>C1
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C2
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C3
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C4
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C5
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C6
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=302
C1 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C2 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C3 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C4 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C5 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C6 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
**************************************************
C1 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C2 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C3 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C4 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C5 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C6 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
**************************************************
C1 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C2 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C3 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C4 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C5 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C6 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
**************************************************
C1 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C2 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C3 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C4 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C5 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C6 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
**************************************************
C1 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C2 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C3 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C4 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C5 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C6 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
**************************************************
C1 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C2 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C3 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C4 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C5 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C6 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
**************************************************
C1 PR
C2 PR
C3 PR
C4 PR
C5 PR
C6 PR
**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 302 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 302 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9060]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9060]--->[9060]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.507 Mb, Max= 30.864 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C2 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C3 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C4 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C5 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
C6 MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
**************************************************
C1 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C2 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C3 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C4 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C5 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
C6 HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
**************************************************
C1 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C2 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C3 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C4 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C5 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
C6 GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
**************************************************
C1 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C2 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C3 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C4 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C5 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
C6 DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
**************************************************
C1 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C2 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C3 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C4 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C5 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
C6 ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
**************************************************
C1 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C2 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C3 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C4 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C5 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
C6 AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
**************************************************
C1 PR
C2 PR
C3 PR
C4 PR
C5 PR
C6 PR
**
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
C2 ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
C3 ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
C4 ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
C5 ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
C6 ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
**************************************************
C1 GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
C2 GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
C3 GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
C4 GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
C5 GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
C6 GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
**************************************************
C1 TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
C2 TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
C3 TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
C4 TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
C5 TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
C6 TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
**************************************************
C1 CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
C2 CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
C3 CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
C4 CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
C5 CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
C6 CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
**************************************************
C1 GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
C2 GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
C3 GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
C4 GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
C5 GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
C6 GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
**************************************************
C1 TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
C2 TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
C3 TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
C4 TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
C5 TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
C6 TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
**************************************************
C1 GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
C2 GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
C3 GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
C4 GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
C5 GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
C6 GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
**************************************************
C1 GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
C2 GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
C3 GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
C4 GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
C5 GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
C6 GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
**************************************************
C1 ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
C2 ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
C3 ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
C4 ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
C5 ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
C6 ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
