357.082) (-359.841) [-360.871] (-358.506) * (-358.840) [-357.900] (-356.283) (-361.532) -- 0:00:29
      512500 -- (-359.883) (-356.752) (-358.966) [-359.446] * (-358.686) (-360.964) (-357.952) [-359.347] -- 0:00:29
      513000 -- (-357.691) [-357.182] (-360.671) (-357.622) * (-359.958) [-358.061] (-358.177) (-358.393) -- 0:00:29
      513500 -- [-357.440] (-357.589) (-362.476) (-359.349) * [-359.175] (-359.432) (-359.864) (-357.582) -- 0:00:29
      514000 -- (-360.472) (-356.999) [-358.508] (-361.743) * [-357.351] (-357.988) (-357.659) (-364.852) -- 0:00:29
      514500 -- (-360.987) (-357.176) (-358.927) [-360.914] * [-361.439] (-358.958) (-364.751) (-356.493) -- 0:00:29
      515000 -- (-357.408) [-357.734] (-361.489) (-358.069) * (-359.481) [-357.588] (-359.436) (-357.277) -- 0:00:29

      Average standard deviation of split frequencies: 0.012790

      515500 -- (-356.868) (-362.490) [-360.138] (-356.093) * (-360.408) [-357.183] (-357.460) (-358.601) -- 0:00:29
      516000 -- (-359.475) (-363.433) (-358.679) [-356.751] * (-357.223) (-357.909) [-358.560] (-357.788) -- 0:00:29
      516500 -- (-356.294) (-360.297) [-356.344] (-360.401) * [-357.118] (-358.156) (-356.954) (-358.408) -- 0:00:29
      517000 -- (-362.259) (-357.236) [-358.563] (-357.622) * (-357.434) (-357.680) [-358.119] (-362.317) -- 0:00:28
      517500 -- (-360.018) [-356.277] (-358.023) (-357.244) * (-358.939) (-358.429) [-358.239] (-361.421) -- 0:00:28
      518000 -- (-357.367) [-359.430] (-357.571) (-356.929) * (-358.830) (-360.224) [-359.182] (-367.929) -- 0:00:28
      518500 -- (-363.833) (-357.640) (-359.440) [-358.410] * [-358.109] (-359.536) (-361.654) (-362.524) -- 0:00:28
      519000 -- (-357.947) [-358.455] (-356.733) (-357.787) * (-356.701) (-357.636) [-357.862] (-357.075) -- 0:00:28
      519500 -- [-356.441] (-359.095) (-357.014) (-358.714) * (-357.867) [-357.764] (-363.193) (-359.344) -- 0:00:28
      520000 -- (-356.712) (-356.956) (-358.197) [-358.541] * [-356.273] (-356.676) (-359.685) (-359.459) -- 0:00:28

      Average standard deviation of split frequencies: 0.012845

      520500 -- (-358.990) [-358.848] (-357.537) (-358.781) * [-358.335] (-357.690) (-359.010) (-360.227) -- 0:00:28
      521000 -- (-358.408) [-356.710] (-362.138) (-362.566) * (-359.358) (-358.331) [-363.603] (-359.221) -- 0:00:28
      521500 -- (-357.052) (-356.901) [-357.969] (-357.726) * (-357.298) (-357.064) [-358.406] (-358.999) -- 0:00:28
      522000 -- (-356.313) (-356.573) [-360.262] (-358.070) * [-357.443] (-358.534) (-360.296) (-357.767) -- 0:00:28
      522500 -- (-357.260) (-358.656) [-359.064] (-358.883) * (-360.861) (-357.153) [-359.358] (-357.796) -- 0:00:28
      523000 -- (-357.260) (-360.389) [-357.496] (-358.270) * (-360.355) (-357.528) (-359.514) [-358.823] -- 0:00:28
      523500 -- [-356.935] (-357.741) (-358.168) (-359.986) * (-360.726) [-357.283] (-357.065) (-357.895) -- 0:00:28
      524000 -- (-358.275) (-356.876) (-359.266) [-359.494] * [-358.096] (-361.881) (-359.383) (-358.132) -- 0:00:28
      524500 -- [-357.312] (-358.324) (-359.081) (-357.759) * (-364.431) (-359.410) [-356.487] (-358.640) -- 0:00:28
      525000 -- (-361.483) [-356.575] (-362.288) (-358.446) * (-357.786) [-361.030] (-356.391) (-356.701) -- 0:00:28

      Average standard deviation of split frequencies: 0.013163

      525500 -- (-365.078) [-360.099] (-355.993) (-357.377) * (-357.564) (-360.162) (-357.503) [-358.729] -- 0:00:27
      526000 -- (-359.552) (-360.437) (-362.429) [-359.961] * (-356.958) [-358.544] (-358.131) (-358.183) -- 0:00:27
      526500 -- (-360.507) [-357.198] (-359.374) (-360.007) * (-358.169) (-357.756) (-360.798) [-360.438] -- 0:00:28
      527000 -- (-357.287) [-357.504] (-360.119) (-357.280) * (-357.406) [-359.816] (-361.467) (-357.419) -- 0:00:28
      527500 -- (-360.305) [-361.678] (-358.994) (-357.194) * (-362.998) (-358.056) (-362.100) [-358.747] -- 0:00:28
      528000 -- (-358.978) [-358.321] (-359.192) (-356.285) * [-357.957] (-357.846) (-358.688) (-357.368) -- 0:00:28
      528500 -- (-356.387) [-359.052] (-360.308) (-358.317) * (-358.772) (-357.160) (-359.544) [-356.864] -- 0:00:28
      529000 -- [-358.021] (-359.916) (-360.417) (-356.085) * (-357.697) [-359.869] (-358.029) (-358.100) -- 0:00:28
      529500 -- (-358.338) (-359.194) [-358.532] (-356.573) * [-363.158] (-357.553) (-360.727) (-356.521) -- 0:00:28
      530000 -- (-356.726) (-361.191) (-356.639) [-357.241] * (-360.949) [-356.694] (-361.539) (-359.321) -- 0:00:28

      Average standard deviation of split frequencies: 0.013103

      530500 -- (-357.271) (-358.652) [-356.827] (-357.705) * [-359.709] (-356.702) (-356.141) (-360.987) -- 0:00:28
      531000 -- [-358.834] (-358.045) (-357.724) (-362.510) * (-357.731) [-356.470] (-356.693) (-357.811) -- 0:00:28
      531500 -- (-360.363) (-357.113) [-357.142] (-360.134) * (-358.031) [-356.402] (-357.852) (-359.129) -- 0:00:28
      532000 -- (-359.515) (-357.838) [-358.294] (-358.169) * [-356.545] (-356.996) (-360.821) (-360.887) -- 0:00:28
      532500 -- (-358.878) (-357.012) [-358.226] (-358.545) * (-358.407) [-359.345] (-356.819) (-360.718) -- 0:00:28
      533000 -- (-357.282) (-360.807) [-359.620] (-358.381) * [-359.133] (-358.367) (-357.624) (-359.679) -- 0:00:28
      533500 -- (-359.791) (-366.816) [-358.686] (-357.643) * [-357.772] (-362.565) (-358.672) (-357.081) -- 0:00:27
      534000 -- [-360.800] (-361.505) (-357.361) (-356.876) * [-357.165] (-357.998) (-358.300) (-362.265) -- 0:00:27
      534500 -- (-357.733) [-356.726] (-357.057) (-357.185) * [-360.196] (-357.239) (-357.700) (-359.898) -- 0:00:27
      535000 -- (-358.036) (-356.880) (-363.739) [-357.690] * (-361.777) (-360.023) [-358.142] (-359.432) -- 0:00:27

      Average standard deviation of split frequencies: 0.012753

      535500 -- (-358.638) (-357.466) (-361.028) [-360.232] * (-359.231) (-357.786) [-358.193] (-361.459) -- 0:00:27
      536000 -- (-357.040) [-359.156] (-358.617) (-362.092) * (-360.111) [-358.325] (-356.308) (-357.628) -- 0:00:27
      536500 -- (-356.746) (-357.349) [-357.197] (-358.099) * (-356.612) (-357.487) [-358.329] (-356.972) -- 0:00:27
      537000 -- (-356.912) (-359.492) (-357.858) [-358.918] * (-357.433) (-357.756) [-359.319] (-358.713) -- 0:00:27
      537500 -- (-356.365) [-358.699] (-362.369) (-360.265) * [-357.857] (-357.543) (-360.046) (-357.659) -- 0:00:27
      538000 -- (-356.489) [-358.281] (-356.753) (-358.515) * (-357.866) [-359.334] (-363.914) (-357.392) -- 0:00:27
      538500 -- [-356.194] (-356.998) (-358.015) (-357.010) * (-357.537) (-359.402) [-358.046] (-356.728) -- 0:00:27
      539000 -- [-356.196] (-358.742) (-359.567) (-359.396) * (-359.934) (-360.342) (-358.945) [-357.050] -- 0:00:27
      539500 -- [-357.516] (-357.227) (-357.304) (-360.867) * (-357.987) (-359.520) (-357.090) [-357.382] -- 0:00:27
      540000 -- (-356.532) (-356.778) [-357.621] (-356.880) * [-358.551] (-358.306) (-356.711) (-365.170) -- 0:00:27

      Average standard deviation of split frequencies: 0.013078

      540500 -- (-356.592) [-359.706] (-359.594) (-360.827) * [-359.246] (-358.475) (-357.543) (-363.113) -- 0:00:27
      541000 -- [-357.186] (-358.074) (-358.393) (-356.485) * [-359.288] (-356.970) (-362.377) (-362.348) -- 0:00:27
      541500 -- [-358.634] (-356.545) (-360.789) (-357.354) * (-357.677) (-357.854) [-358.823] (-359.345) -- 0:00:27
      542000 -- (-358.913) (-357.060) [-362.582] (-364.673) * (-357.025) (-361.816) (-355.918) [-359.868] -- 0:00:27
      542500 -- (-358.443) (-358.696) [-359.559] (-359.412) * (-357.000) (-360.507) [-356.850] (-357.458) -- 0:00:26
      543000 -- (-356.516) [-359.264] (-358.080) (-360.525) * [-356.369] (-362.594) (-356.292) (-356.980) -- 0:00:26
      543500 -- [-359.108] (-359.741) (-357.695) (-360.531) * (-357.518) [-357.173] (-357.732) (-356.073) -- 0:00:27
      544000 -- (-356.875) (-358.608) (-358.407) [-360.756] * [-359.230] (-360.443) (-361.318) (-358.069) -- 0:00:27
      544500 -- (-357.877) (-360.073) (-360.094) [-359.230] * (-357.278) (-361.837) [-360.151] (-360.004) -- 0:00:27
      545000 -- (-359.981) [-357.934] (-357.243) (-360.472) * (-360.569) [-360.678] (-356.801) (-358.177) -- 0:00:27

      Average standard deviation of split frequencies: 0.013490

      545500 -- (-356.394) [-357.318] (-358.192) (-357.207) * (-358.628) (-358.203) (-357.814) [-357.384] -- 0:00:27
      546000 -- (-356.086) (-357.494) (-359.098) [-357.573] * (-358.454) (-360.297) (-358.443) [-359.042] -- 0:00:27
      546500 -- (-363.357) (-357.770) (-359.305) [-357.988] * (-357.135) (-357.530) (-357.274) [-357.395] -- 0:00:27
      547000 -- (-356.506) (-361.741) [-357.331] (-356.763) * [-359.817] (-359.087) (-357.756) (-356.756) -- 0:00:27
      547500 -- (-357.526) (-363.740) [-357.684] (-357.364) * (-366.445) [-357.621] (-357.756) (-361.664) -- 0:00:27
      548000 -- [-356.958] (-359.751) (-358.475) (-359.845) * [-357.236] (-358.944) (-358.057) (-360.309) -- 0:00:27
      548500 -- (-359.376) [-360.719] (-360.884) (-358.222) * (-358.456) (-357.990) (-356.893) [-358.579] -- 0:00:27
      549000 -- (-359.186) (-362.079) [-359.253] (-367.768) * (-359.430) [-357.768] (-358.420) (-359.721) -- 0:00:27
      549500 -- [-358.383] (-357.494) (-359.318) (-364.057) * (-360.264) (-357.553) [-357.236] (-360.713) -- 0:00:27
      550000 -- (-358.769) [-356.718] (-358.978) (-359.129) * (-362.811) (-357.347) (-358.101) [-358.481] -- 0:00:27

      Average standard deviation of split frequencies: 0.013697

      550500 -- [-356.916] (-356.856) (-357.612) (-360.972) * (-360.529) (-357.772) (-358.332) [-359.438] -- 0:00:26
      551000 -- (-357.077) (-358.313) [-358.465] (-357.897) * (-359.925) (-358.763) [-357.087] (-362.207) -- 0:00:26
      551500 -- [-358.899] (-358.854) (-358.338) (-358.852) * (-361.917) (-360.271) (-358.778) [-357.748] -- 0:00:26
      552000 -- [-359.097] (-357.250) (-356.368) (-363.370) * (-361.636) (-359.406) [-358.814] (-356.599) -- 0:00:26
      552500 -- (-358.998) (-357.585) [-358.359] (-357.951) * (-364.801) (-355.942) (-359.714) [-357.697] -- 0:00:26
      553000 -- [-359.285] (-357.085) (-357.988) (-364.140) * (-359.937) (-356.642) (-360.919) [-357.123] -- 0:00:26
      553500 -- (-358.101) (-356.392) (-357.531) [-360.258] * (-362.464) (-357.262) [-357.915] (-358.048) -- 0:00:26
      554000 -- (-361.340) (-359.132) (-359.927) [-356.930] * (-358.660) [-360.050] (-357.733) (-359.607) -- 0:00:26
      554500 -- (-359.464) (-358.627) [-357.910] (-356.804) * (-359.961) [-359.763] (-359.826) (-360.407) -- 0:00:26
      555000 -- [-358.417] (-358.222) (-357.093) (-357.273) * (-356.593) (-357.898) (-356.936) [-359.296] -- 0:00:26

      Average standard deviation of split frequencies: 0.012718

      555500 -- (-358.948) [-359.785] (-356.342) (-359.322) * (-360.764) [-357.915] (-359.172) (-358.261) -- 0:00:26
      556000 -- (-356.781) (-363.698) [-357.006] (-360.441) * (-364.578) (-357.587) (-358.966) [-357.510] -- 0:00:26
      556500 -- [-356.646] (-358.359) (-356.607) (-358.967) * (-358.118) (-357.802) (-358.331) [-358.769] -- 0:00:26
      557000 -- (-359.799) (-361.981) [-356.446] (-357.850) * (-356.983) (-358.908) [-359.467] (-360.048) -- 0:00:26
      557500 -- (-357.511) (-359.723) [-359.967] (-361.912) * (-358.707) [-359.870] (-360.271) (-358.838) -- 0:00:26
      558000 -- [-361.044] (-359.970) (-358.444) (-356.895) * (-356.137) (-360.026) (-358.024) [-358.929] -- 0:00:26
      558500 -- (-361.012) [-359.027] (-358.810) (-361.232) * (-358.397) [-356.004] (-356.820) (-356.675) -- 0:00:26
      559000 -- [-358.956] (-357.118) (-358.027) (-357.118) * (-357.512) [-357.196] (-357.441) (-359.223) -- 0:00:26
      559500 -- (-357.815) (-359.696) (-357.369) [-358.220] * (-356.256) (-358.907) (-358.050) [-358.983] -- 0:00:25
      560000 -- (-357.183) (-361.667) [-361.607] (-361.309) * [-358.559] (-359.870) (-359.196) (-355.942) -- 0:00:25

      Average standard deviation of split frequencies: 0.012875

      560500 -- [-357.114] (-358.409) (-355.962) (-357.696) * [-357.217] (-357.686) (-358.368) (-356.465) -- 0:00:26
      561000 -- [-358.060] (-358.561) (-359.128) (-358.794) * (-359.345) [-359.984] (-357.309) (-363.406) -- 0:00:26
      561500 -- (-360.121) [-360.712] (-356.743) (-358.408) * [-358.270] (-359.324) (-357.738) (-357.204) -- 0:00:26
      562000 -- [-359.165] (-358.495) (-357.368) (-359.024) * [-358.253] (-357.359) (-359.694) (-357.049) -- 0:00:26
      562500 -- (-357.534) (-359.060) (-357.744) [-359.171] * [-357.469] (-360.436) (-362.006) (-356.323) -- 0:00:26
      563000 -- [-356.518] (-363.213) (-359.049) (-359.384) * (-359.768) (-358.853) (-358.434) [-359.318] -- 0:00:26
      563500 -- (-358.909) (-364.795) [-359.702] (-357.298) * (-359.222) (-359.401) [-356.744] (-359.595) -- 0:00:26
      564000 -- (-357.250) (-357.206) (-359.301) [-357.823] * (-356.152) (-356.677) [-361.897] (-356.807) -- 0:00:26
      564500 -- (-358.875) [-357.753] (-358.506) (-357.698) * [-358.477] (-359.607) (-357.771) (-358.099) -- 0:00:26
      565000 -- [-359.320] (-358.723) (-361.123) (-359.430) * (-358.949) [-357.456] (-357.113) (-359.045) -- 0:00:26

      Average standard deviation of split frequencies: 0.013375

      565500 -- (-357.511) (-359.649) (-358.705) [-360.792] * (-358.795) [-357.096] (-358.968) (-356.428) -- 0:00:26
      566000 -- (-357.556) (-357.323) [-357.120] (-362.772) * (-357.405) [-357.333] (-359.286) (-356.611) -- 0:00:26
      566500 -- [-356.807] (-358.008) (-358.544) (-357.889) * (-357.134) (-356.879) (-359.169) [-356.513] -- 0:00:26
      567000 -- (-357.751) (-359.844) [-356.516] (-359.085) * (-356.364) (-357.995) [-358.814] (-358.599) -- 0:00:25
      567500 -- [-357.279] (-357.975) (-360.602) (-359.999) * [-357.705] (-357.267) (-362.243) (-364.752) -- 0:00:25
      568000 -- [-356.841] (-357.044) (-357.528) (-356.284) * (-358.091) [-356.917] (-357.262) (-358.731) -- 0:00:25
      568500 -- (-357.110) (-356.945) [-360.721] (-359.365) * (-357.644) (-360.861) (-361.228) [-357.385] -- 0:00:25
      569000 -- (-356.259) (-356.758) (-358.401) [-358.230] * (-360.477) (-357.175) [-359.382] (-358.860) -- 0:00:25
      569500 -- (-356.888) (-356.617) (-360.111) [-358.700] * [-359.578] (-357.783) (-356.799) (-360.201) -- 0:00:25
      570000 -- (-358.039) [-358.752] (-359.038) (-356.378) * (-358.614) (-356.593) [-356.468] (-370.427) -- 0:00:25

      Average standard deviation of split frequencies: 0.012907

      570500 -- (-360.309) (-358.796) (-357.709) [-356.628] * (-359.212) [-357.350] (-360.346) (-357.555) -- 0:00:25
      571000 -- [-358.008] (-359.981) (-359.089) (-360.216) * (-356.303) (-358.739) [-359.081] (-358.132) -- 0:00:25
      571500 -- (-361.686) [-357.475] (-359.602) (-356.880) * (-356.657) [-360.874] (-359.416) (-359.602) -- 0:00:25
      572000 -- (-358.841) (-360.979) (-359.883) [-356.075] * (-357.328) (-360.319) [-359.276] (-357.302) -- 0:00:25
      572500 -- (-359.030) (-359.615) [-356.301] (-357.100) * (-359.590) (-357.455) [-359.188] (-357.581) -- 0:00:25
      573000 -- (-357.633) (-357.425) (-358.767) [-357.972] * (-361.276) (-361.976) (-358.001) [-356.909] -- 0:00:25
      573500 -- (-358.094) (-357.303) [-357.735] (-361.213) * (-356.394) (-358.942) (-359.098) [-359.303] -- 0:00:25
      574000 -- [-361.449] (-361.341) (-359.379) (-360.193) * [-360.134] (-357.430) (-357.580) (-356.636) -- 0:00:25
      574500 -- [-357.429] (-359.300) (-368.590) (-356.958) * (-359.899) (-358.312) (-358.941) [-356.258] -- 0:00:25
      575000 -- (-358.479) [-357.620] (-362.619) (-357.330) * (-361.402) (-356.323) [-358.427] (-362.303) -- 0:00:25

      Average standard deviation of split frequencies: 0.012440

      575500 -- [-359.817] (-360.148) (-358.782) (-356.705) * (-360.354) (-356.495) [-356.379] (-356.286) -- 0:00:25
      576000 -- (-359.262) (-361.486) [-357.661] (-356.917) * (-359.725) (-358.216) [-356.616] (-357.278) -- 0:00:25
      576500 -- (-358.794) (-359.894) [-356.912] (-359.265) * (-359.366) [-357.941] (-358.900) (-358.346) -- 0:00:24
      577000 -- (-358.281) (-358.698) [-357.532] (-361.671) * (-359.164) [-358.501] (-357.408) (-357.278) -- 0:00:24
      577500 -- (-356.756) [-356.729] (-359.880) (-359.329) * (-357.765) [-357.223] (-356.825) (-358.140) -- 0:00:25
      578000 -- (-358.413) (-356.778) [-356.976] (-359.120) * (-358.722) (-360.362) (-356.816) [-359.382] -- 0:00:25
      578500 -- (-358.478) (-357.173) [-356.848] (-357.473) * (-357.210) (-359.562) (-358.131) [-357.252] -- 0:00:25
      579000 -- (-359.805) (-358.673) (-357.102) [-357.149] * [-359.482] (-358.194) (-361.266) (-365.011) -- 0:00:25
      579500 -- (-360.473) (-357.733) [-359.415] (-357.060) * (-356.957) [-356.409] (-357.874) (-364.943) -- 0:00:25
      580000 -- [-357.226] (-361.449) (-361.961) (-357.623) * [-357.303] (-356.763) (-361.846) (-358.004) -- 0:00:25

      Average standard deviation of split frequencies: 0.012177

      580500 -- (-357.256) [-359.223] (-363.367) (-357.968) * (-359.496) (-357.671) (-358.511) [-357.668] -- 0:00:25
      581000 -- (-357.793) (-358.093) (-361.264) [-358.256] * (-359.016) (-361.867) [-359.335] (-358.711) -- 0:00:25
      581500 -- (-361.938) [-356.721] (-356.348) (-359.271) * [-357.594] (-357.114) (-358.456) (-360.767) -- 0:00:25
      582000 -- (-357.595) (-360.821) [-357.131] (-358.262) * (-359.079) (-358.453) [-358.623] (-366.050) -- 0:00:25
      582500 -- (-359.195) (-358.203) (-357.380) [-360.269] * (-357.943) (-361.087) (-359.587) [-364.419] -- 0:00:25
      583000 -- (-358.257) (-358.061) [-356.894] (-357.218) * (-357.158) [-356.090] (-360.440) (-359.718) -- 0:00:25
      583500 -- (-357.885) (-358.662) [-357.624] (-359.369) * (-359.518) (-360.498) (-356.960) [-357.112] -- 0:00:24
      584000 -- (-356.938) (-358.109) [-359.079] (-361.236) * (-362.161) [-359.012] (-361.370) (-358.011) -- 0:00:24
      584500 -- (-357.224) (-359.497) (-357.041) [-358.116] * [-358.361] (-357.772) (-357.807) (-357.772) -- 0:00:24
      585000 -- (-358.758) (-357.165) [-358.982] (-356.649) * (-358.725) [-356.429] (-357.853) (-357.967) -- 0:00:24

      Average standard deviation of split frequencies: 0.012218

      585500 -- [-357.634] (-357.557) (-358.367) (-357.573) * (-360.739) (-356.711) [-356.760] (-357.641) -- 0:00:24
      586000 -- [-356.704] (-357.811) (-357.499) (-356.205) * (-359.014) (-356.890) [-357.950] (-356.016) -- 0:00:24
      586500 -- (-359.676) (-358.183) (-357.262) [-356.412] * [-357.896] (-358.901) (-358.050) (-361.690) -- 0:00:24
      587000 -- (-357.280) (-357.716) [-358.117] (-358.558) * (-357.799) [-357.160] (-362.735) (-357.650) -- 0:00:24
      587500 -- (-360.259) (-358.201) (-358.043) [-356.501] * (-358.800) (-357.487) [-359.725] (-360.034) -- 0:00:24
      588000 -- (-359.179) (-359.935) [-360.310] (-357.586) * [-357.683] (-358.271) (-359.657) (-357.202) -- 0:00:24
      588500 -- (-361.453) [-360.845] (-358.505) (-356.634) * (-358.302) (-359.161) (-359.275) [-358.576] -- 0:00:24
      589000 -- (-359.374) (-362.005) [-358.400] (-356.422) * (-358.042) (-360.910) (-357.596) [-357.644] -- 0:00:24
      589500 -- (-358.598) (-361.466) (-358.932) [-356.356] * (-360.912) (-366.069) [-357.753] (-359.108) -- 0:00:24
      590000 -- (-357.621) [-358.348] (-359.222) (-361.264) * [-359.538] (-357.761) (-359.183) (-358.991) -- 0:00:24