**************************************************
C1 GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
C2 GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
C3 GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
C4 GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
C5 GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
C6 GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
**************************************************
C1 CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
C2 CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
C3 CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
C4 CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
C5 CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
C6 CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
**************************************************
C1 CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
C2 CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
C3 CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
C4 CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
C5 CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
C6 CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
**************************************************
C1 GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
C2 GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
C3 GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
C4 GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
C5 GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
C6 GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
**************************************************
C1 GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
C2 GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
C3 GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
C4 GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
C5 GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
C6 GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
**************************************************
C1 TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
C2 TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
C3 TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
C4 TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
C5 TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
C6 TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
**************************************************
C1 GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
C2 GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
C3 GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
C4 GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
C5 GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
C6 GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
**************************************************
C1 GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
C2 GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
C3 GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
C4 GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
C5 GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
C6 GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
**************************************************
C1 AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
C2 AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
C3 AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
C4 AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
C5 AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
C6 AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
**************************************************
C1 CCCCGA
C2 CCCCGA
C3 CCCCGA
C4 CCCCGA
C5 CCCCGA
C6 CCCCGA
******
>C1
ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
CCCCGA
>C2
ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
CCCCGA
>C3
ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
CCCCGA
>C4
ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
CCCCGA
>C5
ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
CCCCGA
>C6
ATGCGTTGGTTGACGACTATCATTCTGTGCTTGATCAGTTCGACCGTTGC
GGGTGGCTGCGGCAGCCTTAGTTCCGGGCACCTGCGCCCGACAGCCGTGG
TGGCATCCACTGACGTGTGGGGCAGTGTGGCTCGCATTATTGCAGGCAGA
CACGTCGCCGTCACCTCCATTGTGACCGGTGCCCACACCGATCCGCACAC
GTATCGTGTCAATCCCGCTGAAACTGCCGCGATCACCGACGCCGCACTAG
TGGTCTACAACGGCGGCGGTTACGATCCATGGGTCGACAAGGTGCTGGCC
GGCCGTCCGGACATCAAATCGGTGGATGCTTACTCGCTTCTCGCTAGCAG
GGGCGCCACCACCGAAGGACCGGCCGACGAACACGTCTTCTACGACCTGA
ACATCGCCAAGTCGGTGGCCTCCCTGATCGCCGACCAGCTGGTGACCATC
GATCCGGACAATGCCGCGGACTACCAGGCCAACGCCACCGAATTCTGCCG
CAGCGCCGACGCTATCGCCATATCCGAACACGCCATTGCCAGCGACTACC
CAGCCGCCGGGGTAATCGTAACCGAGCCCGTGGTGCACTACCTGCTGCAG
GCATCCGGCCTGGTCAATCGCACGCCGCCGGCCTTTACCGCAACCCATGA
GAACGAGAACGATCCGTCGGCAGCCGACATGGCGGCCGCCCTCAATCTGA
TCAACCACCGTCAAGTCTCGGCGTTGCTGGTAAACCCGCAGAAATCGAAC
GCCGCTACCAACGGCCTGCAGGCTGCGGCCCGACGGTCAGGTGTGCCAGT
GACCGAAGTGACCGAGATGTTGCCGAACGACACCGATTACCTTACCTGGC
AACGTAACACGATCGATCAGCTGCTCACTGCGCTGCAATCGAACCGATCA
CCCCGA
>C1
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C2
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C3
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C4
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C5
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
>C6
MRWLTTIILCLISSTVAGGCGSLSSGHLRPTAVVASTDVWGSVARIIAGR
HVAVTSIVTGAHTDPHTYRVNPAETAAITDAALVVYNGGGYDPWVDKVLA
GRPDIKSVDAYSLLASRGATTEGPADEHVFYDLNIAKSVASLIADQLVTI
DPDNAADYQANATEFCRSADAIAISEHAIASDYPAAGVIVTEPVVHYLLQ
ASGLVNRTPPAFTATHENENDPSAADMAAALNLINHRQVSALLVNPQKSN
AATNGLQAAARRSGVPVTEVTEMLPNDTDYLTWQRNTIDQLLTALQSNRS
PR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 906 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579799651
Setting output file names to "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1393023104
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0823712787
Seed = 889876135
Swapseed = 1579799651
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2027.671441 -- -24.965149
Chain 2 -- -2027.671441 -- -24.965149
Chain 3 -- -2027.671326 -- -24.965149
Chain 4 -- -2027.671131 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2027.671441 -- -24.965149
Chain 2 -- -2027.671326 -- -24.965149
Chain 3 -- -2027.671441 -- -24.965149
Chain 4 -- -2027.671326 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2027.671] (-2027.671) (-2027.671) (-2027.671) * [-2027.671] (-2027.671) (-2027.671) (-2027.671)
500 -- (-1237.864) [-1235.457] (-1244.476) (-1253.257) * (-1261.010) [-1242.913] (-1234.194) (-1249.827) -- 0:00:00
1000 -- (-1233.000) (-1239.025) [-1238.597] (-1242.594) * (-1251.908) (-1248.248) [-1245.122] (-1237.598) -- 0:00:00
1500 -- (-1235.346) (-1239.108) [-1242.697] (-1233.982) * (-1241.427) (-1242.455) (-1237.550) [-1238.211] -- 0:11:05
2000 -- (-1236.838) (-1239.245) (-1240.326) [-1236.531] * (-1245.613) (-1237.035) [-1232.422] (-1234.528) -- 0:08:19
2500 -- [-1238.439] (-1242.444) (-1240.403) (-1233.021) * (-1242.388) [-1236.117] (-1238.325) (-1232.919) -- 0:06:39
3000 -- (-1237.395) (-1234.885) (-1232.812) [-1233.073] * (-1237.448) (-1245.518) [-1238.514] (-1244.836) -- 0:05:32
3500 -- (-1245.723) [-1240.193] (-1236.715) (-1242.234) * [-1238.631] (-1240.863) (-1233.955) (-1234.690) -- 0:04:44
4000 -- (-1241.639) (-1241.661) (-1243.039) [-1233.107] * (-1243.905) (-1236.991) [-1234.187] (-1235.306) -- 0:04:09
4500 -- (-1233.917) [-1237.230] (-1241.842) (-1241.561) * (-1238.225) (-1231.171) [-1236.130] (-1234.309) -- 0:03:41
5000 -- (-1235.446) [-1233.279] (-1243.778) (-1236.740) * [-1237.922] (-1236.431) (-1237.128) (-1239.910) -- 0:03:19
Average standard deviation of split frequencies: 0.078567
5500 -- (-1237.946) (-1231.976) (-1235.797) [-1235.584] * (-1241.999) (-1238.163) (-1232.105) [-1232.072] -- 0:03:00
6000 -- [-1235.577] (-1238.003) (-1239.576) (-1245.852) * (-1235.881) [-1235.598] (-1236.032) (-1240.371) -- 0:02:45
6500 -- (-1240.931) (-1239.977) (-1237.975) [-1232.830] * (-1236.897) [-1246.188] (-1236.526) (-1231.775) -- 0:02:32
7000 -- [-1232.837] (-1249.082) (-1238.750) (-1242.890) * (-1243.078) (-1236.271) (-1235.702) [-1242.305] -- 0:02:21
7500 -- (-1236.092) (-1241.207) [-1239.145] (-1237.652) * (-1235.541) (-1238.737) (-1241.282) [-1243.345] -- 0:02:12
8000 -- (-1231.602) (-1235.293) [-1238.820] (-1233.011) * (-1241.364) [-1241.847] (-1240.368) (-1234.655) -- 0:02:04
8500 -- (-1236.379) (-1238.164) (-1234.767) [-1236.056] * [-1234.757] (-1239.460) (-1239.312) (-1233.472) -- 0:01:56
9000 -- (-1238.313) [-1242.869] (-1242.174) (-1236.041) * [-1234.728] (-1239.121) (-1239.339) (-1239.049) -- 0:01:50
9500 -- (-1251.718) (-1234.299) [-1240.294] (-1254.448) * (-1253.418) [-1234.394] (-1240.769) (-1238.820) -- 0:01:44
10000 -- (-1237.492) [-1236.558] (-1234.708) (-1242.634) * (-1240.495) (-1239.164) (-1235.083) [-1235.803] -- 0:01:39
Average standard deviation of split frequencies: 0.078344
10500 -- (-1232.596) (-1239.800) [-1231.175] (-1235.834) * [-1231.093] (-1243.052) (-1234.398) (-1238.614) -- 0:01:34
11000 -- (-1238.583) (-1236.122) [-1240.798] (-1248.251) * [-1234.819] (-1248.193) (-1232.309) (-1240.882) -- 0:01:29
11500 -- (-1234.275) (-1243.035) (-1240.674) [-1237.927] * (-1233.244) (-1239.301) (-1237.727) [-1235.239] -- 0:01:25
12000 -- [-1231.303] (-1241.405) (-1239.689) (-1235.924) * (-1236.942) [-1234.274] (-1235.085) (-1235.915) -- 0:01:22
12500 -- (-1241.169) (-1233.740) (-1243.838) [-1233.385] * [-1239.199] (-1236.533) (-1237.733) (-1239.685) -- 0:01:19
13000 -- (-1239.571) (-1247.500) [-1233.890] (-1236.942) * (-1238.631) (-1244.203) [-1236.069] (-1236.502) -- 0:01:15
13500 -- (-1241.881) (-1258.912) [-1237.026] (-1234.456) * (-1231.377) (-1240.197) [-1237.652] (-1239.306) -- 0:01:13
14000 -- (-1245.671) (-1251.524) [-1237.650] (-1247.211) * (-1241.540) [-1229.456] (-1236.276) (-1242.848) -- 0:01:10
14500 -- (-1243.908) (-1230.976) [-1240.942] (-1238.868) * [-1236.440] (-1231.673) (-1235.282) (-1240.911) -- 0:01:07
15000 -- (-1235.977) (-1228.291) [-1233.741] (-1242.777) * [-1241.621] (-1231.501) (-1241.852) (-1246.630) -- 0:01:05
Average standard deviation of split frequencies: 0.067519
15500 -- [-1239.867] (-1230.083) (-1246.311) (-1235.124) * [-1234.814] (-1229.351) (-1236.728) (-1234.438) -- 0:01:03
16000 -- [-1236.730] (-1230.158) (-1235.955) (-1236.189) * (-1233.908) (-1232.318) (-1240.127) [-1236.070] -- 0:01:01
16500 -- (-1242.098) (-1228.519) [-1239.817] (-1242.312) * (-1238.301) (-1231.501) (-1233.961) [-1236.880] -- 0:01:59
17000 -- (-1237.493) (-1228.206) [-1236.965] (-1241.592) * [-1234.552] (-1231.602) (-1242.524) (-1236.483) -- 0:01:55
17500 -- (-1248.903) [-1229.232] (-1243.284) (-1242.651) * (-1238.509) (-1228.145) [-1236.995] (-1237.508) -- 0:01:52
18000 -- [-1238.319] (-1229.247) (-1239.877) (-1237.656) * (-1240.564) (-1227.065) [-1230.358] (-1242.403) -- 0:01:49
18500 -- [-1236.125] (-1230.541) (-1240.126) (-1239.738) * (-1237.123) (-1226.848) (-1235.979) [-1236.007] -- 0:01:46
19000 -- (-1242.770) [-1228.830] (-1243.981) (-1232.518) * [-1235.789] (-1227.961) (-1237.319) (-1236.094) -- 0:01:43
19500 -- [-1235.702] (-1231.633) (-1236.871) (-1237.536) * (-1236.610) (-1234.840) (-1243.949) [-1234.814] -- 0:01:40
20000 -- (-1240.621) (-1231.876) (-1235.996) [-1236.150] * (-1238.704) (-1226.478) (-1239.338) [-1240.767] -- 0:01:38
Average standard deviation of split frequencies: 0.062427
20500 -- (-1234.640) (-1228.897) (-1235.721) [-1235.451] * (-1235.824) (-1226.590) (-1236.026) [-1235.577] -- 0:01:35
21000 -- (-1234.139) (-1229.361) [-1238.033] (-1244.713) * (-1242.380) (-1230.111) (-1235.335) [-1234.647] -- 0:01:33
21500 -- (-1245.384) [-1229.346] (-1237.766) (-1249.475) * (-1239.388) [-1227.858] (-1236.985) (-1241.119) -- 0:01:31
22000 -- (-1243.120) [-1230.152] (-1237.943) (-1244.084) * (-1239.288) (-1228.100) [-1232.267] (-1236.308) -- 0:01:28
22500 -- (-1235.670) (-1227.026) [-1231.904] (-1236.394) * [-1232.793] (-1229.229) (-1232.413) (-1234.698) -- 0:01:26
23000 -- (-1239.543) (-1227.640) (-1236.022) [-1233.776] * (-1233.365) [-1227.543] (-1228.831) (-1241.791) -- 0:01:24
23500 -- (-1235.062) [-1229.182] (-1253.145) (-1236.726) * (-1232.817) [-1227.971] (-1228.487) (-1237.676) -- 0:01:23
24000 -- [-1241.056] (-1229.454) (-1239.768) (-1235.911) * (-1232.789) (-1228.616) [-1229.212] (-1236.988) -- 0:01:21
24500 -- (-1236.975) [-1227.197] (-1237.957) (-1238.686) * (-1234.520) [-1229.816] (-1229.518) (-1236.518) -- 0:01:19
25000 -- [-1240.488] (-1227.802) (-1236.365) (-1235.403) * (-1236.941) (-1228.299) (-1228.934) [-1235.690] -- 0:01:18
Average standard deviation of split frequencies: 0.051096
25500 -- (-1228.742) (-1227.649) [-1237.107] (-1234.811) * [-1235.647] (-1229.099) (-1231.662) (-1230.056) -- 0:01:16
26000 -- (-1231.845) (-1227.636) [-1237.476] (-1240.129) * (-1236.189) (-1228.676) [-1229.600] (-1233.301) -- 0:01:14
26500 -- [-1230.140] (-1227.175) (-1233.943) (-1237.680) * (-1235.096) [-1229.340] (-1227.552) (-1238.272) -- 0:01:13
27000 -- (-1228.740) [-1228.977] (-1235.884) (-1245.031) * (-1238.013) [-1229.121] (-1226.909) (-1237.054) -- 0:01:12
27500 -- [-1229.839] (-1229.779) (-1238.077) (-1234.228) * [-1236.466] (-1226.964) (-1228.165) (-1240.041) -- 0:01:10
28000 -- (-1226.298) (-1227.109) [-1238.849] (-1230.550) * (-1243.681) (-1229.315) [-1227.996] (-1245.311) -- 0:01:09
28500 -- (-1227.244) (-1227.178) (-1240.572) [-1233.918] * (-1236.242) (-1230.476) [-1226.335] (-1236.399) -- 0:01:08
29000 -- (-1228.070) [-1227.753] (-1236.516) (-1238.541) * (-1235.366) (-1227.300) (-1230.626) [-1238.677] -- 0:01:06
29500 -- [-1226.957] (-1230.386) (-1235.615) (-1246.761) * (-1241.367) (-1227.242) (-1231.976) [-1236.219] -- 0:01:05
30000 -- (-1227.072) (-1229.402) [-1230.701] (-1235.542) * (-1245.289) [-1226.977] (-1227.122) (-1242.251) -- 0:01:04
Average standard deviation of split frequencies: 0.050727
30500 -- (-1231.048) (-1229.282) (-1241.023) [-1235.608] * (-1242.522) (-1226.940) (-1228.612) [-1235.226] -- 0:01:03
31000 -- (-1230.876) (-1229.510) (-1236.553) [-1231.678] * (-1235.853) (-1229.142) (-1228.338) [-1237.929] -- 0:01:02
31500 -- (-1226.794) (-1228.310) [-1240.672] (-1238.871) * (-1236.702) [-1226.379] (-1228.758) (-1236.106) -- 0:01:01
32000 -- (-1228.580) [-1227.514] (-1233.606) (-1237.896) * (-1237.660) (-1226.243) [-1227.460] (-1237.030) -- 0:01:00
32500 -- (-1232.064) [-1227.660] (-1240.786) (-1245.809) * (-1255.223) [-1227.929] (-1227.961) (-1241.148) -- 0:01:29
33000 -- (-1232.001) [-1226.851] (-1241.344) (-1239.237) * (-1237.986) (-1228.306) (-1226.129) [-1232.280] -- 0:01:27
33500 -- (-1227.050) (-1229.066) (-1236.764) [-1237.241] * (-1238.946) [-1231.742] (-1226.462) (-1233.974) -- 0:01:26
34000 -- (-1227.124) (-1227.894) (-1246.407) [-1237.475] * (-1236.436) (-1227.482) [-1226.586] (-1239.196) -- 0:01:25
34500 -- (-1228.715) (-1228.585) [-1231.971] (-1233.793) * [-1234.329] (-1227.902) (-1228.029) (-1245.678) -- 0:01:23
35000 -- [-1231.169] (-1227.517) (-1240.016) (-1241.385) * (-1240.162) (-1228.976) [-1228.014] (-1240.062) -- 0:01:22
Average standard deviation of split frequencies: 0.037413
35500 -- (-1226.711) (-1226.500) [-1234.486] (-1242.534) * (-1242.929) [-1230.128] (-1229.235) (-1241.276) -- 0:01:21
36000 -- (-1227.096) [-1227.285] (-1233.794) (-1236.729) * (-1230.821) [-1226.903] (-1233.043) (-1241.635) -- 0:01:20
36500 -- [-1228.333] (-1227.436) (-1238.005) (-1242.107) * (-1242.329) (-1227.125) (-1227.533) [-1237.595] -- 0:01:19
37000 -- (-1228.092) (-1228.179) [-1241.952] (-1235.631) * (-1237.741) (-1226.505) [-1228.928] (-1236.233) -- 0:01:18
37500 -- (-1229.443) (-1229.723) (-1249.616) [-1229.391] * (-1237.829) [-1226.301] (-1227.550) (-1239.687) -- 0:01:17
38000 -- (-1229.733) (-1229.302) (-1234.243) [-1241.112] * [-1232.152] (-1227.059) (-1227.152) (-1237.902) -- 0:01:15
38500 -- (-1229.225) (-1230.464) [-1235.952] (-1245.481) * (-1240.396) [-1227.204] (-1227.448) (-1242.485) -- 0:01:14
39000 -- [-1228.377] (-1228.797) (-1241.933) (-1235.575) * (-1235.364) (-1226.346) [-1226.742] (-1241.673) -- 0:01:13
39500 -- (-1229.928) (-1228.021) [-1234.684] (-1237.722) * [-1237.632] (-1228.305) (-1227.545) (-1239.930) -- 0:01:12
40000 -- (-1228.102) (-1230.259) [-1238.319] (-1245.451) * (-1236.505) (-1227.234) (-1227.575) [-1232.952] -- 0:01:12
Average standard deviation of split frequencies: 0.036432
40500 -- (-1229.834) [-1226.668] (-1237.453) (-1240.323) * [-1232.868] (-1228.664) (-1226.613) (-1237.862) -- 0:01:11
41000 -- [-1226.737] (-1226.624) (-1238.636) (-1241.143) * (-1239.984) [-1227.508] (-1227.827) (-1250.067) -- 0:01:10
41500 -- (-1229.762) (-1226.765) (-1240.884) [-1234.702] * [-1237.745] (-1227.802) (-1227.571) (-1235.177) -- 0:01:09
42000 -- (-1229.156) (-1226.635) (-1240.885) [-1231.514] * (-1242.705) (-1229.466) (-1229.207) [-1235.644] -- 0:01:08
42500 -- (-1232.823) (-1229.553) [-1237.638] (-1237.629) * (-1234.270) (-1231.288) (-1226.630) [-1235.143] -- 0:01:07
43000 -- (-1227.672) (-1229.059) [-1236.355] (-1234.207) * (-1236.155) (-1230.059) (-1227.262) [-1229.062] -- 0:01:06
43500 -- (-1227.632) (-1229.589) [-1235.889] (-1240.553) * (-1232.475) (-1228.028) [-1227.195] (-1238.755) -- 0:01:05
44000 -- [-1227.788] (-1227.333) (-1237.927) (-1237.120) * (-1241.160) (-1229.320) (-1228.845) [-1236.885] -- 0:01:05
44500 -- (-1228.653) [-1230.002] (-1235.723) (-1236.926) * (-1235.894) (-1228.279) (-1228.249) [-1238.353] -- 0:01:04
45000 -- (-1227.624) (-1231.109) (-1236.776) [-1240.501] * (-1234.420) (-1228.412) [-1226.837] (-1253.001) -- 0:01:03
Average standard deviation of split frequencies: 0.034308
45500 -- (-1230.203) [-1230.513] (-1230.295) (-1236.464) * (-1234.339) (-1230.146) (-1226.978) [-1230.142] -- 0:01:02
46000 -- (-1232.815) (-1232.635) [-1236.383] (-1239.661) * [-1231.924] (-1230.390) (-1226.861) (-1231.032) -- 0:01:02
46500 -- (-1233.392) (-1229.781) [-1231.831] (-1241.024) * (-1236.433) [-1232.559] (-1226.489) (-1235.181) -- 0:01:01
47000 -- (-1230.110) (-1229.414) (-1236.305) [-1236.137] * [-1233.435] (-1228.614) (-1227.059) (-1229.573) -- 0:01:00