      Average standard deviation of split frequencies: 0.012869

      590500 -- (-361.334) (-360.487) [-362.122] (-358.248) * [-360.656] (-359.480) (-357.931) (-357.856) -- 0:00:24
      591000 -- [-357.757] (-359.587) (-358.590) (-360.406) * (-357.447) (-359.694) [-356.934] (-362.391) -- 0:00:24
      591500 -- (-358.313) (-356.779) [-358.538] (-357.348) * (-357.554) (-359.938) [-356.360] (-358.380) -- 0:00:24
      592000 -- (-357.561) (-358.193) (-359.256) [-360.256] * (-360.768) (-358.974) [-358.613] (-357.759) -- 0:00:24
      592500 -- (-359.285) [-359.961] (-361.524) (-357.486) * (-359.207) (-357.441) [-358.304] (-357.162) -- 0:00:24
      593000 -- (-359.667) (-356.702) [-357.520] (-357.482) * [-357.808] (-363.131) (-358.886) (-358.528) -- 0:00:24
      593500 -- (-358.138) [-358.084] (-357.760) (-357.715) * (-359.669) [-362.070] (-357.892) (-357.632) -- 0:00:23
      594000 -- (-356.943) (-361.369) (-359.541) [-361.004] * (-360.797) [-361.256] (-356.751) (-357.915) -- 0:00:23
      594500 -- (-357.279) (-357.734) [-358.376] (-365.997) * [-357.610] (-357.262) (-362.605) (-359.941) -- 0:00:24
      595000 -- [-358.218] (-362.100) (-359.061) (-359.696) * [-357.049] (-357.954) (-359.857) (-361.344) -- 0:00:24

      Average standard deviation of split frequencies: 0.012606

      595500 -- (-361.867) (-358.212) [-356.853] (-360.413) * (-358.512) [-357.505] (-358.821) (-360.827) -- 0:00:24
      596000 -- (-360.038) [-360.017] (-358.441) (-357.977) * (-357.534) (-357.924) (-356.713) [-357.988] -- 0:00:24
      596500 -- (-366.668) (-358.657) (-358.161) [-358.670] * [-357.999] (-360.620) (-358.183) (-358.277) -- 0:00:24
      597000 -- [-359.947] (-356.776) (-360.827) (-357.998) * (-358.340) [-360.642] (-358.715) (-356.851) -- 0:00:24
      597500 -- (-358.262) [-357.389] (-360.603) (-359.137) * [-359.393] (-356.967) (-358.198) (-359.669) -- 0:00:24
      598000 -- (-356.356) (-359.393) (-357.728) [-357.718] * [-357.609] (-358.899) (-359.992) (-357.027) -- 0:00:24
      598500 -- (-360.024) [-356.765] (-359.597) (-359.199) * (-359.281) (-361.821) (-357.348) [-361.677] -- 0:00:24
      599000 -- (-363.733) [-356.973] (-358.040) (-358.186) * [-357.329] (-356.391) (-357.594) (-364.825) -- 0:00:24
      599500 -- (-358.467) (-361.506) [-359.333] (-356.805) * (-360.072) [-356.948] (-359.349) (-359.440) -- 0:00:24
      600000 -- (-358.257) (-360.054) [-358.266] (-358.014) * [-359.938] (-358.585) (-358.144) (-357.648) -- 0:00:24

      Average standard deviation of split frequencies: 0.012851

      600500 -- [-359.267] (-359.723) (-356.392) (-359.601) * (-358.429) [-358.099] (-358.651) (-364.031) -- 0:00:23
      601000 -- (-358.506) (-356.940) [-366.498] (-358.535) * (-362.019) (-358.936) (-358.016) [-357.628] -- 0:00:23
      601500 -- [-358.371] (-357.368) (-358.804) (-357.935) * [-357.490] (-356.676) (-359.454) (-361.023) -- 0:00:23
      602000 -- (-356.481) (-361.522) (-357.378) [-360.258] * (-360.963) (-358.705) [-358.292] (-359.744) -- 0:00:23
      602500 -- (-356.722) [-357.088] (-358.563) (-360.352) * (-362.524) (-357.736) [-357.736] (-357.827) -- 0:00:23
      603000 -- (-356.556) [-358.319] (-356.856) (-359.379) * (-358.580) (-362.042) [-360.147] (-358.345) -- 0:00:23
      603500 -- (-357.407) (-362.375) (-358.860) [-358.866] * (-357.656) [-357.616] (-359.097) (-362.188) -- 0:00:23
      604000 -- (-358.532) [-357.266] (-360.296) (-357.066) * (-365.724) (-358.253) [-359.500] (-358.905) -- 0:00:23
      604500 -- (-357.423) (-358.134) (-359.682) [-358.928] * (-358.127) (-356.634) [-357.577] (-358.006) -- 0:00:23
      605000 -- (-357.583) (-359.972) (-361.334) [-359.311] * (-359.146) (-360.322) (-361.478) [-360.235] -- 0:00:23

      Average standard deviation of split frequencies: 0.012300

      605500 -- (-359.834) (-358.026) [-358.125] (-358.370) * (-358.626) (-356.265) (-357.698) [-362.778] -- 0:00:23
      606000 -- [-359.141] (-357.003) (-358.902) (-357.329) * (-358.355) (-361.661) [-356.784] (-356.911) -- 0:00:23
      606500 -- (-358.097) (-360.086) [-359.468] (-360.000) * (-357.776) (-360.017) (-358.447) [-357.493] -- 0:00:23
      607000 -- (-360.010) [-357.271] (-356.482) (-362.121) * [-361.786] (-358.697) (-356.337) (-356.506) -- 0:00:23
      607500 -- (-358.167) (-358.237) (-359.753) [-363.017] * (-360.368) (-360.249) [-357.711] (-358.987) -- 0:00:23
      608000 -- (-358.974) [-359.139] (-359.546) (-357.176) * (-359.091) (-359.674) (-356.775) [-356.674] -- 0:00:23
      608500 -- (-357.826) (-357.486) [-361.284] (-358.075) * [-357.083] (-358.917) (-357.397) (-357.273) -- 0:00:23
      609000 -- (-358.635) (-356.057) (-360.527) [-358.886] * (-361.310) [-357.358] (-359.050) (-356.771) -- 0:00:23
      609500 -- (-359.631) (-359.093) (-357.762) [-358.089] * (-356.431) [-359.913] (-357.512) (-356.880) -- 0:00:23
      610000 -- [-356.603] (-357.471) (-356.999) (-357.886) * (-360.165) [-357.496] (-358.650) (-360.551) -- 0:00:23

      Average standard deviation of split frequencies: 0.010904

      610500 -- [-356.910] (-359.396) (-361.080) (-360.193) * (-357.640) (-359.980) [-356.956] (-357.087) -- 0:00:22
      611000 -- (-358.653) [-357.479] (-359.357) (-357.769) * (-356.907) (-359.463) (-357.227) [-356.788] -- 0:00:23
      611500 -- (-359.185) (-357.365) (-358.863) [-359.252] * [-358.447] (-356.549) (-357.504) (-356.941) -- 0:00:23
      612000 -- (-361.320) (-360.807) (-358.609) [-357.504] * (-360.198) (-358.167) [-362.194] (-360.035) -- 0:00:23
      612500 -- (-359.548) (-360.699) [-356.866] (-360.748) * (-358.559) (-359.967) (-359.094) [-356.664] -- 0:00:23
      613000 -- [-359.484] (-358.604) (-357.153) (-358.456) * (-358.810) (-358.413) [-363.373] (-358.164) -- 0:00:23
      613500 -- (-357.089) (-359.292) (-358.785) [-359.331] * (-360.635) (-356.972) (-356.793) [-357.460] -- 0:00:23
      614000 -- (-357.377) (-361.941) (-359.713) [-358.021] * (-357.818) (-361.034) [-357.841] (-359.421) -- 0:00:23
      614500 -- (-358.744) [-358.786] (-359.036) (-362.765) * [-357.241] (-359.546) (-358.233) (-360.293) -- 0:00:23
      615000 -- (-357.904) (-360.861) (-360.802) [-358.623] * (-357.532) (-363.691) [-358.493] (-361.005) -- 0:00:23

      Average standard deviation of split frequencies: 0.010522

      615500 -- (-358.658) (-358.156) [-356.970] (-357.113) * [-357.580] (-359.894) (-358.689) (-363.707) -- 0:00:23
      616000 -- (-357.476) (-360.387) (-361.797) [-357.965] * (-358.173) (-360.244) [-356.096] (-360.697) -- 0:00:23
      616500 -- [-357.508] (-360.718) (-362.181) (-361.274) * (-362.011) (-359.781) (-357.649) [-360.883] -- 0:00:23
      617000 -- (-357.114) [-359.455] (-359.157) (-357.201) * (-359.997) (-358.846) (-356.590) [-358.430] -- 0:00:22
      617500 -- (-357.439) (-361.164) (-360.155) [-358.378] * (-361.149) (-360.608) [-359.054] (-357.914) -- 0:00:22
      618000 -- [-357.468] (-359.130) (-359.961) (-360.530) * (-358.406) [-362.310] (-360.199) (-361.013) -- 0:00:22
      618500 -- (-363.899) (-365.733) (-359.353) [-358.036] * (-361.810) (-356.891) [-359.098] (-357.568) -- 0:00:22
      619000 -- (-357.660) (-357.443) (-356.920) [-357.495] * (-357.007) [-359.265] (-357.312) (-361.188) -- 0:00:22
      619500 -- (-358.226) (-367.084) (-361.184) [-357.950] * [-358.054] (-360.143) (-357.778) (-361.889) -- 0:00:22
      620000 -- (-357.756) (-359.283) (-358.763) [-357.629] * (-359.315) [-358.216] (-359.944) (-359.029) -- 0:00:22

      Average standard deviation of split frequencies: 0.010111

      620500 -- (-357.527) [-357.636] (-358.113) (-356.903) * (-358.505) (-359.545) (-357.209) [-357.038] -- 0:00:22
      621000 -- [-356.623] (-360.013) (-359.142) (-356.920) * (-357.109) (-359.244) (-358.349) [-356.914] -- 0:00:22
      621500 -- (-357.641) (-358.121) (-358.621) [-357.215] * (-358.882) (-361.397) [-359.416] (-360.549) -- 0:00:22
      622000 -- (-361.107) [-357.262] (-357.974) (-358.311) * (-361.765) (-360.360) (-362.580) [-358.081] -- 0:00:22
      622500 -- (-357.083) (-358.614) [-357.909] (-356.795) * [-357.773] (-356.819) (-358.979) (-356.873) -- 0:00:22
      623000 -- (-357.319) [-359.403] (-358.893) (-358.098) * [-359.107] (-358.268) (-360.621) (-359.612) -- 0:00:22
      623500 -- [-362.769] (-360.170) (-362.054) (-362.287) * (-359.244) [-358.409] (-360.649) (-358.955) -- 0:00:22
      624000 -- (-361.794) [-359.467] (-360.628) (-358.801) * (-356.947) (-356.840) (-359.806) [-357.870] -- 0:00:22
      624500 -- (-357.715) [-357.644] (-359.901) (-357.194) * (-359.591) [-357.872] (-360.590) (-358.454) -- 0:00:22
      625000 -- (-358.163) (-357.540) (-359.384) [-358.549] * (-356.212) (-357.790) (-357.879) [-358.979] -- 0:00:22

      Average standard deviation of split frequencies: 0.010260

      625500 -- (-360.707) (-359.381) (-357.099) [-357.203] * (-357.104) (-356.594) (-357.690) [-357.594] -- 0:00:22
      626000 -- [-358.268] (-358.242) (-356.692) (-357.299) * (-359.063) [-357.557] (-359.561) (-357.071) -- 0:00:22
      626500 -- (-356.891) [-358.613] (-358.416) (-357.291) * (-358.727) (-359.262) [-359.156] (-357.693) -- 0:00:22
      627000 -- (-358.099) (-356.808) [-358.472] (-360.970) * [-358.053] (-356.339) (-359.766) (-356.783) -- 0:00:22
      627500 -- [-357.903] (-357.274) (-359.705) (-357.141) * (-358.526) (-364.686) (-363.557) [-357.294] -- 0:00:21
      628000 -- (-359.561) (-356.636) (-362.737) [-357.083] * (-358.003) [-356.775] (-363.556) (-356.645) -- 0:00:21
      628500 -- (-356.612) (-357.592) (-358.083) [-357.768] * (-358.102) (-360.407) [-357.741] (-357.576) -- 0:00:22
      629000 -- [-358.487] (-358.952) (-359.227) (-357.907) * [-356.835] (-356.202) (-359.326) (-358.309) -- 0:00:22
      629500 -- (-357.216) (-359.003) (-357.097) [-360.805] * (-358.208) (-357.066) [-356.611] (-364.276) -- 0:00:22
      630000 -- [-357.755] (-360.643) (-358.347) (-360.383) * (-357.004) (-357.222) (-360.175) [-358.335] -- 0:00:22

      Average standard deviation of split frequencies: 0.010166

      630500 -- [-358.072] (-360.826) (-357.019) (-356.686) * [-358.812] (-359.075) (-356.376) (-356.727) -- 0:00:22
      631000 -- (-358.040) (-356.946) (-357.566) [-357.035] * (-358.444) (-358.167) (-357.588) [-358.442] -- 0:00:22
      631500 -- [-360.688] (-359.268) (-359.595) (-356.889) * (-358.251) (-357.611) (-357.154) [-356.776] -- 0:00:22
      632000 -- (-359.057) [-357.903] (-364.428) (-357.241) * (-357.648) (-360.016) (-360.053) [-357.096] -- 0:00:22
      632500 -- (-356.937) (-357.017) (-356.295) [-358.470] * (-357.644) (-362.660) [-358.992] (-360.195) -- 0:00:22
      633000 -- (-357.666) [-358.080] (-359.418) (-358.342) * [-356.993] (-359.440) (-359.673) (-358.514) -- 0:00:22
      633500 -- (-357.694) (-360.149) [-363.014] (-360.705) * (-357.173) (-357.794) [-359.799] (-358.560) -- 0:00:21
      634000 -- (-358.183) [-359.633] (-357.836) (-359.004) * [-357.157] (-358.065) (-357.574) (-358.956) -- 0:00:21
      634500 -- (-357.194) (-359.402) [-357.897] (-359.187) * [-356.657] (-361.955) (-357.280) (-356.245) -- 0:00:21
      635000 -- (-358.922) [-358.230] (-358.959) (-357.672) * [-356.708] (-359.535) (-357.037) (-358.167) -- 0:00:21

      Average standard deviation of split frequencies: 0.009883

      635500 -- (-357.088) (-361.638) [-358.294] (-356.770) * [-358.158] (-356.904) (-358.820) (-357.795) -- 0:00:21
      636000 -- (-359.393) (-359.184) [-357.520] (-359.893) * (-358.979) [-358.343] (-358.490) (-357.375) -- 0:00:21
      636500 -- (-357.165) [-357.686] (-358.531) (-357.922) * (-357.245) (-357.507) (-359.300) [-358.466] -- 0:00:21
      637000 -- [-360.219] (-358.626) (-356.709) (-358.893) * (-359.297) (-356.843) [-359.000] (-358.279) -- 0:00:21
      637500 -- (-360.972) (-359.617) (-358.855) [-356.981] * (-361.437) (-361.181) (-357.857) [-357.330] -- 0:00:21
      638000 -- (-361.337) (-360.047) (-360.070) [-358.132] * (-362.464) [-357.295] (-357.641) (-358.246) -- 0:00:21
      638500 -- (-360.065) (-360.636) [-357.534] (-360.335) * [-361.860] (-359.165) (-356.053) (-364.160) -- 0:00:21
      639000 -- (-358.317) (-360.453) [-357.751] (-358.197) * (-362.181) [-359.328] (-357.014) (-361.136) -- 0:00:21
      639500 -- [-358.299] (-366.353) (-358.114) (-358.356) * (-358.640) [-356.217] (-359.498) (-358.358) -- 0:00:21
      640000 -- (-357.740) (-360.498) [-358.201] (-358.834) * (-356.476) [-356.777] (-361.178) (-357.743) -- 0:00:21

      Average standard deviation of split frequencies: 0.009762

      640500 -- (-359.938) (-357.294) (-362.761) [-358.740] * [-357.874] (-359.042) (-358.334) (-361.401) -- 0:00:21
      641000 -- (-357.234) (-357.755) [-359.000] (-359.640) * (-358.752) (-358.985) [-356.745] (-361.499) -- 0:00:21
      641500 -- (-357.213) (-357.846) [-358.448] (-357.350) * (-359.655) [-357.965] (-357.314) (-358.000) -- 0:00:21
      642000 -- (-356.871) [-359.433] (-358.663) (-358.603) * (-360.000) [-357.214] (-357.809) (-364.703) -- 0:00:21
      642500 -- (-357.456) [-357.232] (-361.136) (-357.379) * (-364.328) (-356.846) (-360.621) [-357.306] -- 0:00:21
      643000 -- (-358.612) (-359.730) [-360.816] (-357.843) * (-359.328) (-359.476) (-358.117) [-356.417] -- 0:00:21
      643500 -- (-358.454) [-359.322] (-356.727) (-356.862) * [-357.204] (-357.679) (-356.267) (-360.831) -- 0:00:21
      644000 -- (-361.173) [-357.584] (-357.353) (-356.760) * (-356.496) (-358.430) (-361.023) [-360.072] -- 0:00:21
      644500 -- (-359.310) (-361.403) (-357.662) [-358.841] * (-356.956) (-357.834) [-357.316] (-359.513) -- 0:00:20
      645000 -- (-359.297) (-358.709) [-359.084] (-357.615) * (-358.072) (-360.922) [-356.823] (-357.731) -- 0:00:20

      Average standard deviation of split frequencies: 0.009778

      645500 -- [-357.711] (-358.802) (-358.588) (-359.650) * [-356.498] (-359.979) (-358.071) (-358.915) -- 0:00:21
      646000 -- (-357.884) (-356.906) (-358.866) [-361.704] * (-357.895) (-358.036) (-357.946) [-356.803] -- 0:00:21
      646500 -- (-357.480) [-358.634] (-357.769) (-357.714) * (-363.808) (-357.892) [-358.008] (-357.461) -- 0:00:21
      647000 -- (-359.423) (-362.615) (-356.339) [-358.153] * [-359.014] (-356.308) (-359.705) (-357.696) -- 0:00:21
      647500 -- [-356.981] (-362.499) (-357.062) (-359.367) * (-363.767) [-357.170] (-358.833) (-359.100) -- 0:00:21
      648000 -- (-360.013) [-356.819] (-357.022) (-358.090) * (-358.349) [-357.443] (-367.284) (-357.476) -- 0:00:21
      648500 -- [-359.750] (-357.960) (-358.633) (-360.581) * [-359.388] (-359.215) (-365.772) (-357.101) -- 0:00:21
      649000 -- (-356.696) [-358.201] (-357.440) (-364.646) * (-356.954) (-359.425) (-362.740) [-356.761] -- 0:00:21
      649500 -- (-359.192) (-358.213) (-359.538) [-356.763] * (-357.070) (-357.392) (-360.850) [-356.691] -- 0:00:21
      650000 -- (-358.689) (-364.180) (-358.170) [-358.379] * (-360.244) (-358.057) [-359.476] (-362.932) -- 0:00:21

      Average standard deviation of split frequencies: 0.009612

      650500 -- (-360.457) (-364.407) (-365.433) [-358.859] * (-357.924) (-359.243) [-358.045] (-358.009) -- 0:00:20
      651000 -- [-356.823] (-357.491) (-363.877) (-357.980) * [-359.505] (-359.966) (-358.678) (-357.655) -- 0:00:20
      651500 -- (-357.705) (-358.833) (-363.032) [-358.178] * (-357.517) [-357.992] (-359.296) (-358.093) -- 0:00:20
      652000 -- (-360.248) [-358.070] (-364.554) (-358.580) * (-357.067) (-357.225) (-357.212) [-357.704] -- 0:00:20
      652500 -- (-357.524) (-362.446) [-359.241] (-358.156) * (-357.844) [-358.777] (-361.995) (-356.837) -- 0:00:20
      653000 -- (-361.916) (-356.709) [-359.095] (-363.221) * (-358.951) (-357.056) [-358.431] (-359.860) -- 0:00:20
      653500 -- [-357.909] (-357.239) (-358.391) (-360.340) * (-356.888) [-357.418] (-358.812) (-357.379) -- 0:00:20
      654000 -- (-355.989) [-356.592] (-359.384) (-357.203) * (-359.591) [-359.911] (-356.313) (-357.691) -- 0:00:20
      654500 -- (-359.555) (-359.769) (-361.749) [-357.983] * (-356.225) (-357.912) (-356.821) [-360.513] -- 0:00:20
      655000 -- (-357.198) (-360.541) (-361.493) [-358.446] * (-357.429) [-356.578] (-357.066) (-358.535) -- 0:00:20

      Average standard deviation of split frequencies: 0.009294

      655500 -- [-357.991] (-358.260) (-357.878) (-357.264) * (-356.447) [-358.241] (-356.831) (-357.212) -- 0:00:20
      656000 -- (-363.545) (-356.730) [-357.089] (-359.191) * [-356.887] (-357.976) (-358.319) (-356.850) -- 0:00:20
      656500 -- (-358.275) (-357.638) [-356.989] (-357.261) * (-358.722) [-357.894] (-358.585) (-357.910) -- 0:00:20
      657000 -- (-357.156) (-360.237) [-357.382] (-358.788) * [-357.716] (-356.462) (-356.757) (-360.048) -- 0:00:20
      657500 -- [-358.833] (-357.274) (-359.607) (-357.538) * (-356.327) [-359.612] (-356.904) (-356.769) -- 0:00:20
      658000 -- [-360.137] (-356.998) (-357.415) (-356.518) * (-358.427) [-359.406] (-357.403) (-357.640) -- 0:00:20
      658500 -- (-357.595) (-361.989) [-357.180] (-362.077) * (-366.536) (-359.862) (-358.528) [-359.062] -- 0:00:20
      659000 -- (-357.819) (-359.980) (-357.414) [-359.117] * (-358.961) (-360.973) [-356.460] (-359.124) -- 0:00:20
      659500 -- [-358.794] (-358.906) (-363.287) (-356.988) * [-360.564] (-360.116) (-357.950) (-359.411) -- 0:00:20
      660000 -- (-358.372) (-356.458) [-360.896] (-358.472) * (-357.049) (-362.680) [-356.693] (-357.715) -- 0:00:20

      Average standard deviation of split frequencies: 0.009704

      660500 -- [-359.340] (-356.749) (-362.313) (-357.619) * (-356.633) (-358.066) (-360.868) [-358.471] -- 0:00:20
      661000 -- (-357.806) (-359.015) [-359.591] (-359.857) * [-358.196] (-360.132) (-363.967) (-356.466) -- 0:00:20
      661500 -- (-358.478) (-357.980) [-356.659] (-359.371) * [-356.478] (-359.964) (-359.795) (-359.241) -- 0:00:19
      662000 -- [-361.316] (-359.445) (-356.359) (-360.779) * (-358.788) (-360.142) (-362.243) [-359.653] -- 0:00:20
      662500 -- (-356.813) (-356.747) [-363.444] (-358.363) * [-365.524] (-358.754) (-359.767) (-357.884) -- 0:00:20
      663000 -- (-357.393) [-357.232] (-358.685) (-357.451) * (-357.922) (-362.552) [-362.355] (-363.056) -- 0:00:20
      663500 -- (-358.589) (-357.346) [-358.364] (-356.817) * (-356.764) (-361.073) (-362.154) [-357.117] -- 0:00:20
      664000 -- (-356.529) (-360.723) (-359.253) [-356.991] * [-359.678] (-362.591) (-359.593) (-359.589) -- 0:00:20
      664500 -- (-357.512) (-358.722) [-357.196] (-359.231) * (-358.933) [-360.092] (-358.136) (-362.212) -- 0:00:20
      665000 -- (-356.839) (-356.759) (-358.881) [-356.871] * (-361.177) (-358.252) (-357.553) [-358.043] -- 0:00:20