47500 -- (-1227.552) (-1228.434) (-1244.158) [-1234.942] * (-1237.992) (-1228.654) (-1226.812) [-1227.899] -- 0:01:00
48000 -- (-1228.831) [-1228.694] (-1236.991) (-1243.289) * (-1239.562) (-1227.636) (-1227.145) [-1227.001] -- 0:00:59
48500 -- (-1227.291) (-1229.875) (-1237.277) [-1240.282] * (-1235.866) (-1228.844) (-1231.665) [-1227.531] -- 0:01:18
49000 -- [-1227.502] (-1230.386) (-1239.847) (-1241.246) * [-1237.134] (-1227.198) (-1226.586) (-1231.516) -- 0:01:17
49500 -- (-1227.371) [-1227.439] (-1238.215) (-1241.707) * [-1235.097] (-1227.912) (-1227.342) (-1237.125) -- 0:01:16
50000 -- (-1227.492) (-1228.284) (-1243.964) [-1240.762] * [-1234.412] (-1234.139) (-1227.482) (-1230.750) -- 0:01:16
Average standard deviation of split frequencies: 0.028317
50500 -- [-1228.578] (-1230.547) (-1239.944) (-1239.618) * (-1239.202) (-1229.604) [-1227.493] (-1230.051) -- 0:01:15
51000 -- [-1227.962] (-1230.860) (-1235.995) (-1239.861) * (-1234.339) (-1228.635) [-1227.569] (-1227.260) -- 0:01:14
51500 -- (-1229.756) [-1229.203] (-1238.433) (-1241.019) * [-1236.082] (-1227.474) (-1229.363) (-1228.970) -- 0:01:13
52000 -- [-1227.525] (-1229.307) (-1244.971) (-1236.918) * (-1235.021) (-1227.791) [-1227.750] (-1228.128) -- 0:01:12
52500 -- (-1226.798) (-1227.290) (-1241.000) [-1238.542] * [-1242.714] (-1230.114) (-1229.781) (-1227.211) -- 0:01:12
53000 -- (-1230.915) (-1228.977) [-1236.534] (-1241.136) * [-1232.389] (-1229.084) (-1227.473) (-1226.702) -- 0:01:11
53500 -- (-1229.172) (-1231.880) (-1235.747) [-1241.144] * (-1232.953) (-1228.388) [-1228.265] (-1230.519) -- 0:01:10
54000 -- (-1227.862) (-1228.274) (-1243.033) [-1235.965] * (-1238.645) (-1228.382) [-1227.612] (-1230.417) -- 0:01:10
54500 -- (-1227.203) (-1228.547) [-1232.524] (-1240.102) * (-1235.595) (-1227.216) (-1228.142) [-1228.495] -- 0:01:09
55000 -- [-1228.389] (-1228.257) (-1237.294) (-1242.261) * (-1237.018) (-1228.494) [-1228.494] (-1231.549) -- 0:01:08
Average standard deviation of split frequencies: 0.025655
55500 -- (-1233.569) [-1227.048] (-1234.587) (-1236.025) * (-1237.544) (-1228.773) (-1229.470) [-1229.198] -- 0:01:08
56000 -- [-1227.570] (-1227.223) (-1236.002) (-1241.106) * [-1235.472] (-1229.664) (-1227.060) (-1227.478) -- 0:01:07
56500 -- (-1227.931) [-1226.938] (-1240.532) (-1237.962) * (-1238.490) (-1228.748) [-1228.434] (-1227.411) -- 0:01:06
57000 -- (-1227.862) [-1227.013] (-1239.431) (-1240.608) * (-1241.759) (-1229.850) [-1228.121] (-1227.456) -- 0:01:06
57500 -- (-1228.658) [-1227.095] (-1236.769) (-1240.038) * (-1242.789) (-1230.131) (-1229.415) [-1231.138] -- 0:01:05
58000 -- (-1229.067) (-1228.235) [-1231.515] (-1244.083) * (-1243.798) [-1226.953] (-1228.364) (-1227.622) -- 0:01:04
58500 -- (-1228.216) (-1227.321) [-1232.851] (-1243.987) * (-1243.785) [-1228.356] (-1228.366) (-1229.480) -- 0:01:04
59000 -- (-1228.440) [-1227.540] (-1238.997) (-1240.457) * (-1250.799) (-1227.613) (-1228.432) [-1228.259] -- 0:01:03
59500 -- [-1229.492] (-1227.869) (-1241.960) (-1238.640) * (-1243.370) (-1227.611) [-1227.714] (-1227.616) -- 0:01:03
60000 -- (-1228.286) [-1227.245] (-1235.899) (-1243.113) * (-1239.342) (-1228.793) (-1228.196) [-1229.728] -- 0:01:02
Average standard deviation of split frequencies: 0.025531
60500 -- (-1231.777) (-1226.972) (-1230.857) [-1237.802] * (-1232.525) [-1227.669] (-1229.305) (-1230.248) -- 0:01:02
61000 -- (-1229.583) (-1227.678) (-1236.570) [-1231.938] * [-1233.610] (-1226.952) (-1227.559) (-1226.639) -- 0:01:01
61500 -- (-1230.870) (-1227.295) [-1239.339] (-1246.857) * [-1233.904] (-1229.133) (-1228.066) (-1229.680) -- 0:01:01
62000 -- [-1228.216] (-1236.863) (-1240.656) (-1236.819) * (-1239.820) [-1230.369] (-1228.795) (-1228.272) -- 0:01:00
62500 -- [-1228.151] (-1237.102) (-1241.129) (-1236.666) * (-1240.607) (-1228.760) [-1228.875] (-1229.568) -- 0:01:00
63000 -- (-1228.013) (-1231.607) [-1230.293] (-1249.037) * (-1230.952) (-1228.760) (-1227.690) [-1230.990] -- 0:00:59
63500 -- (-1231.378) (-1228.370) [-1229.976] (-1235.006) * [-1226.801] (-1232.475) (-1227.914) (-1232.800) -- 0:00:58
64000 -- (-1233.497) (-1228.388) [-1232.356] (-1238.717) * (-1228.528) [-1227.420] (-1227.639) (-1233.582) -- 0:00:58
64500 -- (-1228.015) (-1228.130) [-1231.079] (-1239.015) * (-1227.498) (-1228.429) [-1227.220] (-1233.666) -- 0:01:12
65000 -- (-1226.970) (-1227.133) [-1236.333] (-1239.000) * (-1227.493) (-1227.466) [-1227.318] (-1232.425) -- 0:01:11
Average standard deviation of split frequencies: 0.020067
65500 -- (-1229.066) (-1227.894) [-1245.754] (-1237.241) * (-1228.393) (-1226.795) (-1228.108) [-1230.455] -- 0:01:11
66000 -- (-1229.830) (-1227.229) [-1240.471] (-1236.144) * (-1228.354) [-1227.188] (-1227.402) (-1227.532) -- 0:01:10
66500 -- (-1232.648) (-1228.179) [-1239.326] (-1237.583) * (-1229.361) [-1227.083] (-1227.386) (-1228.407) -- 0:01:10
67000 -- (-1231.538) (-1228.085) [-1234.531] (-1237.402) * (-1227.467) (-1226.476) [-1226.457] (-1227.781) -- 0:01:09
67500 -- (-1226.829) (-1227.497) [-1237.302] (-1247.150) * [-1228.917] (-1227.249) (-1229.196) (-1227.748) -- 0:01:09
68000 -- (-1228.471) [-1227.497] (-1241.531) (-1234.762) * [-1233.839] (-1226.380) (-1228.202) (-1228.572) -- 0:01:08
68500 -- (-1227.220) (-1226.828) (-1243.971) [-1233.930] * (-1233.726) (-1226.199) [-1228.541] (-1226.771) -- 0:01:07
69000 -- (-1227.762) [-1228.745] (-1236.460) (-1237.047) * (-1226.993) [-1226.376] (-1228.476) (-1228.326) -- 0:01:07
69500 -- (-1228.528) (-1227.141) [-1233.591] (-1236.868) * (-1228.090) (-1226.991) [-1228.150] (-1227.710) -- 0:01:06
70000 -- (-1231.105) (-1227.194) [-1236.275] (-1247.363) * (-1227.890) [-1228.198] (-1231.007) (-1232.597) -- 0:01:06
Average standard deviation of split frequencies: 0.021601
70500 -- (-1229.702) [-1227.215] (-1237.696) (-1232.743) * (-1231.673) [-1226.796] (-1231.168) (-1226.883) -- 0:01:05
71000 -- (-1229.654) [-1226.357] (-1236.561) (-1237.491) * (-1229.185) [-1226.730] (-1226.729) (-1226.907) -- 0:01:05
71500 -- (-1229.240) (-1229.295) (-1239.755) [-1236.129] * (-1229.639) (-1226.157) [-1227.767] (-1227.951) -- 0:01:04
72000 -- (-1227.748) (-1228.319) [-1232.284] (-1237.764) * (-1230.478) (-1229.544) [-1229.973] (-1230.193) -- 0:01:04
72500 -- (-1230.419) [-1228.690] (-1259.604) (-1232.169) * [-1227.324] (-1230.392) (-1226.558) (-1230.644) -- 0:01:03
73000 -- (-1229.369) (-1228.674) [-1226.732] (-1233.355) * (-1227.346) [-1229.419] (-1228.499) (-1230.160) -- 0:01:03
73500 -- (-1231.687) [-1229.228] (-1226.664) (-1233.759) * (-1228.353) (-1229.087) (-1230.410) [-1230.644] -- 0:01:03
74000 -- [-1229.237] (-1227.386) (-1227.823) (-1240.575) * (-1227.840) (-1229.047) (-1227.804) [-1227.906] -- 0:01:02
74500 -- (-1228.987) (-1230.685) (-1227.602) [-1231.091] * (-1228.622) (-1230.789) [-1228.026] (-1231.065) -- 0:01:02
75000 -- (-1232.437) [-1229.515] (-1229.490) (-1239.136) * [-1227.647] (-1226.786) (-1227.112) (-1228.069) -- 0:01:01
Average standard deviation of split frequencies: 0.025697
75500 -- [-1228.009] (-1229.570) (-1228.596) (-1236.871) * (-1227.935) [-1227.045] (-1227.358) (-1228.913) -- 0:01:01
76000 -- (-1229.630) (-1230.828) (-1227.171) [-1232.571] * (-1227.853) (-1227.070) [-1226.964] (-1228.497) -- 0:01:00
76500 -- (-1226.744) [-1229.443] (-1228.452) (-1231.846) * (-1230.783) (-1227.013) (-1227.092) [-1227.374] -- 0:01:00
77000 -- (-1229.529) (-1226.259) (-1228.951) [-1237.152] * (-1228.241) (-1227.679) [-1228.204] (-1227.406) -- 0:00:59
77500 -- [-1227.268] (-1229.280) (-1230.853) (-1236.805) * (-1228.208) (-1226.644) [-1228.569] (-1226.328) -- 0:00:59
78000 -- [-1227.843] (-1230.736) (-1229.887) (-1241.599) * (-1230.248) (-1233.063) [-1228.092] (-1226.332) -- 0:00:59
78500 -- (-1230.125) [-1228.577] (-1227.738) (-1241.573) * (-1228.752) (-1233.702) (-1226.942) [-1226.411] -- 0:00:58
79000 -- (-1228.597) (-1227.515) [-1227.882] (-1234.448) * (-1230.915) (-1227.868) [-1228.027] (-1228.683) -- 0:00:58
79500 -- [-1229.409] (-1226.778) (-1232.457) (-1239.006) * (-1227.906) (-1228.745) [-1226.399] (-1226.849) -- 0:00:57
80000 -- [-1226.635] (-1228.793) (-1230.319) (-1232.608) * (-1227.851) [-1231.229] (-1228.653) (-1227.719) -- 0:00:57
Average standard deviation of split frequencies: 0.024210
80500 -- (-1231.164) (-1227.424) (-1226.543) [-1238.368] * [-1228.776] (-1229.314) (-1228.078) (-1231.066) -- 0:01:08
81000 -- [-1226.977] (-1227.476) (-1227.281) (-1233.146) * (-1227.227) [-1228.984] (-1232.395) (-1233.902) -- 0:01:08
81500 -- (-1227.411) (-1226.606) [-1226.756] (-1227.038) * (-1227.579) (-1236.145) (-1228.005) [-1231.667] -- 0:01:07
82000 -- [-1230.857] (-1227.052) (-1226.721) (-1227.130) * (-1229.896) [-1228.640] (-1226.633) (-1229.811) -- 0:01:07
82500 -- (-1227.704) (-1226.788) [-1226.928] (-1227.829) * (-1231.095) (-1228.225) (-1232.360) [-1230.078] -- 0:01:06
83000 -- (-1227.055) [-1227.885] (-1227.814) (-1227.366) * (-1234.800) [-1228.769] (-1226.595) (-1230.806) -- 0:01:06
83500 -- (-1227.085) (-1227.369) [-1228.564] (-1227.543) * (-1231.203) (-1228.100) (-1226.983) [-1228.156] -- 0:01:05
84000 -- (-1228.934) (-1227.267) [-1228.910] (-1229.912) * (-1227.292) (-1228.228) [-1226.838] (-1228.625) -- 0:01:05
84500 -- (-1229.707) (-1228.331) (-1227.965) [-1228.068] * (-1228.115) (-1229.401) [-1231.803] (-1228.242) -- 0:01:05
85000 -- [-1230.046] (-1229.611) (-1229.163) (-1228.150) * [-1228.321] (-1234.179) (-1229.460) (-1228.823) -- 0:01:04
Average standard deviation of split frequencies: 0.022187
85500 -- (-1226.752) [-1226.950] (-1228.595) (-1227.450) * [-1227.997] (-1230.550) (-1234.746) (-1228.491) -- 0:01:04
86000 -- (-1228.289) (-1226.547) (-1228.766) [-1228.417] * (-1227.882) [-1227.413] (-1231.923) (-1226.884) -- 0:01:03
86500 -- (-1228.518) [-1226.905] (-1229.809) (-1228.209) * (-1226.478) (-1230.471) [-1229.493] (-1227.262) -- 0:01:03
87000 -- (-1228.295) [-1226.857] (-1228.250) (-1229.877) * [-1229.442] (-1232.390) (-1229.443) (-1228.916) -- 0:01:02
87500 -- (-1231.880) [-1226.844] (-1227.425) (-1227.536) * (-1226.841) [-1229.785] (-1227.441) (-1228.737) -- 0:01:02
88000 -- [-1227.114] (-1228.568) (-1228.094) (-1227.996) * [-1227.023] (-1230.309) (-1236.901) (-1228.042) -- 0:01:02
88500 -- (-1227.445) [-1229.534] (-1229.377) (-1228.150) * (-1226.629) [-1229.667] (-1229.446) (-1228.080) -- 0:01:01
89000 -- [-1230.263] (-1229.405) (-1227.719) (-1228.699) * (-1228.087) [-1230.889] (-1229.909) (-1229.111) -- 0:01:01
89500 -- (-1232.020) [-1229.098] (-1228.258) (-1229.330) * (-1228.064) (-1227.514) (-1226.633) [-1227.255] -- 0:01:01
90000 -- [-1226.989] (-1229.667) (-1229.481) (-1229.613) * (-1230.586) (-1228.329) (-1228.173) [-1229.306] -- 0:01:00
Average standard deviation of split frequencies: 0.022986
90500 -- [-1228.577] (-1230.116) (-1238.403) (-1231.760) * (-1231.271) [-1227.019] (-1231.880) (-1227.660) -- 0:01:00
91000 -- (-1230.412) [-1227.136] (-1229.967) (-1231.038) * (-1232.533) [-1227.157] (-1227.750) (-1231.453) -- 0:00:59
91500 -- (-1232.748) (-1228.912) [-1227.566] (-1230.437) * (-1231.626) [-1226.911] (-1227.709) (-1230.004) -- 0:00:59
92000 -- (-1232.972) (-1229.322) (-1227.832) [-1229.998] * (-1226.807) (-1229.406) [-1228.514] (-1227.291) -- 0:00:59
92500 -- (-1228.751) (-1226.947) (-1232.014) [-1229.518] * (-1226.690) (-1228.165) [-1226.558] (-1229.462) -- 0:00:58
93000 -- (-1228.269) (-1227.561) (-1230.693) [-1231.357] * [-1231.729] (-1227.120) (-1227.449) (-1227.212) -- 0:00:58
93500 -- (-1227.485) [-1228.221] (-1231.203) (-1233.035) * (-1231.005) (-1226.958) [-1227.287] (-1227.346) -- 0:00:58
94000 -- (-1227.544) (-1227.836) [-1227.578] (-1232.451) * (-1229.280) [-1226.478] (-1229.312) (-1227.578) -- 0:00:57
94500 -- [-1233.633] (-1228.143) (-1228.139) (-1231.585) * (-1228.216) (-1227.336) (-1229.664) [-1226.786] -- 0:00:57
95000 -- (-1237.091) (-1228.152) (-1229.984) [-1227.597] * (-1230.119) [-1227.858] (-1228.753) (-1229.083) -- 0:00:57
Average standard deviation of split frequencies: 0.021451
95500 -- (-1228.013) [-1227.610] (-1228.622) (-1227.717) * (-1229.463) (-1226.466) [-1228.960] (-1230.204) -- 0:00:56
96000 -- (-1227.183) (-1226.361) [-1229.897] (-1230.763) * (-1228.722) [-1230.200] (-1234.115) (-1233.800) -- 0:00:56
96500 -- (-1227.185) (-1227.617) [-1230.606] (-1229.475) * (-1227.493) [-1229.109] (-1233.428) (-1228.082) -- 0:01:05
97000 -- (-1230.086) (-1231.184) (-1227.886) [-1228.941] * (-1230.539) [-1229.845] (-1230.147) (-1228.154) -- 0:01:05
97500 -- [-1229.602] (-1230.173) (-1229.667) (-1228.292) * (-1231.573) (-1229.035) [-1229.206] (-1229.062) -- 0:01:04
98000 -- (-1235.422) [-1232.096] (-1230.630) (-1231.765) * [-1228.402] (-1227.078) (-1229.454) (-1229.399) -- 0:01:04
98500 -- (-1233.059) [-1227.027] (-1229.809) (-1233.736) * [-1227.466] (-1227.791) (-1227.838) (-1228.913) -- 0:01:04
99000 -- [-1228.270] (-1228.791) (-1232.415) (-1229.412) * (-1226.626) [-1227.841] (-1227.045) (-1229.027) -- 0:01:03
99500 -- (-1227.460) [-1227.135] (-1235.601) (-1232.288) * [-1226.283] (-1229.489) (-1226.188) (-1230.675) -- 0:01:03
100000 -- (-1227.186) (-1228.502) [-1229.195] (-1229.016) * [-1226.688] (-1227.112) (-1227.260) (-1228.994) -- 0:01:02
Average standard deviation of split frequencies: 0.022374
100500 -- (-1227.186) (-1229.811) (-1227.722) [-1227.382] * (-1229.196) (-1229.480) (-1226.103) [-1227.999] -- 0:01:02
101000 -- (-1228.808) (-1227.526) (-1226.697) [-1227.543] * (-1226.467) [-1227.316] (-1226.632) (-1226.532) -- 0:01:02
101500 -- (-1232.424) (-1227.614) [-1226.335] (-1228.243) * (-1226.557) (-1228.941) [-1229.309] (-1227.021) -- 0:01:01
102000 -- (-1229.403) (-1228.079) [-1227.798] (-1227.269) * (-1234.131) (-1231.655) (-1229.476) [-1228.962] -- 0:01:01
102500 -- (-1232.116) [-1227.672] (-1226.615) (-1228.314) * (-1231.803) (-1230.516) [-1228.217] (-1230.046) -- 0:01:01
103000 -- (-1228.406) [-1227.691] (-1227.159) (-1228.228) * (-1228.367) (-1228.781) [-1230.021] (-1229.858) -- 0:01:00
103500 -- (-1226.576) (-1227.686) (-1227.307) [-1228.736] * [-1227.255] (-1229.611) (-1229.804) (-1230.926) -- 0:01:00
104000 -- (-1226.869) (-1229.614) [-1226.653] (-1229.122) * [-1228.385] (-1228.384) (-1234.908) (-1230.394) -- 0:01:00
104500 -- (-1227.259) (-1227.534) [-1226.691] (-1230.146) * [-1228.321] (-1228.368) (-1227.473) (-1230.455) -- 0:00:59
105000 -- (-1227.482) (-1227.966) (-1232.050) [-1231.776] * [-1227.728] (-1229.819) (-1227.428) (-1229.631) -- 0:00:59
Average standard deviation of split frequencies: 0.023793
105500 -- (-1228.670) [-1229.357] (-1227.857) (-1230.870) * (-1230.764) (-1229.920) [-1228.469] (-1230.047) -- 0:00:59
106000 -- (-1228.369) (-1227.513) [-1227.764] (-1231.777) * (-1228.536) (-1228.489) (-1227.278) [-1228.094] -- 0:00:59
106500 -- (-1226.606) [-1227.267] (-1230.009) (-1228.595) * (-1227.112) (-1227.827) [-1226.409] (-1226.808) -- 0:00:58
107000 -- (-1226.606) (-1231.152) (-1227.556) [-1228.786] * (-1226.635) (-1231.854) (-1226.758) [-1232.554] -- 0:00:58
107500 -- (-1226.602) (-1227.258) [-1228.596] (-1230.343) * (-1227.754) [-1229.385] (-1226.794) (-1231.501) -- 0:00:58
108000 -- [-1229.100] (-1227.099) (-1228.574) (-1228.027) * [-1227.824] (-1229.422) (-1228.969) (-1230.433) -- 0:00:57
108500 -- (-1227.669) (-1226.531) (-1228.486) [-1229.392] * (-1231.205) [-1230.984] (-1227.734) (-1230.314) -- 0:00:57
109000 -- (-1227.231) (-1228.448) (-1228.808) [-1232.114] * (-1231.000) (-1228.664) (-1226.895) [-1229.411] -- 0:00:57
109500 -- (-1227.050) (-1229.841) (-1228.275) [-1229.775] * (-1232.674) (-1227.915) [-1227.589] (-1231.008) -- 0:00:56
110000 -- [-1227.411] (-1229.750) (-1228.385) (-1231.665) * (-1232.409) [-1229.836] (-1226.224) (-1229.454) -- 0:00:56
Average standard deviation of split frequencies: 0.020850
110500 -- [-1226.817] (-1227.242) (-1232.262) (-1229.461) * (-1231.392) [-1229.696] (-1227.541) (-1230.014) -- 0:00:56
111000 -- (-1226.854) [-1226.594] (-1234.728) (-1234.534) * (-1229.400) (-1229.006) (-1230.482) [-1230.296] -- 0:00:56
111500 -- (-1228.752) (-1232.381) [-1230.742] (-1230.539) * (-1226.942) (-1228.651) [-1226.931] (-1230.894) -- 0:00:55
112000 -- (-1227.704) [-1226.568] (-1231.190) (-1227.979) * (-1228.605) (-1227.232) [-1227.761] (-1229.017) -- 0:00:55
112500 -- [-1226.324] (-1228.151) (-1230.256) (-1230.093) * (-1226.789) (-1227.666) (-1226.534) [-1228.081] -- 0:01:03
113000 -- [-1228.437] (-1228.838) (-1230.844) (-1229.450) * [-1227.447] (-1229.628) (-1227.641) (-1228.696) -- 0:01:02
113500 -- [-1226.985] (-1228.864) (-1229.309) (-1229.450) * (-1227.438) [-1235.486] (-1227.335) (-1228.368) -- 0:01:02
114000 -- (-1227.038) (-1226.412) (-1235.409) [-1229.499] * (-1228.649) [-1228.380] (-1227.201) (-1229.098) -- 0:01:02
114500 -- (-1226.747) (-1226.756) (-1230.384) [-1228.599] * (-1230.381) (-1229.370) [-1227.327] (-1230.101) -- 0:01:01
115000 -- (-1228.278) (-1226.756) (-1232.102) [-1227.973] * (-1230.724) (-1226.979) [-1229.884] (-1231.021) -- 0:01:01
Average standard deviation of split frequencies: 0.022448
115500 -- (-1228.605) (-1227.548) [-1230.906] (-1227.594) * (-1226.550) [-1227.702] (-1230.142) (-1227.158) -- 0:01:01
116000 -- (-1228.813) (-1233.795) (-1229.874) [-1227.457] * (-1227.458) (-1227.774) [-1229.328] (-1226.680) -- 0:01:00
116500 -- (-1230.980) [-1231.654] (-1227.095) (-1227.204) * (-1228.278) (-1228.420) [-1227.744] (-1229.653) -- 0:01:00
117000 -- (-1232.501) [-1228.797] (-1228.670) (-1226.809) * (-1231.359) (-1230.517) (-1226.516) [-1230.807] -- 0:01:00
117500 -- (-1227.909) [-1228.461] (-1227.037) (-1232.192) * (-1228.558) (-1229.653) (-1226.942) [-1230.099] -- 0:01:00
118000 -- (-1231.399) (-1230.066) (-1229.616) [-1229.061] * (-1229.569) (-1229.585) [-1226.327] (-1227.614) -- 0:00:59
118500 -- (-1228.547) [-1232.073] (-1230.727) (-1228.350) * (-1229.312) (-1229.042) [-1227.908] (-1227.439) -- 0:00:59
119000 -- (-1227.295) (-1227.891) (-1227.143) [-1228.238] * (-1229.693) (-1229.349) [-1226.829] (-1227.590) -- 0:00:59