      Average standard deviation of split frequencies: 0.009673

      665500 -- [-360.754] (-361.364) (-360.583) (-357.420) * (-357.521) (-357.370) (-362.438) [-357.989] -- 0:00:20
      666000 -- (-358.274) [-357.307] (-356.247) (-360.550) * (-357.075) (-359.508) [-356.893] (-356.650) -- 0:00:20
      666500 -- (-361.367) (-357.582) [-358.352] (-357.977) * (-361.489) (-361.438) [-359.015] (-359.242) -- 0:00:20
      667000 -- (-356.927) (-361.967) (-359.641) [-361.180] * (-360.665) (-360.268) (-356.513) [-361.850] -- 0:00:19
      667500 -- (-357.682) (-361.935) (-362.110) [-359.272] * (-360.941) (-356.531) (-358.804) [-356.767] -- 0:00:19
      668000 -- (-360.443) [-358.001] (-357.382) (-359.099) * [-357.404] (-357.691) (-359.897) (-360.364) -- 0:00:19
      668500 -- (-361.121) (-357.332) [-357.104] (-357.891) * (-356.737) [-357.127] (-358.817) (-358.994) -- 0:00:19
      669000 -- (-362.644) (-359.973) [-357.100] (-359.206) * (-356.367) (-358.891) [-360.337] (-358.630) -- 0:00:19
      669500 -- (-358.685) [-358.608] (-359.181) (-359.173) * [-358.831] (-360.319) (-359.367) (-357.990) -- 0:00:19
      670000 -- (-358.505) [-358.388] (-360.698) (-358.383) * (-357.251) (-358.115) (-356.403) [-357.961] -- 0:00:19

      Average standard deviation of split frequencies: 0.009419

      670500 -- (-363.022) (-357.346) [-359.649] (-357.632) * (-358.346) (-358.191) [-357.133] (-361.490) -- 0:00:19
      671000 -- (-359.096) [-357.819] (-360.712) (-359.219) * (-356.759) (-360.479) (-357.387) [-357.900] -- 0:00:19
      671500 -- (-359.923) (-357.667) [-357.675] (-356.821) * (-356.937) (-357.261) [-360.887] (-358.512) -- 0:00:19
      672000 -- (-357.415) (-361.023) (-358.365) [-357.595] * [-356.496] (-357.473) (-361.905) (-359.345) -- 0:00:19
      672500 -- (-356.545) [-356.651] (-358.589) (-357.572) * (-356.540) [-356.749] (-361.436) (-357.808) -- 0:00:19
      673000 -- (-360.210) (-360.531) [-359.107] (-358.095) * (-357.540) [-361.908] (-357.351) (-362.832) -- 0:00:19
      673500 -- [-359.045] (-358.049) (-360.657) (-357.512) * (-361.522) (-359.243) (-357.633) [-361.717] -- 0:00:19
      674000 -- (-359.768) (-358.188) [-357.042] (-358.472) * [-360.129] (-359.324) (-358.146) (-361.318) -- 0:00:19
      674500 -- (-356.888) (-363.599) [-356.721] (-359.207) * (-356.400) [-357.919] (-357.134) (-360.807) -- 0:00:19
      675000 -- (-356.429) (-357.738) (-355.986) [-356.532] * [-356.478] (-361.766) (-359.059) (-358.881) -- 0:00:19

      Average standard deviation of split frequencies: 0.009484

      675500 -- (-359.707) [-357.910] (-359.490) (-358.213) * (-357.505) (-360.313) [-358.796] (-358.329) -- 0:00:19
      676000 -- (-357.658) [-357.891] (-357.884) (-359.576) * (-357.689) [-358.229] (-360.574) (-359.500) -- 0:00:19
      676500 -- [-357.429] (-357.833) (-359.286) (-363.463) * (-361.906) [-356.308] (-359.605) (-359.226) -- 0:00:19
      677000 -- (-358.679) [-357.791] (-358.931) (-360.835) * (-357.619) [-359.161] (-357.321) (-359.709) -- 0:00:19
      677500 -- (-357.490) (-361.570) [-360.469] (-358.472) * [-358.681] (-359.930) (-358.908) (-356.775) -- 0:00:19
      678000 -- (-360.092) (-359.036) (-363.752) [-359.139] * (-358.759) (-359.811) (-360.136) [-360.397] -- 0:00:18
      678500 -- [-360.088] (-357.527) (-361.048) (-358.692) * (-359.214) (-357.221) (-361.999) [-360.850] -- 0:00:18
      679000 -- (-358.136) [-357.107] (-358.291) (-359.115) * (-357.547) (-359.648) [-356.657] (-362.054) -- 0:00:19
      679500 -- (-359.962) (-358.192) (-361.544) [-356.791] * (-356.448) (-358.051) [-356.634] (-360.402) -- 0:00:19
      680000 -- [-357.887] (-361.294) (-357.513) (-358.443) * [-357.456] (-360.417) (-356.287) (-358.965) -- 0:00:19

      Average standard deviation of split frequencies: 0.009188

      680500 -- (-356.957) [-358.269] (-358.013) (-359.633) * [-357.712] (-360.162) (-357.867) (-358.555) -- 0:00:19
      681000 -- [-356.891] (-358.652) (-356.372) (-362.650) * [-359.243] (-357.246) (-360.829) (-358.671) -- 0:00:19
      681500 -- (-358.489) (-357.617) (-358.183) [-358.459] * (-359.874) (-361.365) [-359.476] (-356.588) -- 0:00:19
      682000 -- [-360.656] (-356.139) (-360.371) (-359.453) * (-358.645) (-356.448) (-358.062) [-356.699] -- 0:00:19
      682500 -- (-357.822) (-356.982) [-360.573] (-358.633) * [-357.497] (-359.156) (-357.078) (-359.304) -- 0:00:19
      683000 -- (-357.390) (-357.581) (-357.829) [-356.922] * (-358.316) [-359.319] (-360.355) (-357.191) -- 0:00:19
      683500 -- (-359.185) [-357.952] (-359.181) (-358.494) * (-360.369) (-356.949) (-357.081) [-356.577] -- 0:00:18
      684000 -- (-357.145) (-358.275) (-357.638) [-357.061] * (-360.549) (-356.300) (-360.719) [-358.439] -- 0:00:18
      684500 -- (-357.178) (-360.446) (-359.544) [-358.645] * (-357.392) (-358.664) [-358.336] (-356.800) -- 0:00:18
      685000 -- (-360.084) (-356.732) [-358.571] (-360.417) * (-356.581) (-358.035) [-357.353] (-357.853) -- 0:00:18

      Average standard deviation of split frequencies: 0.009483

      685500 -- [-359.261] (-360.193) (-358.625) (-356.352) * (-356.540) (-357.865) [-357.172] (-358.400) -- 0:00:18
      686000 -- [-360.794] (-357.455) (-357.425) (-356.539) * [-358.458] (-358.222) (-356.737) (-356.734) -- 0:00:18
      686500 -- (-358.663) (-358.818) [-360.730] (-356.811) * [-361.445] (-356.243) (-358.691) (-358.455) -- 0:00:18
      687000 -- (-357.660) (-356.464) [-357.139] (-360.188) * (-356.501) (-356.298) [-360.608] (-357.771) -- 0:00:18
      687500 -- [-357.679] (-357.454) (-356.791) (-360.044) * (-357.977) (-356.140) (-360.820) [-359.824] -- 0:00:18
      688000 -- [-359.131] (-358.933) (-360.555) (-362.739) * (-356.797) [-356.798] (-358.484) (-364.191) -- 0:00:18
      688500 -- (-358.119) (-361.075) [-359.153] (-358.302) * [-356.411] (-358.405) (-359.226) (-360.495) -- 0:00:18
      689000 -- (-360.482) (-359.482) [-358.780] (-360.602) * [-355.999] (-358.962) (-357.192) (-360.409) -- 0:00:18
      689500 -- (-360.297) (-358.578) [-357.820] (-356.814) * (-357.070) [-361.029] (-356.577) (-359.985) -- 0:00:18
      690000 -- [-359.363] (-356.944) (-358.315) (-359.368) * (-357.194) (-362.931) [-359.583] (-359.491) -- 0:00:18

      Average standard deviation of split frequencies: 0.009692

      690500 -- (-357.314) (-358.111) (-360.399) [-357.861] * (-356.863) (-357.898) [-357.594] (-357.152) -- 0:00:18
      691000 -- (-357.646) (-358.066) (-357.167) [-357.020] * [-357.845] (-357.332) (-356.417) (-358.096) -- 0:00:18
      691500 -- (-364.419) (-359.186) (-358.188) [-356.985] * (-356.767) (-360.398) [-356.214] (-357.100) -- 0:00:18
      692000 -- (-364.854) [-356.893] (-357.755) (-360.777) * [-357.284] (-362.883) (-358.823) (-356.933) -- 0:00:18
      692500 -- [-359.783] (-356.935) (-356.896) (-359.520) * (-357.546) (-359.143) (-363.345) [-358.079] -- 0:00:18
      693000 -- [-357.129] (-359.241) (-357.082) (-356.547) * (-359.202) [-356.124] (-359.004) (-358.485) -- 0:00:18
      693500 -- (-358.716) (-356.331) [-356.571] (-357.438) * (-356.804) [-356.431] (-358.963) (-360.354) -- 0:00:18
      694000 -- (-358.588) (-358.137) (-357.093) [-357.530] * (-359.206) [-359.991] (-359.229) (-359.936) -- 0:00:18
      694500 -- (-356.448) [-357.596] (-362.797) (-358.387) * [-356.682] (-356.870) (-359.524) (-359.108) -- 0:00:18
      695000 -- (-358.458) (-362.048) [-357.768] (-365.730) * (-360.174) (-358.062) [-357.578] (-358.088) -- 0:00:17

      Average standard deviation of split frequencies: 0.009482

      695500 -- (-362.485) (-358.277) [-358.883] (-361.241) * [-358.372] (-359.248) (-360.966) (-358.315) -- 0:00:17
      696000 -- (-358.735) (-360.141) [-358.225] (-360.772) * (-357.883) (-360.555) [-356.982] (-356.663) -- 0:00:18
      696500 -- (-356.300) [-357.473] (-358.639) (-362.723) * [-356.268] (-362.797) (-356.575) (-356.402) -- 0:00:18
      697000 -- (-356.720) [-357.106] (-356.217) (-366.277) * (-358.468) (-362.729) [-360.522] (-361.055) -- 0:00:18
      697500 -- (-357.063) (-361.372) [-361.972] (-357.611) * (-357.842) (-359.947) (-365.870) [-356.798] -- 0:00:18
      698000 -- (-356.590) [-360.273] (-356.873) (-356.962) * (-357.485) (-357.977) (-360.074) [-357.257] -- 0:00:18
      698500 -- (-359.671) (-362.762) [-356.633] (-358.769) * (-358.638) [-359.432] (-358.875) (-358.983) -- 0:00:18
      699000 -- (-360.063) (-362.767) (-360.506) [-360.698] * (-358.460) (-356.483) [-356.811] (-363.321) -- 0:00:18
      699500 -- [-358.202] (-359.070) (-357.205) (-361.061) * [-357.388] (-357.939) (-361.504) (-360.444) -- 0:00:18
      700000 -- (-359.146) (-362.964) [-359.225] (-357.564) * [-358.974] (-358.636) (-359.089) (-358.299) -- 0:00:18

      Average standard deviation of split frequencies: 0.009419

      700500 -- (-359.707) [-357.546] (-358.390) (-357.590) * [-361.563] (-364.227) (-357.585) (-365.683) -- 0:00:17
      701000 -- (-358.345) (-360.321) [-359.192] (-365.058) * (-359.176) (-357.475) [-357.776] (-359.911) -- 0:00:17
      701500 -- (-359.281) [-357.173] (-360.136) (-356.833) * (-357.633) [-356.988] (-356.107) (-358.211) -- 0:00:17
      702000 -- [-359.730] (-357.527) (-360.358) (-358.251) * (-358.499) [-356.309] (-357.141) (-359.013) -- 0:00:17
      702500 -- (-358.387) (-361.410) [-357.727] (-358.083) * (-356.597) (-358.469) (-357.035) [-359.133] -- 0:00:17
      703000 -- [-356.402] (-358.871) (-360.940) (-358.367) * (-356.328) (-357.471) (-358.770) [-360.043] -- 0:00:17
      703500 -- (-361.810) [-360.635] (-358.404) (-362.575) * (-357.778) (-359.733) (-357.447) [-361.410] -- 0:00:17
      704000 -- [-357.775] (-359.027) (-357.565) (-358.196) * [-357.083] (-358.220) (-357.444) (-358.103) -- 0:00:17
      704500 -- [-357.621] (-356.906) (-356.607) (-357.960) * [-360.171] (-366.717) (-359.673) (-358.199) -- 0:00:17
      705000 -- [-357.964] (-358.010) (-356.594) (-356.910) * [-359.290] (-357.513) (-359.949) (-358.264) -- 0:00:17

      Average standard deviation of split frequencies: 0.009259

      705500 -- (-357.534) (-359.345) [-356.580] (-358.169) * [-360.395] (-359.479) (-357.917) (-358.826) -- 0:00:17
      706000 -- (-357.873) (-356.953) [-359.212] (-356.446) * (-358.901) [-357.623] (-358.903) (-357.368) -- 0:00:17
      706500 -- (-358.708) [-357.957] (-358.576) (-359.098) * (-356.645) (-357.463) (-356.349) [-357.924] -- 0:00:17
      707000 -- (-359.380) [-359.246] (-359.193) (-362.610) * (-356.783) (-357.045) [-356.396] (-359.445) -- 0:00:17
      707500 -- (-360.610) (-356.877) [-358.981] (-361.101) * (-361.436) [-356.684] (-357.223) (-359.271) -- 0:00:17
      708000 -- [-357.866] (-362.358) (-359.951) (-359.720) * (-358.097) [-357.075] (-356.964) (-357.351) -- 0:00:17
      708500 -- (-357.651) [-357.838] (-365.913) (-356.848) * (-360.237) [-358.164] (-357.150) (-360.970) -- 0:00:17
      709000 -- (-358.056) [-358.496] (-363.825) (-361.857) * [-357.861] (-356.358) (-359.670) (-357.531) -- 0:00:17
      709500 -- (-359.301) (-356.641) [-361.606] (-359.642) * (-357.138) (-359.606) [-357.982] (-357.372) -- 0:00:17
      710000 -- [-357.226] (-360.274) (-357.741) (-359.022) * (-360.074) [-357.860] (-359.365) (-360.325) -- 0:00:17

      Average standard deviation of split frequencies: 0.009021

      710500 -- (-359.712) (-366.098) [-356.636] (-358.217) * (-357.759) (-357.770) [-359.010] (-358.393) -- 0:00:17
      711000 -- (-356.850) (-356.869) (-363.512) [-356.844] * (-358.841) (-357.455) (-359.010) [-357.024] -- 0:00:17
      711500 -- [-356.130] (-360.160) (-364.502) (-356.399) * [-358.097] (-357.693) (-360.148) (-356.815) -- 0:00:17
      712000 -- [-357.385] (-357.371) (-356.924) (-358.152) * (-358.602) (-357.445) (-357.641) [-358.607] -- 0:00:16
      712500 -- (-357.943) [-357.907] (-357.725) (-359.598) * (-360.526) (-358.521) [-357.533] (-356.370) -- 0:00:16
      713000 -- (-357.337) [-360.060] (-357.220) (-358.229) * (-358.901) (-357.299) [-360.617] (-358.054) -- 0:00:17
      713500 -- (-357.289) (-357.570) (-358.410) [-358.393] * [-356.542] (-360.050) (-357.599) (-361.485) -- 0:00:17
      714000 -- (-356.686) (-360.680) (-358.588) [-357.801] * (-357.596) [-357.206] (-356.985) (-359.790) -- 0:00:17
      714500 -- (-356.388) (-358.449) [-358.010] (-359.961) * (-359.102) (-357.093) (-357.049) [-357.360] -- 0:00:17
      715000 -- (-358.349) (-360.015) [-356.973] (-359.428) * (-358.191) [-359.401] (-358.857) (-361.231) -- 0:00:17

      Average standard deviation of split frequencies: 0.009086

      715500 -- (-358.873) (-356.342) [-359.013] (-361.312) * (-358.008) (-357.247) [-358.618] (-358.115) -- 0:00:17
      716000 -- (-357.092) (-356.143) [-358.360] (-360.068) * (-360.204) [-357.987] (-359.987) (-357.578) -- 0:00:17
      716500 -- (-362.064) (-356.973) [-357.332] (-359.256) * (-357.528) (-359.968) [-359.747] (-359.307) -- 0:00:17
      717000 -- [-357.769] (-360.691) (-357.359) (-359.993) * [-358.514] (-358.096) (-360.389) (-361.376) -- 0:00:16
      717500 -- [-358.676] (-357.946) (-357.081) (-361.316) * (-359.194) (-357.850) [-356.485] (-359.665) -- 0:00:16
      718000 -- [-358.884] (-365.150) (-356.465) (-357.071) * (-362.806) (-359.014) (-356.324) [-357.534] -- 0:00:16
      718500 -- (-360.739) (-359.496) (-357.585) [-357.592] * [-360.065] (-357.270) (-358.983) (-359.660) -- 0:00:16
      719000 -- (-356.690) (-363.694) [-357.620] (-357.338) * (-357.912) [-357.664] (-358.531) (-358.298) -- 0:00:16
      719500 -- (-356.561) (-357.479) (-360.265) [-357.690] * (-356.799) [-359.814] (-357.035) (-358.829) -- 0:00:16
      720000 -- (-357.168) (-358.420) [-357.020] (-361.265) * (-362.789) [-361.112] (-356.110) (-357.238) -- 0:00:16

      Average standard deviation of split frequencies: 0.009637

      720500 -- (-356.759) (-358.511) [-356.405] (-366.982) * (-359.843) [-362.470] (-357.112) (-359.366) -- 0:00:16
      721000 -- (-357.040) (-357.911) [-360.703] (-369.375) * [-358.521] (-358.152) (-358.868) (-359.097) -- 0:00:16
      721500 -- (-356.413) (-359.492) (-357.526) [-361.088] * (-360.690) [-357.886] (-360.026) (-357.037) -- 0:00:16
      722000 -- [-358.400] (-358.706) (-366.820) (-362.690) * (-357.262) [-359.814] (-359.408) (-361.703) -- 0:00:16
      722500 -- (-358.106) (-362.291) [-362.281] (-360.858) * (-357.082) (-358.471) (-359.314) [-357.828] -- 0:00:16
      723000 -- [-358.000] (-358.168) (-357.417) (-359.539) * (-357.582) (-357.456) [-358.378] (-359.361) -- 0:00:16
      723500 -- (-360.587) [-363.026] (-364.171) (-360.307) * [-358.667] (-356.116) (-358.700) (-356.947) -- 0:00:16
      724000 -- [-360.400] (-360.863) (-359.272) (-366.738) * (-357.829) [-357.499] (-358.764) (-356.021) -- 0:00:16
      724500 -- (-359.661) (-359.455) (-356.324) [-357.642] * [-360.310] (-359.410) (-356.023) (-360.887) -- 0:00:16
      725000 -- (-358.862) [-356.634] (-356.467) (-364.090) * (-359.208) [-358.841] (-357.555) (-360.543) -- 0:00:16

      Average standard deviation of split frequencies: 0.009983

      725500 -- (-359.115) (-357.139) [-356.794] (-357.550) * (-357.320) (-360.075) [-358.834] (-356.123) -- 0:00:16
      726000 -- [-359.852] (-359.810) (-358.295) (-358.166) * [-358.072] (-358.527) (-357.544) (-357.370) -- 0:00:16
      726500 -- (-357.067) [-361.273] (-358.458) (-357.607) * (-363.708) (-361.157) (-357.640) [-356.998] -- 0:00:16
      727000 -- (-359.566) [-357.091] (-358.588) (-358.205) * [-357.158] (-360.009) (-358.134) (-360.342) -- 0:00:16
      727500 -- (-358.981) (-356.694) [-356.935] (-360.337) * (-357.572) [-357.574] (-358.988) (-356.111) -- 0:00:16
      728000 -- (-361.527) (-357.090) (-356.510) [-356.761] * (-357.003) (-358.791) (-360.306) [-356.211] -- 0:00:16
      728500 -- [-357.633] (-358.474) (-357.480) (-357.223) * [-356.985] (-357.821) (-356.819) (-357.224) -- 0:00:16
      729000 -- (-360.426) [-356.919] (-356.883) (-357.286) * [-358.675] (-362.824) (-358.015) (-356.672) -- 0:00:15
      729500 -- (-358.398) (-357.374) [-356.859] (-357.890) * (-362.900) (-366.933) (-358.954) [-359.757] -- 0:00:15
      730000 -- (-358.132) [-358.457] (-358.960) (-356.179) * (-357.802) (-357.221) [-357.899] (-356.701) -- 0:00:16

      Average standard deviation of split frequencies: 0.009637

      730500 -- (-359.315) (-358.256) (-361.088) [-357.268] * (-357.255) (-357.426) (-356.852) [-357.953] -- 0:00:16
      731000 -- (-358.131) (-358.781) [-358.997] (-360.956) * [-361.473] (-357.278) (-359.674) (-358.878) -- 0:00:16
      731500 -- [-356.852] (-359.668) (-358.031) (-359.736) * (-363.365) [-357.235] (-357.130) (-362.376) -- 0:00:16
      732000 -- (-357.395) [-357.069] (-357.082) (-357.225) * (-358.747) [-358.438] (-359.620) (-357.772) -- 0:00:16
      732500 -- (-358.405) (-358.117) [-357.905] (-356.651) * (-356.650) (-358.671) [-357.270] (-358.410) -- 0:00:16
      733000 -- (-360.565) [-357.651] (-359.818) (-357.363) * [-359.056] (-360.011) (-358.723) (-357.528) -- 0:00:16
      733500 -- (-361.674) (-356.714) (-359.854) [-357.853] * (-358.653) (-357.382) [-358.372] (-360.628) -- 0:00:15
      734000 -- (-356.712) (-356.238) (-359.205) [-358.610] * (-358.175) [-362.152] (-358.334) (-362.300) -- 0:00:15
      734500 -- (-359.917) [-356.198] (-360.115) (-358.776) * (-364.367) (-359.801) [-360.463] (-357.899) -- 0:00:15
      735000 -- (-359.340) (-359.659) [-358.551] (-360.148) * (-358.947) [-359.803] (-359.474) (-359.018) -- 0:00:15

      Average standard deviation of split frequencies: 0.009647

      735500 -- (-356.133) [-356.888] (-359.651) (-362.290) * [-359.136] (-357.956) (-359.589) (-365.541) -- 0:00:15
      736000 -- (-356.100) (-357.895) (-359.819) [-356.738] * (-356.488) [-359.485] (-359.325) (-362.454) -- 0:00:15
      736500 -- [-357.994] (-357.975) (-356.495) (-367.143) * (-358.316) [-359.743] (-361.177) (-358.121) -- 0:00:15
      737000 -- [-357.893] (-358.077) (-356.824) (-357.741) * (-356.998) (-363.037) [-357.263] (-360.430) -- 0:00:15
      737500 -- (-359.160) (-358.394) [-358.428] (-357.646) * (-356.579) [-357.598] (-358.279) (-357.675) -- 0:00:15
      738000 -- (-359.617) [-359.140] (-357.779) (-361.766) * (-357.024) (-357.850) [-360.818] (-359.510) -- 0:00:15
      738500 -- (-358.921) (-356.559) [-359.197] (-357.224) * (-357.053) (-357.601) (-357.841) [-356.166] -- 0:00:15
      739000 -- (-358.840) [-356.163] (-357.607) (-358.649) * (-358.361) [-356.470] (-357.320) (-356.016) -- 0:00:15
      739500 -- [-358.221] (-357.755) (-358.100) (-362.994) * (-356.419) (-357.949) (-360.137) [-358.186] -- 0:00:15
      740000 -- (-359.837) [-356.956] (-367.730) (-358.082) * (-359.031) (-359.013) (-363.332) [-358.929] -- 0:00:15

      Average standard deviation of split frequencies: 0.009666

      740500 -- (-357.216) (-357.477) [-358.855] (-356.693) * [-357.364] (-357.821) (-359.690) (-357.510) -- 0:00:15
      741000 -- [-357.394] (-362.329) (-359.836) (-358.283) * (-357.149) (-356.164) (-356.185) [-356.552] -- 0:00:15
      741500 -- (-361.989) (-358.337) [-357.384] (-359.566) * (-357.957) [-356.865] (-358.716) (-362.509) -- 0:00:15
      742000 -- [-360.262] (-359.014) (-357.700) (-356.890) * (-357.789) (-358.770) (-356.474) [-358.993] -- 0:00:15
      742500 -- (-358.965) (-359.319) (-359.135) [-360.398] * (-357.669) (-358.501) (-357.157) [-357.594] -- 0:00:15
      743000 -- [-359.457] (-357.816) (-357.485) (-358.095) * (-358.806) (-357.260) [-358.372] (-357.062) -- 0:00:15
      743500 -- (-358.392) (-359.534) (-358.293) [-358.479] * (-357.384) [-356.929] (-357.951) (-361.837) -- 0:00:15
      744000 -- (-359.324) (-357.833) (-361.044) [-358.042] * (-362.678) [-356.571] (-359.587) (-356.430) -- 0:00:15
      744500 -- (-357.947) [-359.097] (-358.079) (-358.575) * (-357.752) (-358.174) [-359.251] (-359.849) -- 0:00:15
      745000 -- (-360.309) [-357.745] (-361.093) (-362.652) * [-357.748] (-363.980) (-358.137) (-357.402) -- 0:00:15

      Average standard deviation of split frequencies: 0.009676

      745500 -- (-357.556) (-357.684) (-360.632) [-360.927] * (-358.892) (-372.849) (-359.939) [-359.512] -- 0:00:15
      746000 -- (-357.984) [-357.492] (-358.896) (-357.319) * (-356.887) (-366.735) [-365.163] (-360.134) -- 0:00:14
      746500 -- (-358.389) (-357.191) (-360.531) [-356.905] * (-357.807) (-369.955) [-364.201] (-359.301) -- 0:00:14
      747000 -- [-358.766] (-363.781) (-358.228) (-358.388) * (-359.145) (-360.062) (-358.747) [-362.643] -- 0:00:14
      747500 -- (-358.681) [-357.257] (-356.996) (-358.188) * [-358.896] (-360.116) (-357.296) (-358.699) -- 0:00:15
      748000 -- (-358.195) (-360.426) [-357.187] (-357.504) * (-359.023) (-364.613) (-360.176) [-361.195] -- 0:00:15
      748500 -- (-356.824) [-357.914] (-359.018) (-358.224) * (-356.077) (-360.113) (-357.516) [-358.309] -- 0:00:15
      749000 -- (-356.980) (-358.503) (-357.746) [-359.334] * (-357.301) [-358.612] (-359.303) (-357.788) -- 0:00:15
      749500 -- [-363.863] (-358.669) (-357.015) (-360.487) * (-357.211) (-357.158) (-356.547) [-360.018] -- 0:00:15
      750000 -- [-357.970] (-360.986) (-362.336) (-357.750) * (-358.348) [-356.255] (-357.863) (-358.921) -- 0:00:15

      Average standard deviation of split frequencies: 0.009380

      750500 -- [-358.381] (-356.887) (-356.998) (-357.885) * [-357.584] (-356.251) (-359.211) (-360.296) -- 0:00:14
      751000 -- (-357.431) [-358.550] (-358.230) (-358.156) * (-358.266) (-359.647) (-359.095) [-362.980] -- 0:00:14
      751500 -- (-358.090) [-355.988] (-363.085) (-359.491) * (-358.802) (-356.342) [-359.054] (-361.246) -- 0:00:14
      752000 -- (-357.874) (-358.895) (-358.040) [-360.710] * (-360.597) [-356.165] (-360.687) (-360.403) -- 0:00:14
      752500 -- (-359.260) (-361.066) [-357.367] (-357.818) * (-361.372) (-357.466) [-359.859] (-358.690) -- 0:00:14
      753000 -- (-357.365) (-357.878) [-357.425] (-357.538) * (-359.988) [-356.236] (-362.686) (-357.155) -- 0:00:14
      753500 -- (-358.071) [-357.388] (-357.262) (-360.390) * [-358.321] (-358.977) (-357.569) (-356.885) -- 0:00:14
      754000 -- (-359.317) (-356.851) [-357.578] (-356.929) * (-360.050) (-360.311) (-359.080) [-358.604] -- 0:00:14
      754500 -- [-357.607] (-360.018) (-358.015) (-356.084) * (-362.614) (-358.099) (-358.529) [-359.853] -- 0:00:14
      755000 -- (-360.528) (-356.155) [-357.647] (-357.842) * (-356.203) (-358.956) (-359.317) [-359.089] -- 0:00:14

      Average standard deviation of split frequencies: 0.009470

      755500 -- (-363.453) [-358.465] (-361.955) (-358.979) * (-356.130) (-360.858) [-364.733] (-356.494) -- 0:00:14
      756000 -- (-363.319) [-356.755] (-358.817) (-358.299) * (-356.309) [-360.665] (-362.669) (-357.446) -- 0:00:14
      756500 -- [-360.087] (-356.615) (-361.478) (-358.495) * (-359.047) (-358.116) [-360.907] (-359.204) -- 0:00:14
      757000 -- (-360.506) (-356.758) [-358.242] (-357.084) * (-358.088) (-358.722) [-358.449] (-362.347) -- 0:00:14
      757500 -- (-356.721) [-358.351] (-358.663) (-358.921) * (-359.356) (-357.971) (-359.320) [-359.516] -- 0:00:14
      758000 -- (-359.565) [-358.168] (-357.434) (-363.899) * (-358.404) [-358.942] (-359.899) (-358.775) -- 0:00:14
      758500 -- (-357.440) [-363.201] (-356.883) (-358.225) * [-356.722] (-358.281) (-357.742) (-357.020) -- 0:00:14
      759000 -- [-356.959] (-362.396) (-357.332) (-358.712) * (-357.255) [-357.200] (-360.714) (-358.225) -- 0:00:14
      759500 -- (-356.671) [-357.532] (-358.003) (-357.685) * (-362.617) (-357.720) (-358.347) [-362.382] -- 0:00:14
      760000 -- (-357.370) [-356.453] (-356.908) (-356.833) * (-358.820) (-357.357) (-360.477) [-360.067] -- 0:00:14

      Average standard deviation of split frequencies: 0.009916

      760500 -- (-356.395) (-361.482) (-358.647) [-357.869] * (-357.911) (-359.089) [-359.749] (-359.217) -- 0:00:14
      761000 -- (-361.003) (-359.086) (-356.541) [-358.372] * [-357.383] (-360.434) (-358.221) (-358.517) -- 0:00:14
      761500 -- (-358.402) (-361.277) [-358.965] (-358.869) * (-358.032) [-358.804] (-359.477) (-360.026) -- 0:00:14
      762000 -- [-357.765] (-358.900) (-365.281) (-359.962) * (-357.910) [-360.467] (-359.758) (-358.279) -- 0:00:14
      762500 -- (-356.055) [-360.443] (-360.623) (-357.886) * (-360.264) [-358.244] (-357.586) (-359.332) -- 0:00:14
      763000 -- (-358.723) (-357.884) [-359.398] (-360.363) * (-360.396) (-361.339) (-358.679) [-359.617] -- 0:00:13
      763500 -- (-359.618) (-357.777) [-357.522] (-362.153) * [-357.576] (-362.870) (-357.220) (-357.937) -- 0:00:13
      764000 -- (-357.238) (-355.959) [-357.475] (-357.427) * (-357.672) [-356.498] (-357.585) (-362.529) -- 0:00:14
      764500 -- [-358.639] (-358.191) (-356.618) (-361.083) * (-357.215) (-358.415) (-356.738) [-358.037] -- 0:00:14
      765000 -- [-361.871] (-359.520) (-357.926) (-357.822) * (-356.029) [-357.053] (-357.845) (-357.959) -- 0:00:14

      Average standard deviation of split frequencies: 0.010000

      765500 -- (-361.076) (-358.437) [-356.832] (-358.114) * [-356.834] (-356.436) (-359.318) (-357.331) -- 0:00:14
      766000 -- (-360.550) [-358.080] (-362.790) (-358.043) * (-358.726) (-359.329) [-358.809] (-357.501) -- 0:00:14
      766500 -- (-356.832) (-356.598) [-358.678] (-359.583) * (-358.921) (-358.521) [-357.388] (-359.242) -- 0:00:14
      767000 -- (-359.318) (-357.664) (-357.826) [-361.688] * (-358.528) (-357.530) (-357.632) [-356.504] -- 0:00:13
      767500 -- (-358.022) (-363.545) [-357.409] (-358.752) * (-357.255) [-357.055] (-357.133) (-358.062) -- 0:00:13
      768000 -- (-357.118) (-359.930) [-359.679] (-361.145) * (-358.809) (-359.072) (-356.810) [-356.184] -- 0:00:13
      768500 -- (-357.123) (-361.148) (-356.286) [-356.896] * (-358.055) [-358.437] (-357.508) (-357.046) -- 0:00:13
      769000 -- (-359.218) (-366.932) (-356.286) [-357.155] * (-357.518) (-360.714) [-358.040] (-357.188) -- 0:00:13
      769500 -- [-358.273] (-362.454) (-357.155) (-362.327) * [-358.338] (-356.226) (-357.836) (-360.302) -- 0:00:13
      770000 -- (-358.782) (-358.081) (-359.198) [-357.996] * (-357.315) (-356.413) [-357.190] (-360.328) -- 0:00:13

      Average standard deviation of split frequencies: 0.009420

      770500 -- [-357.898] (-359.451) (-358.109) (-357.687) * (-366.624) [-356.895] (-358.301) (-358.493) -- 0:00:13
      771000 -- (-356.836) (-358.883) (-357.040) [-359.518] * (-363.113) (-359.552) [-356.777] (-357.134) -- 0:00:13
      771500 -- (-361.746) (-357.382) [-357.827] (-357.539) * (-356.810) (-361.801) [-357.344] (-362.552) -- 0:00:13
      772000 -- (-356.897) [-358.607] (-356.592) (-358.315) * [-358.484] (-357.688) (-356.432) (-357.225) -- 0:00:13
      772500 -- [-358.160] (-357.283) (-364.257) (-358.880) * [-358.505] (-361.243) (-358.905) (-357.297) -- 0:00:13
      773000 -- (-358.753) [-355.912] (-359.106) (-358.776) * (-356.586) (-358.002) (-358.239) [-356.692] -- 0:00:13
      773500 -- [-359.163] (-359.374) (-359.687) (-359.287) * (-358.458) (-357.907) [-359.760] (-358.710) -- 0:00:13
      774000 -- (-358.448) (-358.873) (-358.279) [-362.583] * (-358.763) (-359.323) [-359.683] (-357.786) -- 0:00:13
      774500 -- (-356.378) [-357.620] (-358.104) (-364.026) * (-356.885) (-359.322) (-359.573) [-358.209] -- 0:00:13
      775000 -- (-357.750) (-359.868) [-356.948] (-356.491) * (-357.895) (-358.604) [-358.680] (-357.318) -- 0:00:13

      Average standard deviation of split frequencies: 0.009598

      775500 -- [-358.561] (-358.663) (-357.706) (-357.917) * (-358.908) (-360.330) (-357.446) [-359.219] -- 0:00:13
      776000 -- (-360.342) (-358.815) [-359.529] (-358.998) * (-359.191) (-358.436) (-358.120) [-357.324] -- 0:00:13
      776500 -- [-358.668] (-356.667) (-357.383) (-358.057) * [-359.752] (-358.647) (-360.992) (-356.220) -- 0:00:13
      777000 -- (-358.458) (-356.566) [-356.663] (-361.933) * (-361.277) (-361.705) (-361.517) [-360.653] -- 0:00:13
      777500 -- (-357.253) [-357.344] (-362.488) (-358.469) * (-359.911) (-362.912) [-359.706] (-358.104) -- 0:00:13
      778000 -- (-356.330) (-359.044) (-358.418) [-359.972] * (-360.204) [-357.744] (-358.631) (-357.632) -- 0:00:13
      778500 -- (-359.567) (-356.874) [-357.046] (-361.284) * (-362.073) [-357.337] (-361.813) (-356.337) -- 0:00:13
      779000 -- (-359.336) (-361.759) (-357.281) [-356.360] * [-357.932] (-359.525) (-359.721) (-356.839) -- 0:00:13
      779500 -- [-357.822] (-358.672) (-361.993) (-360.617) * (-357.908) (-359.903) (-358.086) [-356.106] -- 0:00:13
      780000 -- [-359.018] (-358.520) (-357.071) (-360.536) * (-357.073) (-357.414) (-358.562) [-356.517] -- 0:00:12

      Average standard deviation of split frequencies: 0.009581

      780500 -- [-357.197] (-358.669) (-359.804) (-357.544) * (-358.838) [-356.799] (-359.971) (-357.510) -- 0:00:12
      781000 -- [-359.359] (-358.022) (-358.197) (-362.352) * (-360.414) (-356.305) [-361.283] (-358.656) -- 0:00:12
      781500 -- (-359.851) (-362.424) (-357.687) [-358.659] * [-357.373] (-357.741) (-361.839) (-356.375) -- 0:00:13
      782000 -- (-357.707) (-360.656) (-364.637) [-358.788] * (-361.279) (-357.496) (-356.484) [-355.997] -- 0:00:13
      782500 -- (-359.621) (-360.142) [-361.087] (-356.799) * (-359.650) (-357.110) (-361.458) [-356.305] -- 0:00:13
      783000 -- (-361.583) (-357.957) [-357.900] (-359.206) * (-359.133) (-366.730) (-357.878) [-356.858] -- 0:00:13
      783500 -- (-358.058) (-361.675) (-358.150) [-359.384] * (-357.753) (-359.827) [-357.884] (-357.459) -- 0:00:12
      784000 -- (-358.232) (-357.923) [-356.266] (-358.469) * (-357.966) [-359.449] (-359.188) (-360.999) -- 0:00:12
      784500 -- (-357.507) (-358.964) (-356.403) [-356.700] * (-358.278) [-359.770] (-358.054) (-359.355) -- 0:00:12
      785000 -- (-357.044) (-357.431) (-359.709) [-357.080] * [-359.526] (-358.692) (-357.412) (-363.028) -- 0:00:12

      Average standard deviation of split frequencies: 0.009916

      785500 -- (-357.454) (-356.753) (-362.087) [-356.916] * (-360.651) (-359.424) [-359.177] (-361.708) -- 0:00:12
      786000 -- (-358.955) (-358.566) (-356.043) [-358.493] * [-358.335] (-357.181) (-356.768) (-358.481) -- 0:00:12
      786500 -- [-359.236] (-357.179) (-356.362) (-359.422) * (-357.707) (-360.851) (-357.627) [-359.762] -- 0:00:12
      787000 -- [-359.118] (-356.636) (-359.471) (-358.017) * [-359.735] (-356.830) (-359.934) (-359.492) -- 0:00:12
      787500 -- (-359.595) [-356.160] (-357.047) (-360.652) * [-356.113] (-361.905) (-357.762) (-358.567) -- 0:00:12
      788000 -- (-358.002) [-357.379] (-360.297) (-358.678) * [-356.319] (-358.835) (-360.805) (-361.143) -- 0:00:12
      788500 -- [-358.660] (-359.835) (-363.583) (-361.205) * (-360.928) (-356.268) (-357.478) [-357.168] -- 0:00:12
      789000 -- (-358.534) [-356.185] (-361.083) (-357.734) * (-358.947) (-357.225) (-360.032) [-357.583] -- 0:00:12
      789500 -- (-358.151) [-356.076] (-360.437) (-357.638) * (-357.815) [-357.294] (-361.845) (-358.926) -- 0:00:12
      790000 -- [-360.846] (-357.225) (-363.049) (-357.098) * [-358.033] (-358.422) (-363.545) (-356.787) -- 0:00:12

      Average standard deviation of split frequencies: 0.009937

      790500 -- (-357.093) (-358.303) [-357.401] (-356.761) * (-358.135) (-358.989) [-356.594] (-357.933) -- 0:00:12
      791000 -- (-357.961) [-357.277] (-357.486) (-356.598) * (-357.608) (-356.981) [-359.050] (-359.605) -- 0:00:12
      791500 -- (-358.700) (-362.577) (-359.333) [-358.404] * (-359.446) (-359.410) (-358.662) [-358.024] -- 0:00:12
      792000 -- [-357.666] (-357.293) (-363.088) (-359.309) * (-360.061) [-357.539] (-356.760) (-358.405) -- 0:00:12
      792500 -- (-359.863) (-358.986) (-360.071) [-357.727] * [-357.813] (-358.418) (-361.601) (-359.816) -- 0:00:12
      793000 -- (-358.199) (-357.970) (-357.896) [-356.216] * (-361.353) (-356.690) (-360.166) [-356.307] -- 0:00:12
      793500 -- (-357.549) (-361.591) (-357.482) [-358.645] * (-361.344) (-358.848) (-357.498) [-356.930] -- 0:00:12
      794000 -- (-360.049) (-361.064) (-357.961) [-358.638] * (-359.486) (-358.418) [-357.608] (-357.761) -- 0:00:12
      794500 -- [-357.373] (-361.442) (-358.591) (-357.331) * (-357.886) [-356.581] (-357.917) (-356.402) -- 0:00:12
      795000 -- (-360.545) [-357.108] (-357.631) (-357.241) * (-358.310) (-357.966) [-356.658] (-357.728) -- 0:00:12

      Average standard deviation of split frequencies: 0.010384

      795500 -- (-357.924) [-358.807] (-356.440) (-358.026) * (-357.350) [-358.030] (-359.535) (-359.562) -- 0:00:12
      796000 -- (-359.028) (-356.805) [-357.278] (-359.514) * [-357.275] (-357.456) (-359.796) (-358.437) -- 0:00:12
      796500 -- (-358.100) (-358.545) (-360.632) [-357.459] * (-358.686) [-357.547] (-360.229) (-358.458) -- 0:00:12
      797000 -- (-360.205) (-358.926) [-360.537] (-357.813) * (-356.506) (-363.897) [-357.481] (-358.838) -- 0:00:11
      797500 -- (-358.982) (-358.969) [-357.597] (-357.257) * [-356.653] (-358.355) (-356.726) (-357.311) -- 0:00:11
      798000 -- (-357.527) (-357.749) [-360.714] (-361.723) * (-361.424) (-357.866) (-356.724) [-357.345] -- 0:00:11
      798500 -- [-357.037] (-359.960) (-357.988) (-360.208) * [-358.815] (-360.068) (-359.799) (-359.510) -- 0:00:12
      799000 -- (-357.498) [-360.327] (-356.664) (-358.000) * [-358.878] (-362.781) (-361.776) (-360.112) -- 0:00:12
      799500 -- [-357.095] (-359.656) (-356.891) (-356.653) * (-356.984) (-357.188) (-360.555) [-356.563] -- 0:00:12
      800000 -- (-359.419) [-364.604] (-361.038) (-365.474) * (-357.178) (-364.247) [-357.687] (-356.441) -- 0:00:12

      Average standard deviation of split frequencies: 0.010088

      800500 -- [-360.347] (-358.151) (-362.351) (-357.386) * (-357.786) (-358.145) [-358.261] (-356.250) -- 0:00:11
      801000 -- (-358.115) (-358.656) [-359.939] (-358.211) * (-356.661) (-360.775) [-359.515] (-360.588) -- 0:00:11
      801500 -- (-358.816) (-360.107) [-357.546] (-361.777) * (-360.897) (-360.061) [-356.250] (-361.941) -- 0:00:11
      802000 -- (-357.095) [-356.081] (-358.174) (-358.714) * [-361.201] (-357.093) (-361.036) (-359.404) -- 0:00:11
      802500 -- (-358.545) [-359.238] (-357.702) (-357.132) * (-360.829) (-358.651) (-362.799) [-357.755] -- 0:00:11
      803000 -- (-357.015) [-357.532] (-359.482) (-359.451) * (-356.661) (-358.579) (-359.021) [-356.769] -- 0:00:11
      803500 -- [-356.988] (-356.673) (-356.629) (-359.189) * [-358.171] (-358.246) (-358.332) (-361.673) -- 0:00:11
      804000 -- (-356.914) [-358.914] (-357.544) (-359.956) * (-357.415) (-356.973) [-358.787] (-360.206) -- 0:00:11
      804500 -- [-356.932] (-356.860) (-361.273) (-359.006) * (-357.270) (-359.176) [-362.966] (-359.841) -- 0:00:11
      805000 -- [-359.561] (-357.062) (-358.344) (-358.627) * (-356.706) [-356.247] (-358.016) (-357.650) -- 0:00:11

      Average standard deviation of split frequencies: 0.009787

      805500 -- (-357.850) (-357.244) (-360.104) [-356.824] * (-357.410) [-358.569] (-357.128) (-359.420) -- 0:00:11
      806000 -- (-358.435) (-360.595) [-360.607] (-359.041) * (-359.097) (-357.782) [-361.388] (-358.895) -- 0:00:11
      806500 -- (-357.314) (-359.977) [-357.110] (-357.071) * (-360.121) (-357.120) [-357.081] (-357.003) -- 0:00:11
      807000 -- (-357.500) [-357.092] (-359.374) (-357.860) * (-357.726) [-357.369] (-360.355) (-356.690) -- 0:00:11
      807500 -- [-357.424] (-357.238) (-357.035) (-357.790) * [-357.190] (-359.966) (-362.766) (-359.412) -- 0:00:11
      808000 -- (-357.575) (-357.250) (-358.356) [-357.868] * (-358.176) (-357.558) [-359.194] (-365.013) -- 0:00:11
      808500 -- (-358.137) [-357.596] (-358.196) (-360.406) * (-358.726) (-358.428) (-359.312) [-362.551] -- 0:00:11
      809000 -- (-361.004) (-357.082) [-359.049] (-358.080) * (-356.977) (-360.048) (-362.182) [-358.583] -- 0:00:11
      809500 -- (-363.199) [-357.253] (-356.925) (-358.626) * (-357.117) (-356.277) (-358.523) [-358.068] -- 0:00:11
      810000 -- [-357.637] (-357.039) (-358.591) (-361.963) * (-357.423) (-357.004) (-359.851) [-357.110] -- 0:00:11

      Average standard deviation of split frequencies: 0.009343

      810500 -- (-359.519) [-356.994] (-359.247) (-357.322) * (-359.090) [-357.277] (-356.932) (-357.748) -- 0:00:11
      811000 -- (-358.037) (-356.927) (-359.070) [-360.552] * (-355.897) [-356.728] (-357.893) (-356.019) -- 0:00:11
      811500 -- (-358.422) [-357.374] (-358.386) (-356.579) * (-357.450) (-357.629) (-362.091) [-359.004] -- 0:00:11
      812000 -- [-362.112] (-358.299) (-358.532) (-356.587) * (-357.865) (-358.745) [-359.109] (-359.136) -- 0:00:11
      812500 -- [-357.623] (-360.821) (-360.789) (-356.637) * [-357.153] (-357.600) (-356.979) (-358.584) -- 0:00:11
      813000 -- (-358.092) (-360.172) [-357.355] (-356.750) * (-358.756) (-357.772) (-356.137) [-358.281] -- 0:00:11
      813500 -- (-358.175) (-360.340) (-357.375) [-357.909] * (-359.249) [-356.700] (-360.243) (-357.938) -- 0:00:11
      814000 -- (-358.743) [-361.041] (-361.499) (-357.401) * (-359.948) (-358.114) [-356.742] (-361.290) -- 0:00:10
      814500 -- (-356.878) [-357.895] (-361.934) (-358.557) * (-358.108) (-358.059) (-357.953) [-357.578] -- 0:00:10
      815000 -- (-360.075) (-358.662) [-358.005] (-358.227) * (-358.813) [-358.173] (-360.652) (-357.200) -- 0:00:10

      Average standard deviation of split frequencies: 0.008974

      815500 -- (-363.515) (-359.750) [-358.792] (-358.285) * (-357.346) [-358.190] (-357.766) (-361.196) -- 0:00:11
      816000 -- [-359.483] (-363.590) (-359.237) (-357.812) * (-357.531) [-356.801] (-363.254) (-365.811) -- 0:00:11
      816500 -- (-358.837) (-358.963) [-358.350] (-359.211) * (-358.069) (-358.112) (-357.265) [-363.637] -- 0:00:11
      817000 -- (-359.364) [-357.141] (-357.542) (-362.588) * [-356.868] (-362.198) (-358.567) (-359.874) -- 0:00:10
      817500 -- (-356.861) (-356.815) [-356.717] (-368.781) * (-359.480) (-357.630) (-358.200) [-360.419] -- 0:00:10
      818000 -- (-361.102) (-357.805) [-356.487] (-361.419) * (-356.106) (-360.651) (-358.665) [-359.897] -- 0:00:10
      818500 -- (-356.683) [-357.335] (-357.618) (-357.828) * (-356.836) (-358.023) (-358.961) [-357.703] -- 0:00:10
      819000 -- [-357.576] (-362.330) (-360.092) (-356.701) * (-357.208) [-357.291] (-364.901) (-359.835) -- 0:00:10
      819500 -- (-358.831) [-359.174] (-356.775) (-357.346) * (-356.347) (-359.483) (-358.783) [-360.372] -- 0:00:10
      820000 -- [-358.513] (-359.308) (-358.018) (-357.898) * (-356.647) (-357.849) [-358.062] (-359.448) -- 0:00:10