119500 -- [-1228.351] (-1233.443) (-1227.128) (-1227.665) * (-1227.604) (-1235.395) (-1227.521) [-1228.179] -- 0:00:58
120000 -- (-1230.811) (-1230.363) [-1229.113] (-1227.980) * (-1228.773) (-1228.171) (-1228.638) [-1230.356] -- 0:00:58
Average standard deviation of split frequencies: 0.020561
120500 -- (-1226.669) (-1232.025) [-1229.208] (-1228.491) * (-1230.121) (-1228.623) [-1227.775] (-1228.433) -- 0:00:58
121000 -- [-1226.153] (-1231.534) (-1227.546) (-1227.766) * (-1227.984) [-1227.502] (-1228.540) (-1231.275) -- 0:00:58
121500 -- [-1226.206] (-1227.707) (-1226.419) (-1227.177) * [-1228.128] (-1227.297) (-1228.515) (-1228.425) -- 0:00:57
122000 -- [-1227.255] (-1229.573) (-1227.882) (-1231.217) * (-1228.760) [-1228.406] (-1228.223) (-1227.485) -- 0:00:57
122500 -- [-1226.909] (-1227.724) (-1227.307) (-1229.924) * (-1230.290) (-1228.722) [-1227.815] (-1227.465) -- 0:00:57
123000 -- (-1228.803) [-1227.501] (-1227.050) (-1229.833) * (-1228.443) (-1227.577) (-1227.567) [-1231.150] -- 0:00:57
123500 -- [-1226.383] (-1226.481) (-1227.610) (-1229.196) * (-1231.784) (-1226.864) (-1228.773) [-1227.751] -- 0:00:56
124000 -- (-1228.149) [-1227.414] (-1229.991) (-1227.841) * (-1228.672) [-1228.613] (-1228.656) (-1232.459) -- 0:00:56
124500 -- [-1230.073] (-1230.687) (-1230.526) (-1230.033) * [-1226.845] (-1234.515) (-1227.799) (-1226.662) -- 0:00:56
125000 -- (-1230.776) (-1227.726) (-1228.470) [-1229.290] * [-1227.165] (-1229.861) (-1229.950) (-1228.111) -- 0:00:56
Average standard deviation of split frequencies: 0.020132
125500 -- (-1229.145) [-1228.265] (-1231.158) (-1227.156) * (-1228.809) (-1230.504) (-1228.626) [-1227.292] -- 0:00:55
126000 -- [-1233.862] (-1227.633) (-1227.780) (-1227.737) * [-1226.932] (-1231.414) (-1230.923) (-1229.004) -- 0:00:55
126500 -- (-1229.945) [-1228.675] (-1227.811) (-1229.072) * (-1233.372) [-1229.327] (-1227.914) (-1228.483) -- 0:00:55
127000 -- (-1233.989) [-1231.570] (-1231.280) (-1228.793) * (-1226.794) (-1229.332) (-1230.518) [-1228.376] -- 0:00:54
127500 -- (-1230.710) [-1234.472] (-1229.594) (-1227.318) * (-1226.799) (-1227.632) [-1226.726] (-1230.628) -- 0:00:54
128000 -- (-1229.568) [-1228.356] (-1231.002) (-1227.809) * (-1231.117) (-1227.261) (-1227.129) [-1231.740] -- 0:00:54
128500 -- (-1227.973) (-1229.013) [-1231.844] (-1227.494) * (-1227.457) [-1229.200] (-1228.580) (-1228.302) -- 0:01:01
129000 -- (-1227.918) [-1226.857] (-1226.926) (-1227.746) * (-1227.653) (-1228.149) (-1231.807) [-1227.385] -- 0:01:00
129500 -- (-1228.600) [-1226.328] (-1227.862) (-1228.702) * [-1229.006] (-1229.679) (-1233.173) (-1226.448) -- 0:01:00
130000 -- (-1228.524) [-1227.217] (-1226.858) (-1226.851) * (-1227.447) (-1227.952) [-1231.538] (-1227.917) -- 0:01:00
Average standard deviation of split frequencies: 0.021990
130500 -- [-1228.499] (-1227.355) (-1227.816) (-1226.921) * (-1227.538) (-1228.239) [-1230.444] (-1226.492) -- 0:00:59
131000 -- (-1228.372) [-1227.539] (-1230.366) (-1228.581) * (-1228.101) (-1227.042) (-1228.707) [-1226.718] -- 0:00:59
131500 -- (-1228.964) [-1227.929] (-1227.057) (-1227.193) * (-1228.026) [-1228.951] (-1229.073) (-1228.214) -- 0:00:59
132000 -- (-1228.199) (-1228.386) (-1229.991) [-1227.930] * [-1228.220] (-1229.712) (-1230.773) (-1226.799) -- 0:00:59
132500 -- (-1228.199) (-1226.668) [-1227.260] (-1229.377) * (-1226.786) [-1229.281] (-1229.231) (-1228.998) -- 0:00:58
133000 -- (-1227.921) (-1227.341) (-1230.680) [-1227.007] * (-1227.726) [-1229.220] (-1230.013) (-1228.556) -- 0:00:58
133500 -- (-1226.713) (-1227.365) (-1227.002) [-1229.779] * (-1232.733) [-1229.635] (-1228.160) (-1228.655) -- 0:00:58
134000 -- (-1230.674) (-1226.845) [-1226.337] (-1228.353) * (-1233.592) (-1227.561) (-1228.565) [-1228.783] -- 0:00:58
134500 -- (-1233.126) (-1227.046) [-1227.096] (-1228.216) * (-1228.629) [-1227.893] (-1227.310) (-1228.261) -- 0:00:57
135000 -- (-1226.938) (-1226.826) (-1227.096) [-1227.392] * (-1228.360) [-1226.873] (-1230.502) (-1229.513) -- 0:00:57
Average standard deviation of split frequencies: 0.020624
135500 -- [-1231.909] (-1228.271) (-1227.056) (-1230.519) * [-1230.817] (-1227.600) (-1228.848) (-1228.789) -- 0:00:57
136000 -- (-1228.570) [-1227.427] (-1231.779) (-1228.373) * [-1228.700] (-1227.147) (-1227.448) (-1226.771) -- 0:00:57
136500 -- (-1226.377) (-1229.778) [-1226.235] (-1233.274) * (-1228.747) [-1227.398] (-1229.427) (-1227.906) -- 0:00:56
137000 -- [-1230.638] (-1230.426) (-1228.029) (-1228.847) * (-1228.856) (-1228.408) (-1229.904) [-1229.838] -- 0:00:56
137500 -- (-1227.840) [-1227.739] (-1226.805) (-1232.773) * (-1229.088) (-1227.704) (-1227.974) [-1228.181] -- 0:00:56
138000 -- (-1228.029) [-1231.205] (-1228.097) (-1228.643) * [-1229.374] (-1230.842) (-1227.483) (-1226.319) -- 0:00:56
138500 -- (-1227.523) (-1229.518) (-1230.063) [-1230.435] * (-1232.957) [-1228.096] (-1229.949) (-1228.026) -- 0:00:55
139000 -- (-1226.806) [-1227.495] (-1230.548) (-1226.570) * [-1227.376] (-1228.883) (-1228.043) (-1228.580) -- 0:00:55
139500 -- [-1227.418] (-1228.046) (-1232.887) (-1227.288) * [-1229.595] (-1230.754) (-1228.156) (-1230.523) -- 0:00:55
140000 -- (-1226.230) (-1229.622) (-1228.700) [-1227.286] * (-1228.348) [-1228.916] (-1226.467) (-1228.474) -- 0:00:55
Average standard deviation of split frequencies: 0.018990
140500 -- (-1226.292) (-1234.336) (-1227.694) [-1228.471] * (-1228.642) [-1230.162] (-1228.190) (-1230.893) -- 0:00:55
141000 -- [-1226.328] (-1230.103) (-1229.364) (-1231.244) * [-1227.668] (-1226.957) (-1226.430) (-1229.389) -- 0:00:54
141500 -- (-1227.265) (-1228.552) [-1226.766] (-1227.630) * (-1226.997) (-1229.175) [-1227.415] (-1232.287) -- 0:00:54
142000 -- (-1227.620) (-1230.499) [-1227.854] (-1226.655) * (-1226.924) [-1231.957] (-1227.267) (-1230.142) -- 0:00:54
142500 -- (-1229.122) (-1229.769) (-1228.749) [-1227.663] * (-1227.859) [-1226.932] (-1228.223) (-1233.202) -- 0:00:54
143000 -- (-1227.424) (-1229.470) [-1227.547] (-1227.388) * [-1228.967] (-1228.115) (-1228.389) (-1227.685) -- 0:00:53
143500 -- (-1228.155) (-1226.749) (-1229.209) [-1226.726] * [-1227.687] (-1227.016) (-1228.826) (-1227.263) -- 0:00:53
144000 -- [-1229.618] (-1226.983) (-1226.791) (-1226.686) * (-1228.890) (-1228.552) (-1227.222) [-1226.929] -- 0:00:53
144500 -- (-1228.424) (-1228.333) (-1226.788) [-1226.781] * (-1228.183) (-1226.383) [-1226.865] (-1226.953) -- 0:00:53
145000 -- (-1230.410) (-1227.601) [-1234.718] (-1226.936) * (-1232.205) [-1226.388] (-1226.374) (-1230.788) -- 0:00:58
Average standard deviation of split frequencies: 0.018786
145500 -- (-1229.830) (-1226.562) (-1233.791) [-1228.732] * (-1230.568) [-1226.388] (-1227.103) (-1226.664) -- 0:00:58
146000 -- (-1229.886) (-1229.167) (-1231.947) [-1230.143] * (-1230.519) (-1226.062) (-1227.766) [-1229.547] -- 0:00:58
146500 -- [-1226.977] (-1229.671) (-1232.582) (-1229.644) * (-1231.381) (-1227.305) (-1227.914) [-1227.134] -- 0:00:58
147000 -- (-1231.739) [-1229.490] (-1230.891) (-1227.526) * [-1229.286] (-1229.430) (-1227.831) (-1227.555) -- 0:00:58
147500 -- (-1227.805) (-1230.254) [-1226.628] (-1227.619) * [-1229.615] (-1232.623) (-1227.226) (-1232.038) -- 0:00:57
148000 -- (-1230.131) [-1227.832] (-1228.003) (-1230.475) * (-1229.030) (-1231.559) [-1229.483] (-1229.771) -- 0:00:57
148500 -- [-1230.819] (-1230.928) (-1227.607) (-1227.273) * (-1231.237) [-1231.559] (-1228.672) (-1228.206) -- 0:00:57
149000 -- (-1229.689) (-1229.145) [-1227.817] (-1226.415) * (-1228.399) (-1228.549) (-1226.562) [-1227.336] -- 0:00:57
149500 -- (-1226.653) (-1228.998) (-1226.658) [-1226.658] * (-1228.026) (-1229.844) [-1228.258] (-1228.535) -- 0:00:56
150000 -- [-1228.896] (-1228.831) (-1227.889) (-1230.200) * (-1227.940) (-1229.606) (-1231.042) [-1228.998] -- 0:00:56
Average standard deviation of split frequencies: 0.020263
150500 -- [-1228.698] (-1228.777) (-1226.367) (-1230.986) * [-1226.668] (-1230.054) (-1234.437) (-1229.098) -- 0:00:56
151000 -- (-1228.813) (-1229.642) (-1226.389) [-1228.668] * [-1226.831] (-1242.612) (-1229.564) (-1227.155) -- 0:00:56
151500 -- (-1230.402) [-1228.602] (-1226.440) (-1228.013) * (-1229.888) [-1229.545] (-1229.168) (-1227.147) -- 0:00:56
152000 -- (-1231.437) (-1230.759) [-1226.994] (-1227.554) * (-1229.710) (-1229.583) [-1227.778] (-1227.573) -- 0:00:55
152500 -- (-1230.071) (-1231.785) [-1227.058] (-1228.852) * [-1227.636] (-1232.198) (-1231.470) (-1227.340) -- 0:00:55
153000 -- (-1230.492) (-1228.246) [-1230.450] (-1228.415) * (-1228.545) [-1232.945] (-1230.942) (-1228.591) -- 0:00:55
153500 -- (-1228.861) (-1228.176) [-1228.288] (-1228.853) * (-1227.080) (-1228.655) (-1228.021) [-1226.544] -- 0:00:55
154000 -- (-1228.190) (-1229.454) [-1227.028] (-1227.157) * (-1228.772) (-1229.225) [-1226.208] (-1230.429) -- 0:00:54
154500 -- (-1230.970) (-1228.066) [-1227.163] (-1226.522) * (-1228.770) (-1228.015) [-1227.327] (-1228.423) -- 0:00:54
155000 -- (-1227.637) [-1227.057] (-1229.888) (-1228.530) * (-1226.845) (-1227.520) [-1227.829] (-1227.944) -- 0:00:54
Average standard deviation of split frequencies: 0.018994
155500 -- (-1228.802) (-1226.795) [-1230.032] (-1229.714) * (-1227.015) (-1227.258) (-1229.340) [-1227.758] -- 0:00:54
156000 -- (-1229.676) [-1226.327] (-1232.324) (-1226.765) * (-1231.891) (-1228.276) (-1227.194) [-1227.784] -- 0:00:54
156500 -- (-1227.495) (-1228.693) (-1229.301) [-1228.450] * (-1228.091) (-1229.336) [-1230.088] (-1227.868) -- 0:00:53
157000 -- (-1226.987) [-1226.869] (-1229.402) (-1228.939) * (-1226.568) [-1229.285] (-1226.343) (-1229.443) -- 0:00:53
157500 -- [-1229.916] (-1227.358) (-1226.630) (-1229.457) * (-1228.342) (-1229.536) [-1226.791] (-1230.939) -- 0:00:53
158000 -- [-1227.451] (-1230.254) (-1227.347) (-1229.002) * [-1228.342] (-1227.696) (-1226.816) (-1226.540) -- 0:00:53
158500 -- (-1228.289) (-1226.882) (-1226.741) [-1228.722] * (-1226.727) [-1227.404] (-1226.664) (-1227.340) -- 0:00:53
159000 -- [-1229.542] (-1227.200) (-1227.973) (-1230.676) * (-1228.037) (-1227.057) (-1227.039) [-1227.643] -- 0:00:52
159500 -- (-1227.508) (-1229.659) (-1227.621) [-1230.570] * [-1227.244] (-1228.838) (-1228.060) (-1227.735) -- 0:00:52
160000 -- (-1228.144) [-1227.482] (-1227.847) (-1229.046) * (-1228.216) [-1228.611] (-1227.805) (-1228.722) -- 0:00:52
Average standard deviation of split frequencies: 0.019886
160500 -- (-1226.527) [-1226.978] (-1226.757) (-1230.216) * (-1231.186) (-1228.428) [-1230.318] (-1229.065) -- 0:00:52
161000 -- (-1226.675) (-1228.522) [-1226.822] (-1227.253) * [-1228.917] (-1227.043) (-1228.405) (-1228.123) -- 0:00:57
161500 -- [-1227.672] (-1229.811) (-1226.398) (-1230.036) * [-1229.556] (-1229.832) (-1228.920) (-1231.656) -- 0:00:57
162000 -- [-1227.002] (-1228.122) (-1231.250) (-1227.083) * (-1228.599) [-1228.116] (-1227.770) (-1230.544) -- 0:00:56
162500 -- (-1235.917) [-1229.194] (-1229.070) (-1227.298) * (-1228.823) [-1227.960] (-1227.785) (-1233.895) -- 0:00:56
163000 -- (-1236.370) (-1228.598) (-1227.089) [-1228.501] * (-1230.297) [-1227.793] (-1228.626) (-1227.967) -- 0:00:56
163500 -- (-1232.120) (-1229.940) (-1229.066) [-1228.109] * (-1230.260) (-1228.504) (-1229.471) [-1228.563] -- 0:00:56
164000 -- (-1230.288) (-1230.098) (-1229.676) [-1232.124] * [-1229.458] (-1227.559) (-1227.747) (-1228.085) -- 0:00:56
164500 -- (-1230.082) [-1227.428] (-1228.253) (-1229.386) * (-1229.905) [-1228.033] (-1227.949) (-1229.484) -- 0:00:55
165000 -- (-1229.993) [-1227.506] (-1230.186) (-1230.947) * (-1227.570) (-1227.972) [-1228.279] (-1226.615) -- 0:00:55
Average standard deviation of split frequencies: 0.019311
165500 -- (-1228.608) [-1228.197] (-1232.465) (-1231.721) * (-1227.087) (-1228.306) (-1228.430) [-1232.693] -- 0:00:55
166000 -- (-1228.538) (-1233.362) [-1229.826] (-1229.858) * (-1227.119) (-1227.445) (-1227.945) [-1228.017] -- 0:00:55
166500 -- (-1228.386) [-1232.365] (-1226.617) (-1231.550) * [-1228.930] (-1229.104) (-1229.958) (-1226.945) -- 0:00:55
167000 -- (-1228.269) (-1228.000) [-1228.736] (-1227.192) * (-1229.803) [-1230.240] (-1229.177) (-1230.513) -- 0:00:54
167500 -- [-1227.104] (-1226.167) (-1228.193) (-1228.200) * (-1227.739) (-1227.232) (-1233.109) [-1229.982] -- 0:00:54
168000 -- [-1228.890] (-1226.951) (-1229.075) (-1229.950) * (-1232.332) (-1227.775) [-1231.027] (-1228.897) -- 0:00:54
168500 -- (-1228.357) [-1227.979] (-1226.733) (-1228.614) * (-1229.530) [-1228.361] (-1238.326) (-1226.954) -- 0:00:54
169000 -- (-1230.435) (-1227.138) (-1228.014) [-1227.166] * (-1228.258) (-1227.842) [-1227.981] (-1226.978) -- 0:00:54
169500 -- [-1227.790] (-1232.731) (-1228.845) (-1228.878) * (-1227.678) [-1229.957] (-1226.929) (-1226.495) -- 0:00:53
170000 -- (-1226.857) (-1231.563) (-1227.617) [-1227.759] * (-1227.173) (-1228.490) (-1229.645) [-1228.358] -- 0:00:53
Average standard deviation of split frequencies: 0.018463
170500 -- (-1227.499) [-1227.021] (-1227.931) (-1230.005) * (-1226.791) (-1229.197) [-1228.433] (-1228.473) -- 0:00:53
171000 -- [-1227.051] (-1227.466) (-1227.424) (-1230.399) * (-1227.798) (-1230.155) (-1236.535) [-1228.281] -- 0:00:53
171500 -- [-1227.831] (-1230.736) (-1230.125) (-1230.594) * (-1228.951) [-1228.546] (-1228.747) (-1227.306) -- 0:00:53
172000 -- (-1230.923) (-1233.741) (-1230.581) [-1229.401] * (-1228.154) (-1227.131) (-1226.870) [-1227.059] -- 0:00:52
172500 -- (-1232.174) (-1232.034) [-1226.387] (-1232.012) * (-1229.778) (-1229.476) [-1228.525] (-1228.376) -- 0:00:52
173000 -- (-1230.641) (-1229.375) [-1226.347] (-1226.752) * (-1228.453) [-1228.347] (-1229.197) (-1229.264) -- 0:00:52
173500 -- (-1232.176) (-1228.053) (-1228.296) [-1228.431] * (-1226.907) [-1230.603] (-1228.314) (-1228.103) -- 0:00:52
174000 -- (-1232.115) [-1227.305] (-1228.188) (-1228.989) * (-1232.570) (-1228.610) (-1227.931) [-1229.346] -- 0:00:52
174500 -- (-1228.211) (-1227.914) [-1227.727] (-1230.246) * (-1228.946) (-1230.944) [-1233.327] (-1230.831) -- 0:00:52
175000 -- (-1228.089) (-1229.268) (-1228.781) [-1229.673] * [-1228.159] (-1226.974) (-1227.753) (-1231.852) -- 0:00:51
Average standard deviation of split frequencies: 0.019172
175500 -- (-1227.657) [-1229.246] (-1226.288) (-1228.237) * (-1229.309) [-1227.886] (-1227.329) (-1228.730) -- 0:00:51
176000 -- [-1226.486] (-1228.391) (-1229.919) (-1228.194) * [-1227.727] (-1227.539) (-1227.732) (-1230.313) -- 0:00:51
176500 -- [-1227.219] (-1228.395) (-1233.980) (-1227.492) * (-1229.203) (-1226.970) [-1230.230] (-1229.675) -- 0:00:51
177000 -- (-1229.293) [-1228.283] (-1233.135) (-1227.245) * (-1228.798) (-1226.499) (-1229.536) [-1230.010] -- 0:00:51
177500 -- (-1230.795) [-1229.438] (-1229.370) (-1226.819) * [-1228.122] (-1226.976) (-1226.683) (-1230.662) -- 0:00:55
178000 -- (-1227.806) (-1227.150) (-1228.444) [-1227.079] * (-1230.019) (-1232.634) (-1227.083) [-1230.101] -- 0:00:55
178500 -- (-1228.225) (-1228.885) [-1228.041] (-1229.408) * [-1227.888] (-1231.564) (-1228.765) (-1227.454) -- 0:00:55
179000 -- [-1228.478] (-1229.333) (-1228.149) (-1226.673) * (-1227.334) (-1231.225) [-1228.238] (-1227.709) -- 0:00:55
179500 -- (-1226.605) (-1227.678) (-1227.219) [-1226.805] * (-1232.021) (-1228.143) [-1230.255] (-1227.654) -- 0:00:54
180000 -- (-1229.036) (-1230.724) (-1228.168) [-1226.518] * (-1226.987) (-1229.271) (-1229.661) [-1229.496] -- 0:00:54
Average standard deviation of split frequencies: 0.019913
180500 -- (-1229.056) (-1231.594) [-1228.285] (-1226.518) * (-1227.546) (-1230.254) [-1228.152] (-1226.703) -- 0:00:54
181000 -- (-1227.585) [-1228.948] (-1227.997) (-1226.518) * (-1228.038) (-1231.549) [-1227.009] (-1226.468) -- 0:00:54
181500 -- (-1229.081) [-1229.134] (-1227.972) (-1228.018) * [-1227.550] (-1230.442) (-1228.076) (-1228.271) -- 0:00:54
182000 -- (-1229.110) [-1230.012] (-1226.526) (-1228.746) * (-1228.553) (-1229.203) [-1227.950] (-1227.492) -- 0:00:53
182500 -- [-1229.351] (-1228.375) (-1226.473) (-1227.881) * (-1228.356) (-1227.479) (-1232.659) [-1226.567] -- 0:00:53
183000 -- (-1226.649) [-1227.953] (-1226.805) (-1229.343) * (-1227.524) [-1227.606] (-1227.363) (-1228.121) -- 0:00:53
183500 -- (-1226.656) [-1229.189] (-1226.619) (-1227.229) * (-1234.976) (-1228.038) (-1230.738) [-1227.919] -- 0:00:53
184000 -- (-1226.338) (-1229.035) [-1226.654] (-1229.807) * (-1231.107) [-1227.984] (-1230.867) (-1228.652) -- 0:00:53
184500 -- (-1227.801) (-1226.872) [-1227.494] (-1229.102) * (-1229.028) (-1230.797) [-1235.305] (-1229.135) -- 0:00:53
185000 -- (-1227.075) [-1227.320] (-1227.434) (-1227.229) * [-1230.512] (-1229.911) (-1227.469) (-1227.418) -- 0:00:52
Average standard deviation of split frequencies: 0.020542
185500 -- (-1227.762) [-1228.452] (-1227.689) (-1235.065) * (-1228.164) (-1227.528) [-1228.185] (-1226.810) -- 0:00:52
186000 -- (-1227.563) [-1228.447] (-1227.843) (-1232.208) * (-1226.709) (-1226.595) (-1227.780) [-1228.633] -- 0:00:52
186500 -- [-1226.945] (-1228.756) (-1227.809) (-1230.364) * (-1227.190) (-1226.942) (-1233.734) [-1233.903] -- 0:00:52
187000 -- (-1227.177) (-1230.101) (-1232.144) [-1228.160] * (-1228.867) (-1229.585) (-1231.316) [-1227.064] -- 0:00:52
187500 -- (-1229.168) (-1233.039) [-1227.344] (-1228.887) * (-1228.397) (-1226.777) [-1228.391] (-1227.127) -- 0:00:52
188000 -- (-1228.468) (-1226.563) (-1228.750) [-1230.744] * (-1226.877) [-1229.483] (-1230.556) (-1230.673) -- 0:00:51
188500 -- (-1229.969) [-1227.498] (-1229.576) (-1231.063) * (-1227.939) (-1229.299) [-1230.592] (-1230.240) -- 0:00:51
189000 -- (-1227.178) (-1227.486) [-1229.425] (-1230.324) * [-1226.692] (-1227.774) (-1228.958) (-1232.095) -- 0:00:51
189500 -- (-1227.403) [-1226.929] (-1229.426) (-1228.862) * (-1226.729) [-1229.885] (-1229.614) (-1229.770) -- 0:00:51
190000 -- (-1227.609) (-1228.177) [-1229.659] (-1227.885) * (-1230.493) [-1228.270] (-1228.111) (-1229.063) -- 0:00:51
Average standard deviation of split frequencies: 0.020300
190500 -- [-1227.811] (-1227.557) (-1227.572) (-1226.519) * [-1229.179] (-1228.185) (-1228.597) (-1228.423) -- 0:00:50
191000 -- (-1227.850) (-1227.298) (-1227.854) [-1229.520] * (-1229.109) [-1230.878] (-1229.077) (-1228.391) -- 0:00:50