      Average standard deviation of split frequencies: 0.009037

      820500 -- [-357.345] (-358.124) (-358.700) (-359.156) * (-356.745) (-358.594) [-360.721] (-359.313) -- 0:00:10
      821000 -- (-358.863) [-357.283] (-361.884) (-361.705) * (-359.080) (-362.516) (-357.591) [-359.077] -- 0:00:10
      821500 -- [-356.892] (-356.888) (-362.763) (-356.441) * (-358.379) (-360.335) (-360.520) [-357.514] -- 0:00:10
      822000 -- [-357.458] (-356.519) (-359.522) (-360.106) * (-358.088) [-359.160] (-357.374) (-356.161) -- 0:00:10
      822500 -- (-357.579) [-359.968] (-360.075) (-356.555) * (-358.837) (-359.422) [-359.051] (-359.490) -- 0:00:10
      823000 -- (-357.282) (-360.950) (-356.637) [-356.722] * (-358.399) [-359.114] (-357.422) (-359.151) -- 0:00:10
      823500 -- [-358.862] (-360.588) (-357.237) (-360.846) * (-355.879) (-358.980) (-357.145) [-357.064] -- 0:00:10
      824000 -- (-359.505) [-359.561] (-359.813) (-359.740) * (-355.875) (-359.434) [-358.914] (-358.799) -- 0:00:10
      824500 -- (-361.660) (-358.930) (-360.402) [-357.284] * [-358.760] (-358.959) (-356.515) (-359.305) -- 0:00:10
      825000 -- (-358.184) (-358.798) [-357.163] (-356.663) * (-358.377) [-358.515] (-359.074) (-357.783) -- 0:00:10

      Average standard deviation of split frequencies: 0.009131

      825500 -- (-358.172) [-361.169] (-357.516) (-356.636) * [-356.556] (-356.673) (-361.088) (-360.468) -- 0:00:10
      826000 -- (-362.018) (-358.212) (-357.081) [-356.415] * (-357.327) (-356.946) (-357.355) [-364.958] -- 0:00:10
      826500 -- (-358.399) [-359.154] (-357.747) (-356.868) * (-357.365) [-358.402] (-361.438) (-358.897) -- 0:00:10
      827000 -- (-358.620) (-361.546) (-356.246) [-358.579] * (-358.537) (-357.673) [-356.319] (-360.255) -- 0:00:10
      827500 -- [-360.952] (-359.123) (-359.727) (-360.619) * (-359.207) [-357.303] (-357.868) (-357.985) -- 0:00:10
      828000 -- (-357.133) (-360.574) [-356.978] (-359.796) * (-357.097) [-360.612] (-363.482) (-358.205) -- 0:00:10
      828500 -- (-358.237) [-358.210] (-357.763) (-356.699) * (-357.859) [-357.097] (-357.141) (-361.029) -- 0:00:10
      829000 -- [-358.204] (-363.014) (-359.717) (-357.359) * [-357.203] (-359.106) (-357.569) (-360.626) -- 0:00:10
      829500 -- [-358.678] (-358.332) (-357.010) (-360.247) * (-356.692) (-362.877) [-357.330] (-361.269) -- 0:00:10
      830000 -- (-358.618) (-358.812) (-358.565) [-357.937] * (-356.659) (-360.904) (-357.111) [-358.824] -- 0:00:10

      Average standard deviation of split frequencies: 0.008740

      830500 -- (-356.066) [-357.595] (-359.700) (-360.008) * (-360.455) (-359.674) [-357.086] (-357.814) -- 0:00:10
      831000 -- (-358.830) (-358.160) [-362.173] (-358.457) * (-361.680) (-358.454) (-356.270) [-356.057] -- 0:00:09
      831500 -- (-360.825) (-356.677) (-363.241) [-360.432] * (-360.527) (-356.547) [-357.562] (-357.783) -- 0:00:09
      832000 -- (-358.994) (-356.943) (-359.168) [-362.808] * [-357.529] (-357.677) (-358.120) (-360.927) -- 0:00:09
      832500 -- (-357.728) (-357.863) [-358.077] (-356.980) * [-358.708] (-358.645) (-357.922) (-359.943) -- 0:00:10
      833000 -- (-356.701) [-357.016] (-360.961) (-361.645) * [-356.947] (-357.243) (-364.152) (-362.763) -- 0:00:10
      833500 -- [-358.630] (-357.766) (-359.744) (-358.764) * (-357.616) (-359.766) (-359.747) [-359.675] -- 0:00:09
      834000 -- [-359.635] (-358.117) (-359.215) (-359.101) * (-359.101) (-356.641) (-357.001) [-358.322] -- 0:00:09
      834500 -- (-357.301) (-360.115) [-357.457] (-357.785) * (-357.688) (-358.303) (-360.647) [-358.654] -- 0:00:09
      835000 -- (-360.803) (-360.979) (-360.093) [-356.666] * (-357.588) [-358.354] (-359.142) (-359.959) -- 0:00:09

      Average standard deviation of split frequencies: 0.009022

      835500 -- [-358.916] (-361.263) (-357.321) (-357.051) * [-357.591] (-357.651) (-364.819) (-357.882) -- 0:00:09
      836000 -- (-359.529) (-356.551) (-356.418) [-357.331] * (-358.367) [-357.399] (-358.988) (-363.191) -- 0:00:09
      836500 -- (-359.025) (-357.738) (-360.566) [-359.018] * (-361.645) (-358.349) [-360.114] (-362.485) -- 0:00:09
      837000 -- [-359.684] (-357.077) (-362.159) (-360.220) * (-364.497) [-358.965] (-359.768) (-365.393) -- 0:00:09
      837500 -- (-358.211) (-358.648) (-360.248) [-361.173] * (-362.272) [-359.521] (-360.139) (-358.072) -- 0:00:09
      838000 -- (-366.161) (-356.667) (-357.335) [-358.853] * (-358.013) (-359.279) (-356.864) [-356.251] -- 0:00:09
      838500 -- (-356.516) [-359.018] (-358.697) (-360.155) * [-358.684] (-358.787) (-359.512) (-358.823) -- 0:00:09
      839000 -- (-358.252) (-357.986) (-358.639) [-356.713] * (-363.237) [-356.763] (-360.099) (-357.412) -- 0:00:09
      839500 -- [-357.421] (-358.156) (-358.514) (-357.920) * (-359.824) (-357.614) (-358.403) [-357.419] -- 0:00:09
      840000 -- (-358.367) [-357.465] (-357.709) (-358.114) * (-357.841) [-358.049] (-359.024) (-357.175) -- 0:00:09

      Average standard deviation of split frequencies: 0.009533

      840500 -- (-356.940) (-357.059) (-356.707) [-362.662] * [-358.756] (-359.022) (-357.226) (-358.327) -- 0:00:09
      841000 -- (-357.526) (-359.251) (-356.680) [-358.441] * (-357.482) [-359.066] (-356.287) (-361.831) -- 0:00:09
      841500 -- [-362.727] (-360.475) (-357.756) (-359.268) * (-357.464) [-356.899] (-356.884) (-359.536) -- 0:00:09
      842000 -- [-357.865] (-359.222) (-361.930) (-357.476) * (-356.556) (-358.210) [-356.583] (-358.103) -- 0:00:09
      842500 -- (-359.022) (-365.475) (-358.618) [-356.868] * [-358.811] (-357.252) (-360.569) (-357.495) -- 0:00:09
      843000 -- (-358.527) (-362.771) (-357.952) [-355.958] * [-358.394] (-358.747) (-359.944) (-357.609) -- 0:00:09
      843500 -- (-360.351) [-360.678] (-359.322) (-359.412) * (-360.653) [-358.286] (-358.592) (-357.656) -- 0:00:09
      844000 -- [-357.631] (-356.711) (-360.463) (-357.218) * [-359.210] (-357.015) (-362.658) (-359.551) -- 0:00:09
      844500 -- (-360.447) (-360.697) (-360.790) [-359.494] * (-360.423) [-357.931] (-357.438) (-362.703) -- 0:00:09
      845000 -- (-358.904) (-362.144) [-363.046] (-358.079) * (-358.896) (-358.865) [-357.230] (-360.595) -- 0:00:09

      Average standard deviation of split frequencies: 0.009658

      845500 -- (-359.149) (-356.752) (-357.986) [-359.798] * (-357.784) (-359.560) (-358.668) [-357.617] -- 0:00:09
      846000 -- (-359.216) [-357.029] (-360.775) (-362.426) * [-357.505] (-358.454) (-358.325) (-358.558) -- 0:00:09
      846500 -- [-358.471] (-359.980) (-360.641) (-358.913) * (-358.289) [-359.396] (-357.496) (-357.931) -- 0:00:09
      847000 -- (-356.401) (-357.574) (-357.728) [-360.915] * (-357.394) (-357.264) (-358.424) [-356.641] -- 0:00:09
      847500 -- (-356.522) (-357.563) (-358.314) [-357.434] * (-359.687) (-358.507) (-357.872) [-357.460] -- 0:00:08
      848000 -- (-357.883) (-356.862) [-358.795] (-357.680) * (-358.565) (-358.173) (-356.677) [-356.687] -- 0:00:08
      848500 -- (-356.796) [-362.874] (-357.610) (-357.973) * (-361.351) (-356.795) (-359.708) [-357.887] -- 0:00:08
      849000 -- (-357.952) [-358.410] (-356.593) (-358.505) * (-358.874) (-356.523) (-356.897) [-357.695] -- 0:00:08
      849500 -- [-358.859] (-358.284) (-355.909) (-358.057) * [-357.656] (-360.040) (-364.156) (-357.489) -- 0:00:09
      850000 -- (-359.846) (-357.538) [-357.245] (-360.124) * (-357.340) (-358.792) [-357.662] (-356.777) -- 0:00:09

      Average standard deviation of split frequencies: 0.010049

      850500 -- (-359.314) [-357.894] (-361.155) (-360.581) * (-356.972) (-356.906) (-358.583) [-357.698] -- 0:00:08
      851000 -- (-358.840) (-362.321) (-362.287) [-362.427] * (-357.955) (-359.819) [-358.609] (-359.072) -- 0:00:08
      851500 -- (-363.471) (-356.954) (-357.925) [-358.858] * (-362.400) [-358.404] (-358.487) (-357.700) -- 0:00:08
      852000 -- (-358.510) (-357.171) (-357.259) [-357.904] * (-361.278) (-359.074) (-359.890) [-358.516] -- 0:00:08
      852500 -- (-357.714) (-357.207) (-359.166) [-358.127] * [-360.209] (-359.058) (-357.091) (-361.842) -- 0:00:08
      853000 -- (-364.735) [-359.217] (-358.366) (-362.062) * (-360.404) (-359.691) [-358.251] (-359.010) -- 0:00:08
      853500 -- [-359.325] (-356.595) (-358.471) (-360.332) * (-357.649) [-357.594] (-356.915) (-358.919) -- 0:00:08
      854000 -- (-357.829) [-361.705] (-357.071) (-357.228) * (-357.189) [-360.437] (-356.891) (-358.099) -- 0:00:08
      854500 -- (-356.657) [-357.153] (-359.305) (-356.325) * [-357.335] (-357.367) (-358.672) (-358.543) -- 0:00:08
      855000 -- [-357.433] (-357.195) (-358.520) (-360.697) * (-358.318) (-356.596) (-358.863) [-361.342] -- 0:00:08

      Average standard deviation of split frequencies: 0.009913

      855500 -- (-361.272) (-359.909) [-358.888] (-357.832) * (-361.347) (-360.716) [-356.679] (-358.219) -- 0:00:08
      856000 -- [-358.272] (-357.291) (-359.820) (-358.251) * (-357.694) (-359.443) (-357.230) [-359.791] -- 0:00:08
      856500 -- (-358.035) (-356.986) (-356.710) [-357.221] * (-358.460) (-360.309) (-358.661) [-360.237] -- 0:00:08
      857000 -- (-357.574) [-356.535] (-357.872) (-359.721) * (-363.901) [-358.068] (-357.288) (-361.548) -- 0:00:08
      857500 -- (-359.539) [-356.373] (-358.871) (-360.488) * (-359.011) (-356.806) (-357.425) [-357.023] -- 0:00:08
      858000 -- (-357.192) (-357.576) [-357.894] (-358.016) * (-357.481) [-358.126] (-358.588) (-358.987) -- 0:00:08
      858500 -- [-358.036] (-356.933) (-357.561) (-357.715) * (-358.112) (-356.180) (-357.069) [-358.002] -- 0:00:08
      859000 -- (-360.127) (-356.681) [-356.969] (-357.472) * (-357.925) (-357.068) (-358.458) [-356.758] -- 0:00:08
      859500 -- (-361.641) (-359.151) [-356.990] (-359.355) * [-357.882] (-358.909) (-359.147) (-358.753) -- 0:00:08
      860000 -- (-357.233) (-357.980) [-357.167] (-357.561) * [-356.623] (-357.809) (-357.299) (-358.217) -- 0:00:08

      Average standard deviation of split frequencies: 0.010115

      860500 -- [-357.061] (-358.319) (-357.758) (-358.263) * (-357.280) (-357.556) (-357.472) [-357.012] -- 0:00:08
      861000 -- (-359.172) (-357.349) (-358.329) [-357.634] * (-358.132) [-358.606] (-359.680) (-356.552) -- 0:00:08
      861500 -- [-356.556] (-358.611) (-358.123) (-358.697) * (-359.810) (-357.811) [-357.389] (-356.612) -- 0:00:08
      862000 -- (-356.605) (-358.808) (-358.259) [-360.929] * (-359.216) (-360.212) (-357.789) [-357.049] -- 0:00:08
      862500 -- (-356.786) (-360.025) (-357.750) [-358.975] * (-358.260) (-361.283) [-357.323] (-359.368) -- 0:00:08
      863000 -- (-358.972) (-357.653) (-363.992) [-359.038] * [-356.767] (-359.511) (-360.221) (-364.032) -- 0:00:08
      863500 -- (-358.657) (-358.621) (-359.428) [-357.398] * (-356.418) (-357.467) [-357.254] (-357.766) -- 0:00:08
      864000 -- [-364.881] (-357.598) (-360.983) (-358.902) * (-356.369) (-356.386) (-361.865) [-356.927] -- 0:00:08
      864500 -- (-362.142) [-358.328] (-359.565) (-357.791) * (-356.906) (-357.556) [-356.842] (-358.098) -- 0:00:07
      865000 -- (-356.578) [-357.960] (-359.354) (-360.957) * [-361.107] (-359.086) (-359.196) (-365.451) -- 0:00:07

      Average standard deviation of split frequencies: 0.010052

      865500 -- (-357.117) (-358.821) (-356.892) [-356.894] * (-361.045) (-362.078) (-357.010) [-357.163] -- 0:00:07
      866000 -- [-356.144] (-356.376) (-358.889) (-357.881) * (-361.326) [-361.461] (-359.563) (-363.752) -- 0:00:07
      866500 -- (-359.012) (-356.957) (-356.962) [-362.001] * (-361.367) [-357.293] (-360.234) (-364.536) -- 0:00:08
      867000 -- (-356.655) [-360.799] (-357.981) (-359.103) * (-361.158) (-358.923) (-362.183) [-357.581] -- 0:00:07
      867500 -- [-357.358] (-361.156) (-360.669) (-360.837) * (-358.155) (-359.431) [-359.233] (-365.229) -- 0:00:07
      868000 -- (-358.294) (-361.248) (-361.172) [-360.303] * (-357.832) (-358.944) [-357.785] (-359.441) -- 0:00:07
      868500 -- [-357.858] (-357.062) (-359.049) (-358.398) * [-358.336] (-360.675) (-358.263) (-356.763) -- 0:00:07
      869000 -- (-356.715) [-356.407] (-356.913) (-359.205) * (-359.894) (-358.671) (-357.586) [-356.985] -- 0:00:07
      869500 -- [-357.021] (-360.759) (-358.260) (-365.649) * (-362.566) (-359.588) (-357.625) [-360.336] -- 0:00:07
      870000 -- (-356.571) [-362.821] (-362.060) (-356.945) * (-360.067) (-362.292) [-356.948] (-358.197) -- 0:00:07

      Average standard deviation of split frequencies: 0.009674

      870500 -- (-356.571) (-359.303) (-358.666) [-356.970] * [-359.243] (-356.840) (-361.512) (-359.047) -- 0:00:07
      871000 -- (-358.024) (-358.403) (-356.921) [-357.471] * (-356.078) (-356.104) (-356.753) [-356.192] -- 0:00:07
      871500 -- (-358.017) [-356.908] (-361.504) (-358.247) * (-358.117) (-357.963) (-361.429) [-358.163] -- 0:00:07
      872000 -- (-357.660) (-361.604) (-366.017) [-357.223] * (-359.994) [-357.570] (-359.056) (-359.638) -- 0:00:07
      872500 -- (-356.938) (-361.328) (-357.155) [-358.833] * (-357.082) [-359.171] (-359.697) (-357.708) -- 0:00:07
      873000 -- (-356.422) (-359.542) (-358.009) [-357.086] * (-358.394) [-356.095] (-361.153) (-357.345) -- 0:00:07
      873500 -- [-356.709] (-359.061) (-358.961) (-357.173) * [-358.306] (-358.199) (-362.302) (-357.767) -- 0:00:07
      874000 -- (-356.403) (-360.253) (-357.593) [-358.789] * (-356.981) (-356.656) (-359.460) [-357.305] -- 0:00:07
      874500 -- [-357.027] (-359.436) (-358.358) (-356.538) * (-356.659) [-357.463] (-357.034) (-358.348) -- 0:00:07
      875000 -- (-357.211) (-360.514) (-356.708) [-363.833] * (-359.817) [-356.557] (-358.141) (-359.795) -- 0:00:07

      Average standard deviation of split frequencies: 0.009435

      875500 -- (-358.720) [-357.443] (-357.537) (-357.951) * (-359.221) (-357.202) (-358.031) [-358.440] -- 0:00:07
      876000 -- (-357.340) [-359.194] (-358.372) (-359.195) * (-358.790) (-356.566) [-357.640] (-361.758) -- 0:00:07
      876500 -- (-361.891) (-359.350) [-361.022] (-356.994) * (-358.099) (-357.227) (-358.587) [-359.428] -- 0:00:07
      877000 -- [-357.127] (-358.314) (-359.126) (-356.358) * [-356.331] (-357.723) (-360.842) (-358.942) -- 0:00:07
      877500 -- [-356.710] (-362.271) (-362.734) (-359.609) * [-357.885] (-358.498) (-357.510) (-358.611) -- 0:00:07
      878000 -- (-356.324) (-357.117) [-357.771] (-358.244) * (-359.164) (-360.151) (-356.734) [-356.701] -- 0:00:07
      878500 -- (-357.149) [-357.814] (-356.505) (-358.022) * [-356.813] (-356.974) (-356.533) (-356.410) -- 0:00:07
      879000 -- (-359.868) (-357.055) [-357.476] (-360.203) * (-357.590) (-358.967) (-358.669) [-356.757] -- 0:00:07
      879500 -- (-358.146) (-357.273) [-357.798] (-358.485) * (-358.051) [-359.618] (-358.062) (-357.424) -- 0:00:07
      880000 -- [-357.612] (-359.146) (-356.333) (-357.044) * [-358.147] (-359.993) (-358.765) (-356.493) -- 0:00:07

      Average standard deviation of split frequencies: 0.009171

      880500 -- [-357.860] (-357.812) (-359.255) (-357.562) * (-358.427) (-361.434) [-357.256] (-357.746) -- 0:00:07
      881000 -- [-357.787] (-360.776) (-360.619) (-357.882) * [-358.878] (-357.839) (-358.775) (-359.052) -- 0:00:07
      881500 -- (-359.182) (-360.466) (-360.396) [-356.820] * [-357.433] (-356.561) (-358.409) (-356.537) -- 0:00:06
      882000 -- (-356.919) [-360.196] (-360.548) (-356.749) * [-359.146] (-361.361) (-359.407) (-360.572) -- 0:00:06
      882500 -- (-356.278) [-357.654] (-360.917) (-357.693) * (-359.302) [-358.736] (-358.827) (-362.427) -- 0:00:06
      883000 -- (-356.705) [-360.341] (-358.256) (-358.491) * (-356.680) (-357.509) [-359.240] (-358.839) -- 0:00:07
      883500 -- [-358.126] (-357.683) (-359.162) (-359.788) * (-356.827) (-356.376) (-359.359) [-358.370] -- 0:00:06
      884000 -- (-362.738) [-357.396] (-358.949) (-359.112) * (-357.956) (-360.021) [-358.047] (-359.630) -- 0:00:06
      884500 -- (-359.645) (-358.099) (-357.242) [-360.443] * (-357.952) (-357.891) [-359.712] (-358.379) -- 0:00:06
      885000 -- [-358.939] (-356.514) (-359.896) (-357.430) * (-362.544) (-359.025) (-356.418) [-356.785] -- 0:00:06

      Average standard deviation of split frequencies: 0.008797

      885500 -- (-361.963) [-358.134] (-358.612) (-357.389) * [-356.458] (-360.976) (-356.182) (-360.273) -- 0:00:06
      886000 -- (-358.688) [-356.450] (-357.836) (-357.479) * (-359.648) [-358.986] (-358.178) (-358.183) -- 0:00:06
      886500 -- (-358.613) [-357.309] (-357.580) (-357.599) * (-358.997) [-359.988] (-357.316) (-357.860) -- 0:00:06
      887000 -- (-363.250) (-356.575) (-359.285) [-356.527] * [-359.108] (-360.278) (-357.457) (-359.027) -- 0:00:06
      887500 -- (-359.094) (-358.411) [-358.244] (-363.343) * [-356.630] (-361.681) (-357.146) (-356.991) -- 0:00:06
      888000 -- [-357.971] (-359.760) (-359.300) (-360.377) * (-357.692) (-361.391) [-356.675] (-360.059) -- 0:00:06
      888500 -- (-357.185) (-363.196) [-358.474] (-360.494) * (-359.504) (-358.104) [-358.154] (-356.411) -- 0:00:06
      889000 -- (-359.567) [-358.247] (-360.368) (-357.930) * [-357.177] (-357.300) (-358.173) (-356.806) -- 0:00:06
      889500 -- (-361.301) (-361.405) (-356.975) [-361.361] * [-357.314] (-357.411) (-356.236) (-357.558) -- 0:00:06
      890000 -- (-362.872) (-358.801) (-359.992) [-359.557] * (-358.206) [-356.364] (-357.280) (-356.854) -- 0:00:06

      Average standard deviation of split frequencies: 0.008468

      890500 -- [-361.357] (-358.281) (-357.709) (-361.685) * (-356.891) (-356.342) (-361.292) [-358.754] -- 0:00:06
      891000 -- [-360.077] (-358.012) (-359.212) (-357.930) * [-356.916] (-358.942) (-358.496) (-357.988) -- 0:00:06
      891500 -- (-357.897) (-356.237) [-359.115] (-356.995) * (-359.897) (-358.103) [-359.537] (-361.376) -- 0:00:06
      892000 -- (-361.066) [-355.940] (-359.663) (-357.781) * (-362.047) [-356.648] (-357.453) (-357.318) -- 0:00:06
      892500 -- (-358.638) (-358.398) [-359.655] (-359.049) * (-360.914) (-356.645) (-358.006) [-361.650] -- 0:00:06
      893000 -- (-357.169) (-358.031) (-361.567) [-360.416] * (-358.131) (-357.135) [-358.445] (-358.564) -- 0:00:06
      893500 -- (-357.937) [-359.669] (-356.360) (-356.674) * (-365.024) (-359.243) (-359.742) [-358.837] -- 0:00:06
      894000 -- (-357.176) [-357.575] (-357.004) (-359.679) * (-360.798) (-358.183) (-356.964) [-358.478] -- 0:00:06
      894500 -- [-356.839] (-357.812) (-357.014) (-357.510) * (-360.184) (-360.676) (-362.381) [-357.896] -- 0:00:06
      895000 -- (-358.380) [-359.200] (-357.820) (-358.567) * (-357.057) [-358.570] (-357.770) (-356.998) -- 0:00:06

      Average standard deviation of split frequencies: 0.008383

      895500 -- [-357.218] (-359.023) (-359.180) (-361.187) * (-358.561) (-361.423) (-361.168) [-356.912] -- 0:00:06
      896000 -- (-358.059) (-357.085) [-356.446] (-358.173) * (-357.553) [-359.893] (-360.319) (-358.722) -- 0:00:06
      896500 -- (-363.331) [-356.206] (-356.400) (-357.195) * (-363.298) (-358.200) (-356.984) [-356.358] -- 0:00:06
      897000 -- (-357.567) (-358.394) (-360.893) [-358.096] * (-360.854) [-360.700] (-356.917) (-359.762) -- 0:00:06
      897500 -- (-359.555) [-357.540] (-359.907) (-362.347) * [-358.807] (-357.651) (-356.735) (-359.178) -- 0:00:06
      898000 -- (-358.556) [-357.324] (-357.301) (-359.462) * [-357.562] (-363.138) (-358.982) (-359.017) -- 0:00:06
      898500 -- (-359.290) [-356.571] (-357.340) (-358.165) * (-356.452) (-360.649) [-360.291] (-356.756) -- 0:00:05
      899000 -- (-357.352) [-362.306] (-358.497) (-360.316) * (-357.207) (-359.161) (-363.480) [-361.014] -- 0:00:05
      899500 -- (-357.289) (-358.487) [-356.878] (-359.703) * (-358.405) (-357.011) [-357.323] (-358.655) -- 0:00:05
      900000 -- (-358.593) [-358.880] (-359.108) (-358.518) * (-356.723) [-356.883] (-359.141) (-362.043) -- 0:00:05

      Average standard deviation of split frequencies: 0.008479

      900500 -- [-358.440] (-359.899) (-359.270) (-359.724) * (-356.511) [-358.440] (-357.982) (-362.545) -- 0:00:05
      901000 -- (-356.901) (-357.263) [-357.388] (-357.057) * [-359.216] (-357.703) (-361.838) (-358.056) -- 0:00:05
      901500 -- (-356.882) (-357.607) [-360.201] (-359.905) * [-359.707] (-358.578) (-357.419) (-357.210) -- 0:00:05
      902000 -- (-359.998) [-358.553] (-357.980) (-357.836) * (-358.802) [-360.261] (-358.523) (-360.127) -- 0:00:05
      902500 -- (-367.301) [-360.311] (-359.605) (-356.984) * (-357.523) (-356.194) (-359.796) [-359.354] -- 0:00:05
      903000 -- (-359.909) [-360.355] (-358.867) (-358.011) * (-357.065) (-357.779) [-358.554] (-359.449) -- 0:00:05
      903500 -- [-363.215] (-358.658) (-357.074) (-358.107) * (-357.112) [-357.949] (-356.421) (-361.782) -- 0:00:05
      904000 -- (-356.887) [-359.172] (-356.211) (-359.144) * (-356.999) (-363.159) [-357.150] (-360.075) -- 0:00:05
      904500 -- (-357.885) (-356.299) (-357.075) [-357.944] * [-358.117] (-358.280) (-359.046) (-361.270) -- 0:00:05
      905000 -- (-360.477) [-358.083] (-357.610) (-358.247) * (-360.928) (-358.129) (-358.961) [-358.044] -- 0:00:05

      Average standard deviation of split frequencies: 0.008325

      905500 -- (-356.374) (-356.347) (-358.400) [-357.033] * (-362.480) [-360.640] (-357.503) (-358.636) -- 0:00:05
      906000 -- (-359.958) (-358.380) [-358.399] (-358.562) * (-359.641) (-362.997) (-357.399) [-360.064] -- 0:00:05
      906500 -- (-361.657) [-358.217] (-358.050) (-358.485) * (-357.946) [-358.764] (-357.114) (-358.203) -- 0:00:05
      907000 -- [-361.169] (-359.536) (-358.875) (-359.054) * (-357.701) (-358.750) [-357.208] (-357.046) -- 0:00:05
      907500 -- (-356.683) (-357.224) (-360.102) [-357.697] * (-358.421) [-356.563] (-359.877) (-363.258) -- 0:00:05
      908000 -- (-358.651) (-358.758) (-359.267) [-356.942] * [-356.493] (-356.747) (-356.922) (-357.254) -- 0:00:05
      908500 -- (-361.161) (-358.124) [-357.526] (-357.228) * (-359.758) (-359.346) (-357.546) [-357.342] -- 0:00:05
      909000 -- (-361.403) (-361.101) (-358.782) [-358.564] * [-360.595] (-356.449) (-358.032) (-357.991) -- 0:00:05
      909500 -- (-362.949) (-356.286) [-358.247] (-359.367) * (-358.561) [-358.025] (-359.303) (-357.343) -- 0:00:05
      910000 -- (-359.402) [-357.647] (-358.158) (-361.620) * (-359.999) (-357.775) (-359.453) [-356.987] -- 0:00:05

      Average standard deviation of split frequencies: 0.008627

      910500 -- (-364.900) [-358.125] (-357.782) (-356.891) * (-360.945) [-356.959] (-356.710) (-358.169) -- 0:00:05
      911000 -- (-362.831) (-357.007) [-356.350] (-359.867) * (-359.613) [-357.033] (-358.234) (-358.240) -- 0:00:05
      911500 -- (-360.871) [-357.193] (-357.424) (-359.515) * (-356.912) [-360.783] (-362.121) (-358.866) -- 0:00:05
      912000 -- (-363.886) [-357.192] (-360.979) (-358.717) * (-358.783) [-357.005] (-357.600) (-364.595) -- 0:00:05
      912500 -- [-359.064] (-357.128) (-357.233) (-358.292) * [-356.421] (-357.158) (-356.941) (-360.937) -- 0:00:05
      913000 -- [-358.839] (-362.035) (-356.994) (-359.482) * (-360.783) [-356.847] (-357.337) (-360.932) -- 0:00:05
      913500 -- (-357.741) [-359.775] (-357.237) (-361.639) * [-356.432] (-356.655) (-357.732) (-361.473) -- 0:00:05
      914000 -- (-359.864) [-357.141] (-357.470) (-360.099) * (-356.256) [-360.696] (-358.031) (-360.028) -- 0:00:05
      914500 -- (-359.011) (-362.166) (-359.678) [-358.820] * [-357.144] (-360.854) (-357.881) (-358.535) -- 0:00:05
      915000 -- (-358.479) (-357.430) [-358.309] (-359.221) * (-357.926) (-357.480) (-358.102) [-356.601] -- 0:00:05

      Average standard deviation of split frequencies: 0.008440

      915500 -- [-358.562] (-357.187) (-358.264) (-356.249) * (-356.489) (-358.210) (-359.832) [-357.980] -- 0:00:04
      916000 -- (-358.726) [-356.714] (-356.830) (-361.661) * [-358.417] (-357.349) (-361.592) (-356.778) -- 0:00:04
      916500 -- [-356.421] (-361.524) (-357.588) (-358.812) * (-356.752) [-356.207] (-360.840) (-357.293) -- 0:00:04
      917000 -- (-357.356) (-357.314) [-360.634] (-363.881) * (-358.590) (-357.155) (-357.983) [-357.789] -- 0:00:04
      917500 -- (-359.376) [-356.574] (-358.375) (-360.447) * (-357.701) (-359.089) (-356.832) [-359.385] -- 0:00:04
      918000 -- (-357.268) [-357.796] (-358.431) (-359.220) * [-356.004] (-358.614) (-357.891) (-359.293) -- 0:00:04
      918500 -- (-358.366) [-357.296] (-357.349) (-360.480) * (-356.639) (-358.881) [-360.787] (-360.731) -- 0:00:04
      919000 -- (-357.633) (-358.612) (-357.519) [-356.427] * (-357.756) [-360.155] (-359.833) (-361.102) -- 0:00:04
      919500 -- [-358.410] (-357.155) (-359.778) (-357.097) * (-357.747) (-357.289) (-358.468) [-361.362] -- 0:00:04
      920000 -- (-359.651) (-358.209) [-357.832] (-358.524) * (-360.179) (-358.465) (-358.004) [-357.390] -- 0:00:04

      Average standard deviation of split frequencies: 0.008431

      920500 -- (-357.509) [-362.633] (-356.883) (-356.847) * [-357.476] (-359.675) (-358.083) (-357.757) -- 0:00:04
      921000 -- [-364.214] (-359.258) (-359.220) (-356.842) * (-359.903) [-358.981] (-356.589) (-359.082) -- 0:00:04
      921500 -- (-363.896) (-357.522) (-367.565) [-362.777] * (-361.491) (-358.434) (-358.220) [-358.139] -- 0:00:04
      922000 -- [-360.001] (-358.043) (-360.502) (-363.528) * (-359.406) (-360.867) (-358.788) [-357.951] -- 0:00:04
      922500 -- [-359.221] (-357.436) (-358.615) (-359.268) * (-358.092) (-358.367) (-359.552) [-357.934] -- 0:00:04
      923000 -- (-357.548) (-358.234) (-357.241) [-361.676] * (-359.946) (-358.632) (-359.971) [-358.856] -- 0:00:04
      923500 -- (-358.953) (-357.568) (-360.079) [-361.932] * (-356.646) [-361.733] (-358.193) (-356.918) -- 0:00:04
      924000 -- [-357.730] (-358.482) (-361.337) (-359.153) * (-356.700) [-361.206] (-357.915) (-358.555) -- 0:00:04
      924500 -- [-357.393] (-357.596) (-356.218) (-361.072) * (-356.408) (-365.826) (-357.468) [-357.964] -- 0:00:04
      925000 -- [-357.260] (-360.724) (-357.601) (-366.377) * (-356.401) (-356.734) [-359.450] (-357.419) -- 0:00:04

      Average standard deviation of split frequencies: 0.008383

      925500 -- (-359.534) (-360.110) (-359.534) [-359.224] * (-357.604) [-356.977] (-357.412) (-359.027) -- 0:00:04
      926000 -- (-356.598) (-360.947) [-357.667] (-358.426) * (-357.169) [-357.620] (-358.133) (-358.682) -- 0:00:04
      926500 -- (-358.847) (-362.040) [-356.521] (-359.626) * (-357.405) (-360.145) (-357.585) [-356.839] -- 0:00:04
      927000 -- (-358.054) (-357.566) (-356.884) [-358.103] * (-357.141) (-357.723) (-361.004) [-356.153] -- 0:00:04
      927500 -- (-361.769) (-357.787) [-359.578] (-357.481) * [-358.733] (-357.242) (-358.699) (-356.403) -- 0:00:04
      928000 -- (-358.602) (-358.318) [-360.487] (-358.332) * [-360.809] (-358.165) (-359.186) (-359.077) -- 0:00:04
      928500 -- (-358.209) [-357.117] (-358.273) (-359.028) * (-358.930) [-356.358] (-359.565) (-360.259) -- 0:00:04
      929000 -- [-359.178] (-359.038) (-359.684) (-361.807) * (-366.173) (-358.914) [-357.187] (-358.271) -- 0:00:04
      929500 -- [-360.566] (-360.111) (-358.520) (-357.665) * (-357.250) (-360.503) [-361.548] (-359.927) -- 0:00:04
      930000 -- (-359.886) (-357.851) [-356.961] (-360.604) * (-359.173) (-357.217) [-358.649] (-357.009) -- 0:00:04

      Average standard deviation of split frequencies: 0.008239

      930500 -- (-357.531) (-362.030) [-357.338] (-359.148) * [-356.768] (-357.439) (-356.495) (-357.258) -- 0:00:04
      931000 -- (-360.622) [-357.477] (-358.237) (-364.866) * [-362.229] (-357.816) (-357.252) (-357.812) -- 0:00:04
      931500 -- (-364.255) [-357.891] (-359.848) (-357.121) * [-358.516] (-356.034) (-357.284) (-361.720) -- 0:00:04
      932000 -- (-360.165) [-357.533] (-360.398) (-357.846) * (-360.814) (-356.604) [-358.459] (-361.060) -- 0:00:04
      932500 -- (-363.245) (-358.722) [-357.078] (-357.730) * (-358.575) [-356.010] (-359.029) (-359.453) -- 0:00:03
      933000 -- (-358.617) (-360.441) (-359.320) [-359.374] * (-356.834) [-356.745] (-356.509) (-360.417) -- 0:00:03
      933500 -- [-357.359] (-357.796) (-360.667) (-357.710) * (-359.493) (-356.520) (-360.911) [-357.901] -- 0:00:03
      934000 -- (-358.105) (-357.858) (-362.200) [-361.671] * (-358.395) (-358.547) [-359.003] (-364.386) -- 0:00:03
      934500 -- (-358.152) (-356.430) (-357.557) [-358.741] * (-357.387) (-360.236) [-358.578] (-359.554) -- 0:00:03
      935000 -- (-359.902) (-356.935) (-357.552) [-357.968] * (-356.708) (-358.144) (-359.470) [-356.869] -- 0:00:03

      Average standard deviation of split frequencies: 0.008394

      935500 -- (-356.844) [-356.983] (-359.509) (-360.959) * (-356.838) (-356.580) (-357.260) [-360.616] -- 0:00:03
      936000 -- (-358.014) [-359.670] (-357.117) (-358.545) * (-356.508) (-357.344) (-358.537) [-359.177] -- 0:00:03
      936500 -- (-356.864) (-357.407) (-360.576) [-357.601] * (-356.837) (-363.947) [-356.601] (-358.152) -- 0:00:03
      937000 -- (-356.684) (-360.373) (-361.719) [-357.400] * (-359.543) (-358.797) [-359.365] (-358.899) -- 0:00:03
      937500 -- [-357.322] (-360.040) (-360.991) (-358.041) * (-357.739) (-359.160) [-360.277] (-358.286) -- 0:00:03
      938000 -- (-356.843) (-359.007) (-364.379) [-360.079] * [-357.685] (-362.597) (-359.185) (-361.529) -- 0:00:03
      938500 -- [-358.663] (-357.515) (-360.015) (-360.587) * [-357.209] (-357.808) (-356.412) (-359.742) -- 0:00:03
      939000 -- (-358.728) (-357.883) (-358.937) [-358.872] * (-357.639) (-358.079) [-356.445] (-359.274) -- 0:00:03
      939500 -- (-358.451) (-365.979) [-361.426] (-360.345) * (-359.799) (-359.389) (-356.567) [-357.762] -- 0:00:03
      940000 -- (-363.077) [-357.391] (-357.975) (-360.668) * (-356.033) [-357.514] (-358.140) (-356.562) -- 0:00:03

      Average standard deviation of split frequencies: 0.008486

      940500 -- (-359.239) [-357.377] (-358.164) (-357.637) * (-356.136) (-358.751) (-358.090) [-358.520] -- 0:00:03
      941000 -- (-359.604) [-358.329] (-356.235) (-361.222) * [-357.809] (-363.487) (-359.706) (-359.016) -- 0:00:03
      941500 -- [-360.822] (-357.452) (-357.768) (-358.393) * (-359.033) [-358.685] (-358.440) (-357.221) -- 0:00:03
      942000 -- (-359.045) [-357.370] (-357.877) (-356.728) * (-361.212) (-358.517) (-358.325) [-358.955] -- 0:00:03
      942500 -- [-358.332] (-357.590) (-357.723) (-356.929) * (-358.217) (-356.757) (-356.916) [-362.657] -- 0:00:03
      943000 -- [-357.064] (-357.162) (-358.072) (-359.414) * (-357.256) (-359.270) (-356.999) [-358.096] -- 0:00:03
      943500 -- (-360.600) (-358.505) [-358.044] (-358.686) * [-359.246] (-356.767) (-358.096) (-359.072) -- 0:00:03
      944000 -- (-357.686) (-359.124) [-357.192] (-359.064) * (-358.748) [-357.264] (-358.747) (-358.275) -- 0:00:03
      944500 -- (-359.334) (-358.190) (-356.293) [-356.835] * (-357.580) (-361.139) (-356.935) [-360.933] -- 0:00:03
      945000 -- (-356.558) (-357.203) (-360.819) [-356.626] * (-357.157) [-356.816] (-358.167) (-364.066) -- 0:00:03

      Average standard deviation of split frequencies: 0.008405

      945500 -- (-356.890) [-356.475] (-361.197) (-356.794) * [-357.158] (-357.007) (-360.079) (-361.521) -- 0:00:03
      946000 -- [-357.491] (-357.730) (-359.013) (-358.216) * (-359.923) (-356.975) (-360.704) [-360.682] -- 0:00:03
      946500 -- [-358.785] (-359.007) (-356.897) (-358.114) * [-362.020] (-358.153) (-360.561) (-358.875) -- 0:00:03
      947000 -- (-358.460) (-358.789) (-358.402) [-359.040] * (-364.383) (-358.409) [-360.746] (-359.391) -- 0:00:03
      947500 -- (-357.845) (-359.163) (-358.232) [-359.047] * [-356.316] (-358.292) (-359.933) (-357.038) -- 0:00:03
      948000 -- (-356.543) [-359.567] (-357.534) (-358.663) * (-357.839) (-358.428) (-360.547) [-360.111] -- 0:00:03
      948500 -- [-356.886] (-362.551) (-359.683) (-357.207) * (-356.553) [-358.879] (-362.496) (-361.953) -- 0:00:03
      949000 -- (-359.510) (-358.649) [-358.531] (-357.235) * (-360.125) [-357.110] (-358.959) (-362.942) -- 0:00:03
      949500 -- [-358.446] (-363.090) (-360.345) (-360.251) * (-357.972) (-357.522) [-357.399] (-360.041) -- 0:00:02
      950000 -- [-356.916] (-358.305) (-357.721) (-361.120) * (-358.465) (-356.976) [-356.363] (-359.574) -- 0:00:02

      Average standard deviation of split frequencies: 0.008231

      950500 -- (-357.381) (-360.904) [-358.112] (-359.818) * (-356.625) [-357.213] (-358.621) (-358.428) -- 0:00:02
      951000 -- (-357.845) (-359.917) [-356.701] (-358.660) * (-361.555) (-359.021) [-357.692] (-359.280) -- 0:00:02
      951500 -- (-358.268) (-359.397) [-356.212] (-358.027) * (-362.184) (-360.276) (-359.375) [-358.200] -- 0:00:02
      952000 -- (-357.763) [-364.464] (-356.786) (-358.174) * (-359.497) [-359.409] (-359.025) (-360.346) -- 0:00:02
      952500 -- (-360.086) (-359.385) (-356.863) [-360.157] * [-356.814] (-357.429) (-357.290) (-357.263) -- 0:00:02
      953000 -- (-359.925) (-357.277) (-362.668) [-358.512] * (-358.465) (-359.420) (-360.899) [-357.844] -- 0:00:02
      953500 -- (-357.710) (-357.996) (-358.450) [-360.075] * [-365.348] (-359.978) (-358.743) (-357.839) -- 0:00:02
      954000 -- (-356.542) [-360.048] (-357.730) (-359.427) * (-357.807) (-359.210) (-358.541) [-359.258] -- 0:00:02
      954500 -- (-357.523) (-357.703) (-357.590) [-359.634] * [-357.950] (-360.686) (-358.579) (-358.363) -- 0:00:02
      955000 -- (-358.502) (-360.267) (-360.235) [-360.506] * (-359.629) [-357.846] (-358.688) (-357.651) -- 0:00:02

      Average standard deviation of split frequencies: 0.008514

      955500 -- (-357.822) (-360.294) (-358.359) [-362.879] * (-362.664) (-357.301) (-356.210) [-357.302] -- 0:00:02
      956000 -- (-360.005) [-357.016] (-359.563) (-364.036) * [-361.402] (-357.340) (-356.871) (-359.571) -- 0:00:02
      956500 -- (-359.968) (-359.519) (-359.635) [-356.768] * (-357.604) [-356.224] (-359.730) (-359.486) -- 0:00:02
      957000 -- (-358.342) (-358.576) [-357.550] (-356.627) * (-357.382) (-357.168) [-357.279] (-357.376) -- 0:00:02
      957500 -- (-360.307) [-359.360] (-357.203) (-356.621) * [-360.107] (-357.237) (-359.882) (-359.375) -- 0:00:02
      958000 -- (-358.079) (-359.494) (-356.756) [-356.968] * [-357.514] (-357.948) (-356.600) (-359.366) -- 0:00:02
      958500 -- (-358.516) (-357.543) [-358.110] (-357.727) * (-357.632) [-359.053] (-359.625) (-357.893) -- 0:00:02
      959000 -- (-358.017) (-358.274) [-356.653] (-359.184) * (-359.112) (-357.616) [-359.006] (-357.641) -- 0:00:02
      959500 -- (-360.790) (-357.659) [-357.104] (-359.490) * (-358.995) [-357.404] (-357.691) (-358.678) -- 0:00:02
      960000 -- (-363.928) (-357.091) [-358.601] (-361.018) * [-357.714] (-358.318) (-357.980) (-358.809) -- 0:00:02

      Average standard deviation of split frequencies: 0.008833

      960500 -- [-357.897] (-357.613) (-360.752) (-358.695) * (-359.035) (-357.718) (-357.300) [-358.883] -- 0:00:02
      961000 -- (-359.357) [-359.344] (-367.429) (-356.510) * (-360.640) [-357.109] (-356.895) (-365.110) -- 0:00:02
      961500 -- (-358.313) (-357.214) (-357.290) [-356.421] * (-358.594) [-359.306] (-356.712) (-361.587) -- 0:00:02
      962000 -- [-366.210] (-357.966) (-357.951) (-356.809) * (-358.088) (-358.354) [-359.031] (-357.736) -- 0:00:02
      962500 -- (-358.791) (-357.568) (-360.824) [-356.323] * (-360.457) [-357.177] (-363.122) (-358.935) -- 0:00:02
      963000 -- (-359.414) (-356.408) (-364.233) [-360.750] * (-359.866) [-358.483] (-357.324) (-359.589) -- 0:00:02
      963500 -- (-358.286) (-356.414) [-358.558] (-359.610) * (-356.033) [-356.646] (-358.846) (-357.790) -- 0:00:02
      964000 -- (-358.237) [-356.669] (-360.258) (-361.581) * (-356.851) (-356.820) [-358.527] (-357.212) -- 0:00:02
      964500 -- [-357.097] (-360.880) (-358.663) (-359.442) * (-356.689) [-356.844] (-356.476) (-357.846) -- 0:00:02
      965000 -- (-356.697) (-359.974) (-357.840) [-362.488] * [-358.430] (-358.088) (-359.248) (-358.036) -- 0:00:02

      Average standard deviation of split frequencies: 0.009142

      965500 -- (-357.263) (-361.233) [-358.369] (-361.534) * (-359.241) (-358.554) [-357.419] (-357.546) -- 0:00:02
      966000 -- (-356.179) [-359.040] (-362.142) (-364.699) * (-357.230) (-358.570) [-356.244] (-359.172) -- 0:00:02
      966500 -- (-356.910) [-361.259] (-359.058) (-362.246) * [-359.636] (-356.663) (-358.031) (-358.977) -- 0:00:01
      967000 -- (-360.657) [-357.960] (-362.104) (-360.095) * (-358.419) [-357.603] (-359.737) (-356.421) -- 0:00:01
      967500 -- (-357.256) (-357.325) (-359.981) [-359.075] * (-356.866) (-357.786) [-356.988] (-356.336) -- 0:00:01
      968000 -- (-363.570) [-358.934] (-358.247) (-358.199) * (-362.519) (-356.664) [-356.415] (-358.707) -- 0:00:01
      968500 -- (-360.131) (-360.505) (-357.420) [-358.103] * (-360.383) (-357.889) [-360.407] (-362.482) -- 0:00:01
      969000 -- (-360.876) (-358.121) (-360.576) [-358.194] * (-357.132) [-361.402] (-357.514) (-361.651) -- 0:00:01
      969500 -- (-358.475) (-360.765) (-357.418) [-359.211] * (-356.714) (-357.077) [-359.560] (-360.455) -- 0:00:01
      970000 -- [-357.044] (-362.650) (-363.764) (-361.206) * (-356.328) (-356.542) (-362.121) [-359.423] -- 0:00:01

      Average standard deviation of split frequencies: 0.008709

      970500 -- [-358.206] (-358.767) (-357.407) (-358.051) * [-357.399] (-356.169) (-361.769) (-357.368) -- 0:00:01
      971000 -- (-359.418) [-358.039] (-357.616) (-356.916) * (-357.746) (-357.236) (-361.743) [-357.052] -- 0:00:01
      971500 -- (-358.052) (-357.708) [-361.069] (-361.853) * (-358.388) (-358.307) (-356.416) [-358.045] -- 0:00:01
      972000 -- (-360.826) (-359.682) (-360.175) [-362.493] * [-357.024] (-357.384) (-358.619) (-357.852) -- 0:00:01
      972500 -- [-360.023] (-357.668) (-361.071) (-357.845) * (-357.187) (-357.030) [-357.749] (-356.603) -- 0:00:01
      973000 -- (-361.251) [-356.737] (-359.219) (-359.072) * (-356.425) (-357.027) [-357.810] (-358.500) -- 0:00:01
      973500 -- [-357.392] (-357.061) (-358.836) (-359.200) * (-357.997) (-360.575) (-357.924) [-360.661] -- 0:00:01
      974000 -- (-360.428) [-360.629] (-358.056) (-361.254) * (-358.332) (-358.436) (-357.242) [-358.682] -- 0:00:01
      974500 -- (-358.435) (-361.457) (-361.608) [-362.181] * (-359.244) (-359.037) [-357.066] (-357.509) -- 0:00:01
      975000 -- (-359.619) (-358.422) [-360.325] (-359.223) * [-356.993] (-359.646) (-356.427) (-357.892) -- 0:00:01

      Average standard deviation of split frequencies: 0.008919

      975500 -- [-358.120] (-356.949) (-359.973) (-357.641) * (-358.508) [-360.241] (-358.288) (-361.905) -- 0:00:01
      976000 -- [-358.634] (-362.864) (-358.268) (-358.041) * (-356.810) [-356.652] (-356.573) (-358.380) -- 0:00:01
      976500 -- [-357.117] (-363.487) (-362.157) (-357.645) * [-356.069] (-358.316) (-357.462) (-365.253) -- 0:00:01
      977000 -- (-358.107) [-359.969] (-361.618) (-358.094) * (-357.992) (-357.058) (-358.341) [-356.722] -- 0:00:01
      977500 -- (-359.406) [-357.466] (-357.386) (-358.200) * (-361.886) (-357.857) (-359.656) [-357.609] -- 0:00:01
      978000 -- (-359.205) (-357.050) [-357.669] (-357.151) * (-358.995) (-360.278) [-359.062] (-360.223) -- 0:00:01
      978500 -- (-360.082) [-356.310] (-358.524) (-356.636) * (-358.139) (-359.005) [-356.945] (-356.531) -- 0:00:01
      979000 -- (-357.093) (-359.736) (-359.193) [-357.250] * (-358.534) (-356.350) (-359.417) [-356.407] -- 0:00:01
      979500 -- [-357.476] (-358.987) (-357.276) (-356.719) * (-357.634) (-357.748) [-358.830] (-357.583) -- 0:00:01
      980000 -- [-357.090] (-357.519) (-358.028) (-356.857) * (-356.936) (-359.748) [-358.499] (-358.256) -- 0:00:01

      Average standard deviation of split frequencies: 0.008909

      980500 -- [-360.136] (-357.687) (-360.180) (-357.811) * [-359.902] (-361.210) (-359.536) (-359.693) -- 0:00:01
      981000 -- (-360.023) (-359.402) [-356.278] (-357.214) * (-358.837) (-359.038) [-356.939] (-363.429) -- 0:00:01
      981500 -- [-358.638] (-360.130) (-357.254) (-356.382) * [-356.733] (-362.260) (-357.414) (-362.473) -- 0:00:01
      982000 -- (-359.378) (-359.487) (-360.972) [-359.531] * (-357.622) (-361.500) [-360.382] (-361.215) -- 0:00:01
      982500 -- (-357.979) (-361.339) (-362.994) [-357.232] * (-357.565) (-358.731) [-359.663] (-358.269) -- 0:00:01
      983000 -- (-356.601) [-356.647] (-360.422) (-358.445) * (-359.167) (-356.600) (-362.244) [-359.446] -- 0:00:01
      983500 -- [-357.221] (-357.478) (-356.555) (-356.670) * (-358.775) (-357.959) [-358.760] (-358.384) -- 0:00:00
      984000 -- [-358.509] (-356.521) (-360.131) (-357.794) * (-359.839) (-357.205) (-357.794) [-360.809] -- 0:00:00
      984500 -- (-361.416) [-356.759] (-363.229) (-359.132) * (-360.460) (-356.465) (-358.580) [-359.362] -- 0:00:00
      985000 -- (-357.865) (-356.450) (-358.815) [-356.656] * (-357.456) (-362.499) [-357.341] (-357.811) -- 0:00:00

      Average standard deviation of split frequencies: 0.008510

      985500 -- (-359.392) (-357.118) [-356.837] (-363.818) * [-356.403] (-358.249) (-356.313) (-357.099) -- 0:00:00
      986000 -- (-358.214) (-358.391) [-357.887] (-366.867) * [-357.056] (-359.326) (-356.674) (-357.654) -- 0:00:00
      986500 -- (-356.870) [-359.840] (-356.861) (-358.217) * (-356.719) (-361.670) (-357.191) [-360.019] -- 0:00:00
      987000 -- (-358.944) [-357.875] (-356.761) (-360.843) * [-358.747] (-359.381) (-357.019) (-360.515) -- 0:00:00
      987500 -- (-359.648) (-358.074) (-360.420) [-358.962] * (-362.633) [-359.791] (-357.000) (-361.664) -- 0:00:00
      988000 -- (-365.231) (-357.457) (-360.316) [-361.055] * (-358.640) [-356.390] (-358.105) (-360.935) -- 0:00:00
      988500 -- (-362.360) (-360.646) [-357.727] (-361.079) * (-356.718) (-362.042) [-357.455] (-360.396) -- 0:00:00
      989000 -- (-358.900) [-361.819] (-364.237) (-358.083) * (-357.040) (-359.929) (-358.610) [-361.846] -- 0:00:00
      989500 -- (-356.657) (-358.344) [-359.138] (-358.082) * [-356.999] (-358.602) (-357.878) (-362.356) -- 0:00:00
      990000 -- (-357.370) (-358.567) [-357.198] (-358.920) * [-358.328] (-362.063) (-359.072) (-357.817) -- 0:00:00

      Average standard deviation of split frequencies: 0.008375

      990500 -- [-358.196] (-357.012) (-356.942) (-358.526) * (-358.064) (-357.201) (-358.094) [-356.566] -- 0:00:00
      991000 -- [-357.708] (-357.194) (-359.113) (-357.779) * (-358.071) (-359.081) [-358.477] (-358.110) -- 0:00:00
      991500 -- (-358.565) (-357.827) (-358.673) [-357.023] * (-359.779) (-362.672) (-356.613) [-357.905] -- 0:00:00
      992000 -- (-359.720) (-357.652) [-356.664] (-358.214) * (-360.074) (-357.947) (-359.471) [-363.355] -- 0:00:00
      992500 -- [-357.211] (-357.360) (-357.519) (-357.855) * (-358.730) [-357.399] (-357.939) (-362.281) -- 0:00:00
      993000 -- (-356.682) [-360.576] (-360.122) (-357.835) * (-359.251) [-358.148] (-358.860) (-361.232) -- 0:00:00
      993500 -- (-357.950) (-358.167) (-358.157) [-357.412] * (-357.290) [-356.675] (-361.003) (-357.284) -- 0:00:00
      994000 -- (-358.396) [-357.503] (-362.488) (-356.665) * (-358.920) (-356.856) [-360.632] (-358.394) -- 0:00:00
      994500 -- (-360.344) (-358.722) (-362.878) [-355.918] * (-361.419) (-356.797) (-361.738) [-358.225] -- 0:00:00
      995000 -- (-360.505) [-357.541] (-358.050) (-357.023) * (-358.642) [-356.441] (-357.272) (-361.434) -- 0:00:00

      Average standard deviation of split frequencies: 0.008267

      995500 -- [-358.974] (-358.222) (-357.310) (-356.831) * (-357.679) [-357.236] (-357.991) (-357.840) -- 0:00:00
      996000 -- [-358.733] (-357.445) (-357.093) (-362.595) * [-355.991] (-357.879) (-357.982) (-357.354) -- 0:00:00
      996500 -- (-357.497) (-360.784) (-356.285) [-357.926] * [-357.291] (-357.676) (-358.801) (-356.387) -- 0:00:00
      997000 -- (-357.133) [-358.978] (-356.403) (-359.705) * (-359.553) (-358.004) (-357.699) [-358.339] -- 0:00:00
      997500 -- (-356.070) (-358.217) [-357.021] (-362.282) * [-358.802] (-359.039) (-360.736) (-361.233) -- 0:00:00
      998000 -- (-360.814) [-357.976] (-361.369) (-358.741) * (-363.739) [-356.881] (-358.630) (-356.286) -- 0:00:00
      998500 -- [-359.416] (-359.739) (-361.690) (-356.988) * (-360.432) (-358.491) (-361.881) [-357.305] -- 0:00:00
      999000 -- [-357.067] (-357.610) (-356.960) (-359.367) * [-359.381] (-356.618) (-357.736) (-360.546) -- 0:00:00
      999500 -- [-361.645] (-360.627) (-356.467) (-359.984) * (-360.463) [-360.258] (-359.596) (-361.042) -- 0:00:00
      1000000 -- [-358.677] (-359.258) (-356.513) (-356.852) * (-358.221) [-358.274] (-362.072) (-357.686) -- 0:00:00

      Average standard deviation of split frequencies: 0.008166

      Analysis completed in 59 seconds
      Analysis used 57.87 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -355.87
      Likelihood of best state for "cold" chain of run 2 was -355.87

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            74.8 %     ( 68 %)     Dirichlet(Revmat{all})
           100.0 %     (100 %)     Slider(Revmat{all})
            42.0 %     ( 30 %)     Dirichlet(Pi{all})
            40.0 %     ( 33 %)     Slider(Pi{all})
            78.8 %     ( 54 %)     Multiplier(Alpha{1,2})
            77.9 %     ( 46 %)     Multiplier(Alpha{3})
            26.1 %     ( 25 %)     Slider(Pinvar{all})
            98.6 %     ( 99 %)     ExtSPR(Tau{all},V{all})
            70.0 %     ( 71 %)     ExtTBR(Tau{all},V{all})
           100.0 %     (100 %)     NNI(Tau{all},V{all})
            89.3 %     ( 86 %)     ParsSPR(Tau{all},V{all})
            28.1 %     ( 26 %)     Multiplier(V{all})
            97.4 %     ( 98 %)     Nodeslider(V{all})
            30.8 %     ( 24 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            74.9 %     ( 69 %)     Dirichlet(Revmat{all})
            99.9 %     (100 %)     Slider(Revmat{all})
            42.4 %     ( 26 %)     Dirichlet(Pi{all})
            40.6 %     ( 29 %)     Slider(Pi{all})
            78.4 %     ( 57 %)     Multiplier(Alpha{1,2})
            77.1 %     ( 49 %)     Multiplier(Alpha{3})
            26.1 %     ( 25 %)     Slider(Pinvar{all})
            98.6 %     (100 %)     ExtSPR(Tau{all},V{all})
            70.4 %     ( 77 %)     ExtTBR(Tau{all},V{all})
           100.0 %     (100 %)     NNI(Tau{all},V{all})
            89.4 %     ( 90 %)     ParsSPR(Tau{all},V{all})
            28.3 %     ( 26 %)     Multiplier(V{all})
            97.3 %     ( 99 %)     Nodeslider(V{all})
            30.5 %     ( 22 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  167137            0.83    0.67 
         3 |  166507  166640            0.84 
         4 |  166248  166455  167013         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  166714            0.82    0.67 
         3 |  166059  166526            0.84 
         4 |  167093  167087  166521         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -357.37
      |                                           2                |
      |                                                            |
      |                               2   2  1  2                  |
      |             222          1   2                2          1 |
      |22    222           1    12                1 1   2          |
      |1 2      11 11 1  2  1              1   1 1     * 2      2  |
      |                 1     2 2   1   121          2   122 *1  22|
      | 1       2 1    12   2112    2 1* 1 2     2      1 1 2  2  1|
      |   22* 11  22   2  2    1  22 1       21 1  *2      1       |
      |    1         1    1  2    1         *        1        2    |
      |      1   2       1                    2                1   |
      |  1                         1                        1   1  |
      |                                 2      2      1            |
      |                                                            |
      |   1                2                                       |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -359.49
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -357.66          -361.38
        2       -357.54          -360.81
      --------------------------------------
      TOTAL     -357.60          -361.13
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.896243    0.090088    0.362521    1.486402    0.859692   1304.86   1340.46    1.000
      r(A<->C){all}   0.175273    0.020877    0.000072    0.457714    0.138481     99.13    140.99    1.018
      r(A<->G){all}   0.181522    0.023705    0.000069    0.499833    0.140704    116.62    170.95    1.000
      r(A<->T){all}   0.159703    0.019039    0.000001    0.436356    0.121572     56.92    135.00    1.001
      r(C<->G){all}   0.157666    0.017880    0.000022    0.414003    0.121123    239.69    241.98    1.003
      r(C<->T){all}   0.165805    0.018743    0.000077    0.431658    0.132110    192.24    219.46    1.001
      r(G<->T){all}   0.160031    0.018163    0.000006    0.433201    0.124703    217.10    237.86    1.005
      pi(A){all}      0.169932    0.000539    0.127435    0.216924    0.169193   1416.22   1427.68    1.000
      pi(C){all}      0.260254    0.000714    0.207450    0.311879    0.259647   1032.67   1241.17    1.000
      pi(G){all}      0.313465    0.000816    0.256586    0.366743    0.313187   1301.24   1315.33    1.000
      pi(T){all}      0.256349    0.000711    0.207947    0.311414    0.255557   1213.15   1357.07    1.000
      alpha{1,2}      0.411468    0.225909    0.000177    1.382476    0.238897   1202.76   1351.88    1.000
      alpha{3}        0.435563    0.223610    0.000318    1.381044    0.276053   1333.63   1342.50    1.000
      pinvar{all}     0.993478    0.000063    0.977174    0.999998    0.996087   1171.04   1304.09    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6

   Key to taxon bipartitions (saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ------------
    1 -- .*****
    2 -- .*....
    3 -- ..*...
    4 -- ...*..
    5 -- ....*.
    6 -- .....*
    7 -- .**.**
    8 -- .*...*
    9 -- ....**
   10 -- .**...
   11 -- ..*.*.
   12 -- ..****
   13 -- .*.*..
   14 -- ...**.
   15 -- .***.*
   16 -- ...*.*
   17 -- .*.***
   18 -- .****.
   19 -- ..**..
   20 -- .*..*.
   21 -- ..*..*
   ------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    7   451    0.150233    0.004240    0.147235    0.153231    2
    8   447    0.148901    0.003298    0.146569    0.151233    2
    9   446    0.148568    0.005653    0.144570    0.152565    2
   10   438    0.145903    0.014133    0.135909    0.155896    2
   11   437    0.145570    0.007066    0.140573    0.150566    2
   12   431    0.143571    0.013662    0.133911    0.153231    2
   13   424    0.141239    0.001884    0.139907    0.142572    2
   14   424    0.141239    0.000000    0.141239    0.141239    2
   15   419    0.139574    0.013662    0.129913    0.149234    2
   16   418    0.139241    0.003769    0.136576    0.141905    2
   17   418    0.139241    0.004711    0.135909    0.142572    2
   18   415    0.138241    0.008951    0.131912    0.144570    2
   19   415    0.138241    0.011777    0.129913    0.146569    2
   20   412    0.137242    0.019786    0.123251    0.151233    2
   21   411    0.136909    0.009893    0.129913    0.143904    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.098528    0.009206    0.000035    0.299177    0.069859    1.000    2
   length{all}[2]     0.099360    0.010202    0.000014    0.283952    0.068122    1.000    2
   length{all}[3]     0.095728    0.009181    0.000059    0.288614    0.067653    1.000    2
   length{all}[4]     0.100910    0.009918    0.000047    0.294722    0.071168    1.001    2
   length{all}[5]     0.099768    0.009677    0.000009    0.297368    0.071126    1.000    2
   length{all}[6]     0.100121    0.009909    0.000008    0.306730    0.066499    1.000    2
   length{all}[7]     0.098843    0.009107    0.000315    0.303927    0.065663    0.998    2
   length{all}[8]     0.095460    0.008573    0.000201    0.284820    0.067679    1.001    2
   length{all}[9]     0.101976    0.008945    0.000770    0.309240    0.073079    1.002    2
   length{all}[10]    0.091807    0.008732    0.000037    0.286563    0.065204    0.999    2
   length{all}[11]    0.100535    0.009400    0.000029    0.285553    0.076364    0.998    2
   length{all}[12]    0.094497    0.008455    0.000204    0.274323    0.065993    0.998    2
   length{all}[13]    0.097354    0.010150    0.000000    0.286096    0.067666    1.002    2
   length{all}[14]    0.102506    0.011291    0.000007    0.309024    0.071573    0.998    2
   length{all}[15]    0.102671    0.010899    0.000074    0.311729    0.074713    0.999    2
   length{all}[16]    0.097142    0.010250    0.000121    0.298617    0.060545    0.998    2
   length{all}[17]    0.100978    0.010040    0.000009    0.304777    0.072758    0.998    2
   length{all}[18]    0.102658    0.008999    0.000041    0.299405    0.072115    0.998    2
   length{all}[19]    0.093530    0.007451    0.000162    0.256399    0.067781    1.005    2
   length{all}[20]    0.110185    0.013366    0.000384    0.301477    0.075358    1.003    2
   length{all}[21]    0.107655    0.010358    0.000214    0.332055    0.079624    0.998    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.008166
       Maximum standard deviation of split frequencies = 0.019786
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.005


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |------------------------------------------------------------------------ C2 (2)
   |                                                                               
   |------------------------------------------------------------------------ C3 (3)
   +                                                                               
   |------------------------------------------------------------------------ C4 (4)
   |                                                                               
   |------------------------------------------------------------------------ C5 (5)
   |                                                                               
   \------------------------------------------------------------------------ C6 (6)
                                                                                   

   Phylogram (based on average branch lengths):

   /----------------------------------------------------------------------- C1 (1)
   |                                                                               
   |--------------------------------------------------------------------- C2 (2)
   |                                                                               
   |-------------------------------------------------------------------- C3 (3)
   +                                                                               
   |------------------------------------------------------------------------ C4 (4)
   |                                                                               
   |------------------------------------------------------------------------ C5 (5)
   |                                                                               
   \------------------------------------------------------------------- C6 (6)
                                                                                   
   |---------| 0.010 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (105 trees sampled):
      50 % credible set contains 46 trees
      90 % credible set contains 91 trees
      95 % credible set contains 98 trees
      99 % credible set contains 104 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.9h, March 2018

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  7  8

seq file is not paml/phylip format.  Trying nexus format.ns = 6  	ls = 261
Reading sequences, sequential format..
Reading seq # 1: C1       
Reading seq # 2: C2       
Reading seq # 3: C3       
Reading seq # 4: C4       
Reading seq # 5: C5       
Reading seq # 6: C6       
Sequences read..
Counting site patterns..  0:00

Compressing,     40 patterns at     87 /     87 sites (100.0%),  0:00

Collecting fpatt[] & pose[],     40 patterns at     87 /     87 sites (100.0%),  0:00
Counting codons..

      120 bytes for distance
    39040 bytes for conP
     3520 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.061198    0.098297    0.071907    0.098225    0.046795    0.016671    0.300000    1.300000

ntime & nrate & np:     6     2     8

Bounds (np=8):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =     8
lnL0 =  -369.898557

Iterating by ming2
Initial: fx=   369.898557
x=  0.06120  0.09830  0.07191  0.09823  0.04680  0.01667  0.30000  1.30000

  1 h-m-p  0.0000 0.0002 207.3370 +++     361.505367  m 0.0002    14 | 1/8
  2 h-m-p  0.0012 0.0097  31.5719 -----------..  | 1/8
  3 h-m-p  0.0000 0.0004 189.5397 +++     348.730119  m 0.0004    46 | 2/8
  4 h-m-p  0.0025 0.0132  23.8479 ------------..  | 2/8
  5 h-m-p  0.0000 0.0002 170.3439 +++     343.789734  m 0.0002    79 | 3/8
  6 h-m-p  0.0015 0.0194  16.9936 -----------..  | 3/8
  7 h-m-p  0.0000 0.0001 147.7472 ++      341.020920  m 0.0001   110 | 4/8
  8 h-m-p  0.0012 0.0277  12.4035 -----------..  | 4/8
  9 h-m-p  0.0000 0.0003 120.6826 +++     336.448328  m 0.0003   142 | 5/8
 10 h-m-p  0.0034 0.0475   7.7651 ------------..  | 5/8
 11 h-m-p  0.0000 0.0000  85.8068 ++      336.442081  m 0.0000   174 | 6/8
 12 h-m-p  0.0160 8.0000   0.0000 -C      336.442081  0 0.0010   186 | 6/8
 13 h-m-p  1.6000 8.0000   0.0000 ------Y   336.442081  0 0.0001   205
Out..
lnL  =  -336.442081
206 lfun, 206 eigenQcodon, 1236 P(t)

Time used:  0:00


Model 1: NearlyNeutral

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.066119    0.107220    0.080471    0.065238    0.061028    0.059594    0.299807    0.882929    0.286785

ntime & nrate & np:     6     2     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 12.158727

np =     9
lnL0 =  -373.142163

Iterating by ming2
Initial: fx=   373.142163
x=  0.06612  0.10722  0.08047  0.06524  0.06103  0.05959  0.29981  0.88293  0.28678

  1 h-m-p  0.0000 0.0007 199.0783 ++++    343.575351  m 0.0007    16 | 1/9
  2 h-m-p  0.0000 0.0000 139.8669 ++      342.957034  m 0.0000    28 | 2/9
  3 h-m-p  0.0001 0.0005 106.5597 ++      340.843820  m 0.0005    40 | 3/9
  4 h-m-p  0.0000 0.0000 3082.1105 ++      340.470545  m 0.0000    52 | 4/9
  5 h-m-p  0.0001 0.0006 135.4338 ++      339.109362  m 0.0006    64 | 5/9
  6 h-m-p  0.0002 0.0008 107.2274 ++      336.442086  m 0.0008    76 | 6/9
  7 h-m-p  1.6000 8.0000   0.0000 ++      336.442086  m 8.0000    88 | 6/9
  8 h-m-p  0.0035 1.7501   0.3201 +++++   336.442079  m 1.7501   106 | 7/9
  9 h-m-p  0.1458 0.7290   0.3013 ++      336.442078  m 0.7290   121 | 8/9
 10 h-m-p  1.6000 8.0000   0.0000 C       336.442078  0 1.6000   135 | 8/9
 11 h-m-p  0.0008 0.4024   1.8650 +++++   336.442078  m 0.4024   151 | 8/9
 12 h-m-p  0.2646 1.3232   0.7557 -----Y   336.442078  0 0.0001   168 | 8/9
 13 h-m-p  1.6000 8.0000   0.0000 Y       336.442078  0 1.6000   181
Out..
lnL  =  -336.442078
182 lfun, 546 eigenQcodon, 2184 P(t)

Time used:  0:01


Model 2: PositiveSelection

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.020424    0.107167    0.036443    0.010437    0.017905    0.022919    0.000100    0.915388    0.480359    0.133352    1.305152

ntime & nrate & np:     6     3    11

Bounds (np=11):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 10.578178

np =    11
lnL0 =  -354.158714

Iterating by ming2
Initial: fx=   354.158714
x=  0.02042  0.10717  0.03644  0.01044  0.01791  0.02292  0.00011  0.91539  0.48036  0.13335  1.30515

  1 h-m-p  0.0000 0.0000 195.5735 ++      353.775058  m 0.0000    16 | 1/11
  2 h-m-p  0.0000 0.0026  47.4704 +++     348.845632  m 0.0026    31 | 2/11
  3 h-m-p  0.0001 0.0003  61.3329 ++      346.642717  m 0.0003    45 | 3/11
  4 h-m-p  0.0000 0.0002  25.8123 ++      346.505748  m 0.0002    59 | 4/11
  5 h-m-p  0.0000 0.0000 1097.2813 ++      345.927029  m 0.0000    73 | 5/11
  6 h-m-p  0.0003 0.0347  34.3874 ++++    341.730482  m 0.0347    89 | 6/11
  7 h-m-p  0.0007 0.0036  94.7499 ++      338.950083  m 0.0036   103 | 7/11
  8 h-m-p  0.0006 0.0038 587.4472 ++      336.442078  m 0.0038   117 | 8/11
  9 h-m-p  1.6000 8.0000   0.0006 -------N   336.442078  0 0.0000   138 | 8/11
 10 h-m-p  0.0160 8.0000   0.0000 N       336.442078  0 0.0020   155
Out..
lnL  =  -336.442078
156 lfun, 624 eigenQcodon, 2808 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -336.444106  S =  -336.440662    -0.001316
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  40 patterns   0:02
	did  20 /  40 patterns   0:02
	did  30 /  40 patterns   0:02
	did  40 /  40 patterns   0:02
Time used:  0:02


Model 7: beta

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.038161    0.030850    0.074460    0.100591    0.055394    0.016292    0.000100    0.783037    1.791698

ntime & nrate & np:     6     1     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 15.607183

np =     9
lnL0 =  -362.605902

Iterating by ming2
Initial: fx=   362.605902
x=  0.03816  0.03085  0.07446  0.10059  0.05539  0.01629  0.00011  0.78304  1.79170

  1 h-m-p  0.0000 0.0000 197.2224 ++      362.375397  m 0.0000    14 | 1/9
  2 h-m-p  0.0001 0.0677  11.7582 ----------..  | 1/9
  3 h-m-p  0.0000 0.0002 197.3352 +++     354.795622  m 0.0002    47 | 2/9
  4 h-m-p  0.0035 0.0800   9.9860 ------------..  | 2/9
  5 h-m-p  0.0000 0.0002 182.9562 +++     348.828672  m 0.0002    82 | 3/9
  6 h-m-p  0.0041 0.1163   6.9493 ------------..  | 3/9
  7 h-m-p  0.0000 0.0001 165.7042 ++      346.395239  m 0.0001   116 | 4/9
  8 h-m-p  0.0025 0.1627   5.0754 ------------..  | 4/9
  9 h-m-p  0.0000 0.0002 143.8662 +++     342.035149  m 0.0002   151 | 5/9
 10 h-m-p  0.0068 0.2400   3.6050 -------------..  | 5/9
 11 h-m-p  0.0000 0.0002 118.6129 +++     338.749234  m 0.0002   187 | 6/9
 12 h-m-p  0.0097 0.5244   2.0010 -------------..  | 6/9
 13 h-m-p  0.0000 0.0003  84.5316 +++     336.442084  m 0.0003   223 | 7/9
 14 h-m-p  0.5852 8.0000   0.0000 ++      336.442084  m 8.0000   235 | 7/9
 15 h-m-p  0.0526 8.0000   0.0004 ++++    336.442084  m 8.0000   251 | 7/9
 16 h-m-p  0.0052 2.6058   4.0695 --------Y   336.442084  0 0.0000   273 | 7/9
 17 h-m-p  0.0889 8.0000   0.0000 --C     336.442084  0 0.0014   287 | 7/9
 18 h-m-p  0.0853 8.0000   0.0000 +Y      336.442084  0 0.3414   302
Out..
lnL  =  -336.442084
303 lfun, 3333 eigenQcodon, 18180 P(t)

Time used:  0:06


Model 8: beta&w>1

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.085801    0.091345    0.102133    0.030092    0.016932    0.015871    0.000100    0.900000    0.285777    1.564520    1.300027

ntime & nrate & np:     6     2    11

Bounds (np=11):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 16.453710

np =    11
lnL0 =  -363.507150

Iterating by ming2
Initial: fx=   363.507150
x=  0.08580  0.09134  0.10213  0.03009  0.01693  0.01587  0.00011  0.90000  0.28578  1.56452  1.30003

  1 h-m-p  0.0000 0.0000 181.9362 ++      363.391534  m 0.0000    16 | 1/11
  2 h-m-p  0.0000 0.0009 103.8187 ++++    356.263950  m 0.0009    32 | 2/11
  3 h-m-p  0.0000 0.0000  80.1131 ++      355.795478  m 0.0000    46 | 3/11
  4 h-m-p  0.0001 0.0021  49.7407 +++     352.557233  m 0.0021    61 | 4/11
  5 h-m-p  0.0004 0.0020  73.8556 ++      340.385813  m 0.0020    75 | 5/11
  6 h-m-p  0.0003 0.0014  52.7223 ++      339.357806  m 0.0014    89 | 6/11
  7 h-m-p  0.0125 0.2593   2.2582 -------------..  | 6/11
  8 h-m-p  0.0000 0.0001 116.8733 ++      338.311170  m 0.0001   128 | 7/11
  9 h-m-p  0.0030 0.1517   2.0701 ------------..  | 7/11
 10 h-m-p  0.0000 0.0003  83.1901 +++     336.442084  m 0.0003   167 | 8/11
 11 h-m-p  0.2907 8.0000   0.0000 +++     336.442084  m 8.0000   182 | 8/11
 12 h-m-p  0.0160 8.0000   0.0503 +++++   336.442078  m 8.0000   202 | 8/11
 13 h-m-p  0.4785 2.3927   0.2743 ++      336.442075  m 2.3927   219 | 9/11
 14 h-m-p  1.0464 8.0000   0.4197 ++      336.442073  m 8.0000   236 | 9/11
 15 h-m-p  1.6000 8.0000   0.7739 ++      336.442073  m 8.0000   252 | 9/11
 16 h-m-p  1.6000 8.0000   1.9027 ++      336.442072  m 8.0000   268 | 9/11
 17 h-m-p  1.6000 8.0000   3.0051 ++      336.442072  m 8.0000   282 | 9/11
 18 h-m-p  0.5705 2.8524  17.5210 ----------------..  | 9/11
 19 h-m-p  0.0160 8.0000   0.0000 -----N   336.442072  0 0.0000   329 | 9/11
 20 h-m-p  1.6000 8.0000   0.0000 -Y      336.442072  0 0.1000   346
Out..
lnL  =  -336.442072
347 lfun, 4164 eigenQcodon, 22902 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -336.440168  S =  -336.440040    -0.000056
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  40 patterns   0:12
	did  20 /  40 patterns   0:12
	did  30 /  40 patterns   0:12
	did  40 /  40 patterns   0:12
Time used:  0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=87 

NC_011896_1_WP_010907676_1_337_MLBR_RS01640           VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
NC_002677_1_NP_301352_1_224_ML0325                    VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775   VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855   VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745        VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825        VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
                                                      **************************************************

NC_011896_1_WP_010907676_1_337_MLBR_RS01640           LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
NC_002677_1_NP_301352_1_224_ML0325                    LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775   LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855   LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745        LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825        LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
                                                      *************************************



>NC_011896_1_WP_010907676_1_337_MLBR_RS01640
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>NC_002677_1_NP_301352_1_224_ML0325
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825
GTGTTGCGGGGCAACAAGATAGTTGTCTTACCGGAAGTTTTCGCGCTCAC
CGATTACTATCTGGCCGATGTACGGTTCAACATCGAGACCAAGGTAGCGG
CCGATCGGCCAGCTGTATCCGTCTTTTCTCAAGAGTTCGTTGATGTGGTG
CTCGCCGTGGTCAGATCCGTCGGCAAGGTCGACCGGGTGGCTTCGCCTGG
CGAACGCCCTGCCGATGGTGCGTCAGGCTTAGCCGTCTATACCGTTGGTG
GCCTTATGGGA
>NC_011896_1_WP_010907676_1_337_MLBR_RS01640
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>NC_002677_1_NP_301352_1_224_ML0325
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
>NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825
VLRGNKIVVLPEVFALTDYYLADVRFNIETKVAADRPAVSVFSQEFVDVV
LAVVRSVGKVDRVASPGERPADGASGLAVYTVGGLMG
#NEXUS

[ID: 0771709338]
begin taxa;
	dimensions ntax=6;
	taxlabels
		NC_011896_1_WP_010907676_1_337_MLBR_RS01640
		NC_002677_1_NP_301352_1_224_ML0325
		NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775
		NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855
		NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745
		NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825
		;
end;
begin trees;
	translate
		1	NC_011896_1_WP_010907676_1_337_MLBR_RS01640,
		2	NC_002677_1_NP_301352_1_224_ML0325,
		3	NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775,
		4	NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855,
		5	NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745,
		6	NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.06985926,2:0.06812233,3:0.06765335,4:0.07116847,5:0.07112611,6:0.06649854);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.06985926,2:0.06812233,3:0.06765335,4:0.07116847,5:0.07112611,6:0.06649854);
end;
      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -357.66          -361.38
2       -357.54          -360.81
--------------------------------------
TOTAL     -357.60          -361.13
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0325/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896243    0.090088    0.362521    1.486402    0.859692   1304.86   1340.46    1.000
r(A<->C){all}   0.175273    0.020877    0.000072    0.457714    0.138481     99.13    140.99    1.018
r(A<->G){all}   0.181522    0.023705    0.000069    0.499833    0.140704    116.62    170.95    1.000
r(A<->T){all}   0.159703    0.019039    0.000001    0.436356    0.121572     56.92    135.00    1.001
r(C<->G){all}   0.157666    0.017880    0.000022    0.414003    0.121123    239.69    241.98    1.003
r(C<->T){all}   0.165805    0.018743    0.000077    0.431658    0.132110    192.24    219.46    1.001
r(G<->T){all}   0.160031    0.018163    0.000006    0.433201    0.124703    217.10    237.86    1.005
pi(A){all}      0.169932    0.000539    0.127435    0.216924    0.169193   1416.22   1427.68    1.000
pi(C){all}      0.260254    0.000714    0.207450    0.311879    0.259647   1032.67   1241.17    1.000
pi(G){all}      0.313465    0.000816    0.256586    0.366743    0.313187   1301.24   1315.33    1.000
pi(T){all}      0.256349    0.000711    0.207947    0.311414    0.255557   1213.15   1357.07    1.000
alpha{1,2}      0.411468    0.225909    0.000177    1.382476    0.238897   1202.76   1351.88    1.000
alpha{3}        0.435563    0.223610    0.000318    1.381044    0.276053   1333.63   1342.50    1.000
pinvar{all}     0.993478    0.000063    0.977174    0.999998    0.996087   1171.04   1304.09    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018)  /data/4res/ML0325/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio, 
Codon frequency model: F3x4
Site-class models: 
ns =   6  ls =  87

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   1   1   1   1   1   1 | Ser TCT   1   1   1   1   1   1 | Tyr TAT   2   2   2   2   2   2 | Cys TGT   0   0   0   0   0   0
    TTC   3   3   3   3   3   3 |     TCC   2   2   2   2   2   2 |     TAC   1   1   1   1   1   1 |     TGC   0   0   0   0   0   0
Leu TTA   2   2   2   2   2   2 |     TCA   1   1   1   1   1   1 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   1   1   1   1   1   1 |     TCG   1   1   1   1   1   1 |     TAG   0   0   0   0   0   0 | Trp TGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   1   1   1   1   1   1 | Pro CCT   2   2   2   2   2   2 | His CAT   0   0   0   0   0   0 | Arg CGT   0   0   0   0   0   0
    CTC   2   2   2   2   2   2 |     CCC   0   0   0   0   0   0 |     CAC   0   0   0   0   0   0 |     CGC   1   1   1   1   1   1
    CTA   0   0   0   0   0   0 |     CCA   1   1   1   1   1   1 | Gln CAA   1   1   1   1   1   1 |     CGA   0   0   0   0   0   0
    CTG   1   1   1   1   1   1 |     CCG   1   1   1   1   1   1 |     CAG   0   0   0   0   0   0 |     CGG   4   4   4   4   4   4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   0   0   0   0   0   0 | Thr ACT   0   0   0   0   0   0 | Asn AAT   0   0   0   0   0   0 | Ser AGT   0   0   0   0   0   0
    ATC   1   1   1   1   1   1 |     ACC   3   3   3   3   3   3 |     AAC   2   2   2   2   2   2 |     AGC   0   0   0   0   0   0
    ATA   1   1   1   1   1   1 |     ACA   0   0   0   0   0   0 | Lys AAA   0   0   0   0   0   0 | Arg AGA   1   1   1   1   1   1
Met ATG   1   1   1   1   1   1 |     ACG   0   0   0   0   0   0 |     AAG   3   3   3   3   3   3 |     AGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   4   4   4   4   4   4 | Ala GCT   2   2   2   2   2   2 | Asp GAT   5   5   5   5   5   5 | Gly GGT   2   2   2   2   2   2
    GTC   6   6   6   6   6   6 |     GCC   5   5   5   5   5   5 |     GAC   1   1   1   1   1   1 |     GGC   5   5   5   5   5   5
    GTA   3   3   3   3   3   3 |     GCA   0   0   0   0   0   0 | Glu GAA   2   2   2   2   2   2 |     GGA   1   1   1   1   1   1
    GTG   5   5   5   5   5   5 |     GCG   3   3   3   3   3   3 |     GAG   2   2   2   2   2   2 |     GGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: NC_011896_1_WP_010907676_1_337_MLBR_RS01640             
position  1:    T:0.17241    C:0.16092    A:0.13793    G:0.52874
position  2:    T:0.36782    C:0.25287    A:0.21839    G:0.16092
position  3:    T:0.22989    C:0.36782    A:0.14943    G:0.25287
Average         T:0.25670    C:0.26054    A:0.16858    G:0.31418

#2: NC_002677_1_NP_301352_1_224_ML0325             
position  1:    T:0.17241    C:0.16092    A:0.13793    G:0.52874
position  2:    T:0.36782    C:0.25287    A:0.21839    G:0.16092
position  3:    T:0.22989    C:0.36782    A:0.14943    G:0.25287
Average         T:0.25670    C:0.26054    A:0.16858    G:0.31418

#3: NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775             
position  1:    T:0.17241    C:0.16092    A:0.13793    G:0.52874
position  2:    T:0.36782    C:0.25287    A:0.21839    G:0.16092
position  3:    T:0.22989    C:0.36782    A:0.14943    G:0.25287
Average         T:0.25670    C:0.26054    A:0.16858    G:0.31418

#4: NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855             
position  1:    T:0.17241    C:0.16092    A:0.13793    G:0.52874
position  2:    T:0.36782    C:0.25287    A:0.21839    G:0.16092
position  3:    T:0.22989    C:0.36782    A:0.14943    G:0.25287
Average         T:0.25670    C:0.26054    A:0.16858    G:0.31418

#5: NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745             
position  1:    T:0.17241    C:0.16092    A:0.13793    G:0.52874
position  2:    T:0.36782    C:0.25287    A:0.21839    G:0.16092
position  3:    T:0.22989    C:0.36782    A:0.14943    G:0.25287
Average         T:0.25670    C:0.26054    A:0.16858    G:0.31418

#6: NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825             
position  1:    T:0.17241    C:0.16092    A:0.13793    G:0.52874
position  2:    T:0.36782    C:0.25287    A:0.21839    G:0.16092
position  3:    T:0.22989    C:0.36782    A:0.14943    G:0.25287
Average         T:0.25670    C:0.26054    A:0.16858    G:0.31418

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT       6 | Ser S TCT       6 | Tyr Y TAT      12 | Cys C TGT       0
      TTC      18 |       TCC      12 |       TAC       6 |       TGC       0
Leu L TTA      12 |       TCA       6 | *** * TAA       0 | *** * TGA       0
      TTG       6 |       TCG       6 |       TAG       0 | Trp W TGG       0
------------------------------------------------------------------------------
Leu L CTT       6 | Pro P CCT      12 | His H CAT       0 | Arg R CGT       0
      CTC      12 |       CCC       0 |       CAC       0 |       CGC       6
      CTA       0 |       CCA       6 | Gln Q CAA       6 |       CGA       0
      CTG       6 |       CCG       6 |       CAG       0 |       CGG      24
------------------------------------------------------------------------------
Ile I ATT       0 | Thr T ACT       0 | Asn N AAT       0 | Ser S AGT       0
      ATC       6 |       ACC      18 |       AAC      12 |       AGC       0
      ATA       6 |       ACA       0 | Lys K AAA       0 | Arg R AGA       6
Met M ATG       6 |       ACG       0 |       AAG      18 |       AGG       0
------------------------------------------------------------------------------
Val V GTT      24 | Ala A GCT      12 | Asp D GAT      30 | Gly G GGT      12
      GTC      36 |       GCC      30 |       GAC       6 |       GGC      30
      GTA      18 |       GCA       0 | Glu E GAA      12 |       GGA       6
      GTG      30 |       GCG      18 |       GAG      12 |       GGG       0
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.17241    C:0.16092    A:0.13793    G:0.52874
position  2:    T:0.36782    C:0.25287    A:0.21839    G:0.16092
position  3:    T:0.22989    C:0.36782    A:0.14943    G:0.25287
Average         T:0.25670    C:0.26054    A:0.16858    G:0.31418

Model 0: one-ratio


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  8):   -336.442081      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299807 1.300027

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.29981

omega (dN/dS) =  1.30003

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1      0.000   183.1    77.9  1.3000  0.0000  0.0000   0.0   0.0
   7..2      0.000   183.1    77.9  1.3000  0.0000  0.0000   0.0   0.0
   7..3      0.000   183.1    77.9  1.3000  0.0000  0.0000   0.0   0.0
   7..4      0.000   183.1    77.9  1.3000  0.0000  0.0000   0.0   0.0
   7..5      0.000   183.1    77.9  1.3000  0.0000  0.0000   0.0   0.0
   7..6      0.000   183.1    77.9  1.3000  0.0000  0.0000   0.0   0.0

tree length for dN:       0.0000
tree length for dS:       0.0000


Time used:  0:00


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  9):   -336.442078      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.999951

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010


MLEs of dN/dS (w) for site classes (K=2)

p:   0.00001  0.99999
w:   0.99995  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    186.3     74.7   1.0000   0.0000   0.0000    0.0    0.0
   7..2       0.000    186.3     74.7   1.0000   0.0000   0.0000    0.0    0.0
   7..3       0.000    186.3     74.7   1.0000   0.0000   0.0000    0.0    0.0
   7..4       0.000    186.3     74.7   1.0000   0.0000   0.0000    0.0    0.0
   7..5       0.000    186.3     74.7   1.0000   0.0000   0.0000    0.0    0.0
   7..6       0.000    186.3     74.7   1.0000   0.0000   0.0000    0.0    0.0


Time used:  0:01


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np: 11):   -336.442078      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.179714 0.604812 0.000001 2.096016

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010


MLEs of dN/dS (w) for site classes (K=3)

p:   0.17971  0.60481  0.21547
w:   0.00000  1.00000  2.09602

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    186.3     74.7   1.0564   0.0000   0.0000    0.0    0.0
   7..2       0.000    186.3     74.7   1.0564   0.0000   0.0000    0.0    0.0
   7..3       0.000    186.3     74.7   1.0564   0.0000   0.0000    0.0    0.0
   7..4       0.000    186.3     74.7   1.0564   0.0000   0.0000    0.0    0.0
   7..5       0.000    186.3     74.7   1.0564   0.0000   0.0000    0.0    0.0
   7..6       0.000    186.3     74.7   1.0564   0.0000   0.0000    0.0    0.0


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907676_1_337_MLBR_RS01640)

            Pr(w>1)     post mean +- SE for w



Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907676_1_337_MLBR_RS01640)

            Pr(w>1)     post mean +- SE for w




The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
w2:   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100

Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)

 0.010
 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010

sum of density on p0-p1 =   1.000000

Time used:  0:02


Model 7: beta (10 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  9):   -336.442084      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.783109 1.788708

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

Parameters in M7 (beta):
 p =   0.78311  q =   1.78871


MLEs of dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.01178  0.04871  0.09554  0.15068  0.21420  0.28712  0.37158  0.47175  0.59682  0.77775

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    186.3     74.7   0.3026   0.0000   0.0000    0.0    0.0
   7..2       0.000    186.3     74.7   0.3026   0.0000   0.0000    0.0    0.0
   7..3       0.000    186.3     74.7   0.3026   0.0000   0.0000    0.0    0.0
   7..4       0.000    186.3     74.7   0.3026   0.0000   0.0000    0.0    0.0
   7..5       0.000    186.3     74.7   0.3026   0.0000   0.0000    0.0    0.0
   7..6       0.000    186.3     74.7   0.3026   0.0000   0.0000    0.0    0.0


Time used:  0:06


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np: 11):   -336.442072      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.581270 50.976149

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010907676_1_337_MLBR_RS01640: 0.000004, NC_002677_1_NP_301352_1_224_ML0325: 0.000004, NZ_LVXE01000066_1_WP_010907676_1_2458_A3216_RS12775: 0.000004, NZ_LYPH01000071_1_WP_010907676_1_2461_A8144_RS11855: 0.000004, NZ_CP029543_1_WP_010907676_1_339_DIJ64_RS01745: 0.000004, NZ_AP014567_1_WP_010907676_1_355_JK2ML_RS01825: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

Parameters in M8 (beta&w>1):
  p0 =   0.00001  p =   0.00500 q =   1.58127
 (p1 =   0.99999) w =  50.97615


MLEs of dN/dS (w) for site classes (K=11)

p:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.99999
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00002 50.97615

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    186.3     74.7  50.9756   0.0000   0.0000    0.0    0.0
   7..2       0.000    186.3     74.7  50.9756   0.0000   0.0000    0.0    0.0
   7..3       0.000    186.3     74.7  50.9756   0.0000   0.0000    0.0    0.0
   7..4       0.000    186.3     74.7  50.9756   0.0000   0.0000    0.0    0.0
   7..5       0.000    186.3     74.7  50.9756   0.0000   0.0000    0.0    0.0
   7..6       0.000    186.3     74.7  50.9756   0.0000   0.0000    0.0    0.0


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907676_1_337_MLBR_RS01640)

            Pr(w>1)     post mean +- SE for w

     1 V      1.000**       50.976
     2 L      1.000**       50.976
     3 R      1.000**       50.976
     4 G      1.000**       50.976
     5 N      1.000**       50.976
     6 K      1.000**       50.976
     7 I      1.000**       50.976
     8 V      1.000**       50.976
     9 V      1.000**       50.976
    10 L      1.000**       50.976
    11 P      1.000**       50.976
    12 E      1.000**       50.976
    13 V      1.000**       50.976
    14 F      1.000**       50.976
    15 A      1.000**       50.976
    16 L      1.000**       50.976
    17 T      1.000**       50.976
    18 D      1.000**       50.976
    19 Y      1.000**       50.976
    20 Y      1.000**       50.976
    21 L      1.000**       50.976
    22 A      1.000**       50.976
    23 D      1.000**       50.976
    24 V      1.000**       50.976
    25 R      1.000**       50.976
    26 F      1.000**       50.976
    27 N      1.000**       50.976
    28 I      1.000**       50.976
    29 E      1.000**       50.976
    30 T      1.000**       50.976
    31 K      1.000**       50.976
    32 V      1.000**       50.976
    33 A      1.000**       50.976
    34 A      1.000**       50.976
    35 D      1.000**       50.976
    36 R      1.000**       50.976
    37 P      1.000**       50.976
    38 A      1.000**       50.976
    39 V      1.000**       50.976
    40 S      1.000**       50.976
    41 V      1.000**       50.976
    42 F      1.000**       50.976
    43 S      1.000**       50.976
    44 Q      1.000**       50.976
    45 E      1.000**       50.976
    46 F      1.000**       50.976
    47 V      1.000**       50.976
    48 D      1.000**       50.976
    49 V      1.000**       50.976
    50 V      1.000**       50.976
    51 L      1.000**       50.976
    52 A      1.000**       50.976
    53 V      1.000**       50.976
    54 V      1.000**       50.976
    55 R      1.000**       50.976
    56 S      1.000**       50.976
    57 V      1.000**       50.976
    58 G      1.000**       50.976
    59 K      1.000**       50.976
    60 V      1.000**       50.976
    61 D      1.000**       50.976
    62 R      1.000**       50.976
    63 V      1.000**       50.976
    64 A      1.000**       50.976
    65 S      1.000**       50.976
    66 P      1.000**       50.976
    67 G      1.000**       50.976
    68 E      1.000**       50.976
    69 R      1.000**       50.976
    70 P      1.000**       50.976
    71 A      1.000**       50.976
    72 D      1.000**       50.976
    73 G      1.000**       50.976
    74 A      1.000**       50.976
    75 S      1.000**       50.976
    76 G      1.000**       50.976
    77 L      1.000**       50.976
    78 A      1.000**       50.976
    79 V      1.000**       50.976
    80 Y      1.000**       50.976
    81 T      1.000**       50.976
    82 V      1.000**       50.976
    83 G      1.000**       50.976
    84 G      1.000**       50.976
    85 L      1.000**       50.976
    86 M      1.000**       50.976
    87 G      1.000**       50.976


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907676_1_337_MLBR_RS01640)

            Pr(w>1)     post mean +- SE for w




The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
p :   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
q :   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
ws:   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100

Time used:  0:12
Model 1: NearlyNeutral	-336.442078
Model 2: PositiveSelection	-336.442078
Model 0: one-ratio	-336.442081
Model 7: beta	-336.442084
Model 8: beta&w>1	-336.442072


Model 0 vs 1	5.999999984851456E-6

Model 2 vs 1	0.0

Model 8 vs 7	2.4000000053092663E-5