191500 -- [-1229.863] (-1226.369) (-1228.596) (-1227.324) * [-1231.536] (-1229.555) (-1229.280) (-1227.360) -- 0:00:50
192000 -- (-1227.891) [-1228.939] (-1230.481) (-1226.733) * [-1229.549] (-1228.214) (-1228.904) (-1228.362) -- 0:00:50
192500 -- (-1230.365) [-1227.627] (-1228.013) (-1228.532) * [-1228.023] (-1228.065) (-1229.092) (-1228.717) -- 0:00:50
193000 -- (-1230.256) (-1227.006) (-1226.636) [-1228.116] * (-1227.045) (-1227.560) [-1228.181] (-1226.541) -- 0:00:50
193500 -- (-1227.152) (-1227.708) [-1227.779] (-1227.908) * (-1228.688) (-1228.957) [-1228.705] (-1229.899) -- 0:00:54
194000 -- [-1229.532] (-1229.509) (-1226.844) (-1227.147) * (-1227.188) (-1231.044) (-1229.843) [-1232.043] -- 0:00:54
194500 -- (-1228.222) (-1229.319) (-1227.480) [-1226.938] * (-1227.048) [-1227.903] (-1231.717) (-1226.742) -- 0:00:53
195000 -- (-1227.428) (-1229.970) [-1226.662] (-1228.213) * (-1227.048) (-1228.050) [-1228.981] (-1228.757) -- 0:00:53
Average standard deviation of split frequencies: 0.020507
195500 -- (-1228.349) (-1227.663) [-1229.137] (-1226.753) * [-1226.877] (-1228.281) (-1227.526) (-1232.393) -- 0:00:53
196000 -- (-1228.153) (-1228.219) (-1229.833) [-1227.663] * (-1226.800) (-1234.449) [-1230.142] (-1229.246) -- 0:00:53
196500 -- (-1227.487) (-1229.138) [-1227.845] (-1229.326) * (-1227.031) (-1230.043) [-1229.069] (-1228.666) -- 0:00:53
197000 -- (-1227.254) (-1229.138) (-1229.432) [-1227.831] * (-1226.936) [-1228.246] (-1232.534) (-1229.522) -- 0:00:52
197500 -- (-1229.356) (-1228.769) [-1230.396] (-1231.452) * (-1227.158) (-1229.594) (-1228.330) [-1228.286] -- 0:00:52
198000 -- (-1229.678) [-1229.055] (-1232.141) (-1230.813) * (-1226.700) (-1234.521) (-1235.679) [-1227.749] -- 0:00:52
198500 -- (-1228.527) [-1228.021] (-1227.813) (-1228.369) * (-1226.110) (-1233.535) (-1229.539) [-1227.406] -- 0:00:52
199000 -- (-1227.189) (-1230.133) (-1228.062) [-1230.538] * (-1227.631) (-1228.066) [-1227.574] (-1229.411) -- 0:00:52
199500 -- (-1227.115) (-1227.406) (-1226.794) [-1229.192] * (-1229.709) (-1232.331) [-1227.658] (-1229.982) -- 0:00:52
200000 -- (-1227.854) (-1228.812) (-1230.782) [-1227.566] * (-1226.857) [-1229.038] (-1226.496) (-1227.069) -- 0:00:51
Average standard deviation of split frequencies: 0.019535
200500 -- [-1227.784] (-1226.376) (-1230.412) (-1227.428) * (-1227.171) (-1233.991) (-1231.543) [-1226.973] -- 0:00:51
201000 -- (-1230.822) (-1228.404) (-1229.253) [-1227.554] * (-1228.745) (-1230.415) (-1231.544) [-1231.333] -- 0:00:51
201500 -- (-1230.046) (-1228.351) (-1229.015) [-1230.122] * (-1227.787) (-1227.983) (-1228.603) [-1229.392] -- 0:00:51
202000 -- [-1227.991] (-1227.981) (-1227.119) (-1229.207) * (-1229.835) [-1228.983] (-1227.455) (-1228.575) -- 0:00:51
202500 -- [-1228.393] (-1228.023) (-1227.238) (-1229.120) * [-1231.772] (-1231.611) (-1230.243) (-1232.453) -- 0:00:51
203000 -- [-1227.555] (-1227.458) (-1227.207) (-1230.133) * (-1228.672) [-1229.445] (-1231.993) (-1232.310) -- 0:00:51
203500 -- [-1228.163] (-1227.295) (-1228.965) (-1228.979) * [-1229.707] (-1229.103) (-1231.066) (-1228.697) -- 0:00:50
204000 -- (-1226.396) [-1228.366] (-1228.848) (-1230.247) * (-1230.949) [-1228.932] (-1230.312) (-1228.995) -- 0:00:50
204500 -- [-1228.238] (-1228.796) (-1228.798) (-1232.230) * (-1231.868) (-1230.400) [-1229.189] (-1228.994) -- 0:00:50
205000 -- [-1227.311] (-1227.781) (-1227.817) (-1228.125) * (-1230.452) (-1232.423) (-1229.036) [-1229.468] -- 0:00:50
Average standard deviation of split frequencies: 0.021198
205500 -- (-1227.468) [-1226.736] (-1227.160) (-1229.615) * (-1233.820) (-1230.126) [-1229.946] (-1226.550) -- 0:00:50
206000 -- (-1226.792) (-1228.561) (-1230.288) [-1227.037] * [-1228.619] (-1228.433) (-1231.611) (-1227.201) -- 0:00:50
206500 -- (-1228.588) (-1227.772) [-1228.151] (-1227.079) * [-1227.240] (-1227.837) (-1227.346) (-1230.586) -- 0:00:49
207000 -- (-1229.454) [-1226.821] (-1231.412) (-1230.437) * (-1228.006) [-1229.389] (-1227.408) (-1227.591) -- 0:00:49
207500 -- [-1228.579] (-1230.419) (-1231.585) (-1228.078) * (-1228.218) (-1227.337) (-1230.664) [-1229.050] -- 0:00:49
208000 -- [-1229.225] (-1229.510) (-1231.808) (-1229.050) * [-1228.272] (-1228.543) (-1232.292) (-1230.467) -- 0:00:49
208500 -- (-1227.558) (-1226.946) [-1231.607] (-1226.687) * [-1227.009] (-1228.605) (-1228.716) (-1229.444) -- 0:00:49
209000 -- (-1228.740) (-1226.846) (-1229.227) [-1227.966] * [-1230.715] (-1229.104) (-1226.925) (-1228.180) -- 0:00:49
209500 -- (-1228.594) [-1226.982] (-1231.748) (-1229.765) * (-1229.196) (-1229.552) (-1226.314) [-1228.370] -- 0:00:52
210000 -- [-1229.589] (-1229.433) (-1226.352) (-1228.455) * (-1229.196) (-1227.356) [-1229.410] (-1232.043) -- 0:00:52
Average standard deviation of split frequencies: 0.020492
210500 -- (-1226.982) (-1230.585) (-1234.893) [-1227.675] * (-1226.545) (-1227.436) [-1226.871] (-1234.409) -- 0:00:52
211000 -- (-1231.994) (-1229.240) (-1227.485) [-1227.684] * (-1226.498) (-1228.849) [-1226.839] (-1232.969) -- 0:00:52
211500 -- [-1228.146] (-1227.191) (-1226.279) (-1227.288) * (-1228.948) [-1228.864] (-1227.614) (-1232.274) -- 0:00:52
212000 -- (-1229.075) (-1228.158) (-1227.001) [-1229.165] * (-1226.924) (-1227.784) [-1227.269] (-1229.395) -- 0:00:52
212500 -- (-1227.247) [-1230.380] (-1227.701) (-1228.347) * [-1227.386] (-1227.874) (-1226.863) (-1227.620) -- 0:00:51
213000 -- (-1227.755) [-1228.784] (-1226.565) (-1228.484) * (-1228.084) [-1227.215] (-1226.400) (-1227.685) -- 0:00:51
213500 -- (-1228.486) [-1234.468] (-1226.980) (-1227.662) * [-1226.692] (-1228.133) (-1227.482) (-1229.801) -- 0:00:51
214000 -- (-1226.308) (-1233.164) (-1226.735) [-1226.901] * (-1229.660) (-1229.020) [-1226.190] (-1232.021) -- 0:00:51
214500 -- (-1226.373) [-1230.143] (-1229.105) (-1227.123) * (-1228.500) [-1232.324] (-1228.499) (-1228.737) -- 0:00:51
215000 -- [-1227.264] (-1232.087) (-1226.890) (-1226.461) * (-1228.691) (-1228.989) (-1234.347) [-1227.782] -- 0:00:51
Average standard deviation of split frequencies: 0.021480
215500 -- [-1227.911] (-1229.695) (-1228.650) (-1226.660) * (-1226.464) (-1228.434) [-1232.046] (-1228.871) -- 0:00:50
216000 -- (-1228.388) (-1228.956) (-1228.638) [-1226.400] * (-1228.325) (-1229.646) (-1230.310) [-1228.072] -- 0:00:50
216500 -- (-1229.373) [-1227.352] (-1226.773) (-1226.506) * [-1226.876] (-1227.390) (-1226.632) (-1228.788) -- 0:00:50
217000 -- (-1234.004) (-1228.556) (-1226.497) [-1226.704] * (-1227.796) (-1228.171) [-1226.647] (-1228.300) -- 0:00:50
217500 -- [-1230.801] (-1228.966) (-1227.119) (-1227.184) * (-1228.308) (-1231.212) [-1227.510] (-1228.551) -- 0:00:50
218000 -- (-1230.405) (-1229.550) [-1228.837] (-1228.014) * (-1227.130) (-1232.753) [-1226.306] (-1228.320) -- 0:00:50
218500 -- (-1228.480) (-1228.931) (-1230.437) [-1228.098] * [-1229.387] (-1227.592) (-1227.775) (-1227.999) -- 0:00:50
219000 -- (-1229.393) (-1226.386) [-1229.670] (-1228.404) * (-1229.005) [-1229.680] (-1227.916) (-1227.955) -- 0:00:49
219500 -- (-1228.131) (-1227.214) (-1229.800) [-1228.367] * [-1232.090] (-1230.298) (-1227.527) (-1230.232) -- 0:00:49
220000 -- (-1231.879) (-1227.248) (-1228.460) [-1228.474] * [-1227.618] (-1231.125) (-1228.118) (-1229.055) -- 0:00:49
Average standard deviation of split frequencies: 0.022824
220500 -- (-1228.578) (-1227.477) [-1226.924] (-1230.270) * [-1229.321] (-1232.002) (-1227.788) (-1226.806) -- 0:00:49
221000 -- (-1229.080) (-1227.561) [-1228.980] (-1228.017) * (-1227.526) [-1228.433] (-1227.594) (-1228.361) -- 0:00:49
221500 -- [-1229.244] (-1228.964) (-1230.344) (-1228.362) * (-1229.004) [-1227.769] (-1227.552) (-1227.614) -- 0:00:49
222000 -- (-1231.469) (-1229.145) [-1229.507] (-1229.871) * (-1227.874) (-1226.794) (-1226.910) [-1227.025] -- 0:00:49
222500 -- (-1229.541) [-1228.057] (-1229.423) (-1226.964) * (-1229.255) (-1229.203) [-1226.980] (-1228.100) -- 0:00:48
223000 -- (-1230.287) (-1228.274) (-1228.656) [-1228.319] * (-1228.124) (-1230.555) [-1228.101] (-1228.515) -- 0:00:48
223500 -- (-1227.151) (-1231.009) (-1230.691) [-1231.620] * (-1228.745) [-1227.143] (-1227.488) (-1226.537) -- 0:00:48
224000 -- [-1228.494] (-1229.627) (-1230.661) (-1231.884) * (-1229.261) (-1228.060) [-1226.655] (-1228.802) -- 0:00:48
224500 -- (-1228.227) [-1230.191] (-1231.155) (-1231.829) * (-1231.619) (-1227.601) [-1229.811] (-1228.029) -- 0:00:48
225000 -- [-1230.975] (-1228.274) (-1228.021) (-1229.121) * [-1231.485] (-1226.901) (-1227.173) (-1229.456) -- 0:00:48
Average standard deviation of split frequencies: 0.021484
225500 -- (-1229.003) [-1228.112] (-1229.630) (-1226.858) * (-1227.341) (-1227.333) [-1227.673] (-1229.642) -- 0:00:51
226000 -- [-1228.827] (-1230.430) (-1227.667) (-1229.280) * (-1228.835) (-1228.506) (-1228.438) [-1229.927] -- 0:00:51
226500 -- (-1226.618) [-1229.419] (-1226.588) (-1228.830) * (-1229.841) (-1229.416) (-1228.999) [-1227.918] -- 0:00:51
227000 -- [-1227.342] (-1228.112) (-1226.997) (-1227.231) * (-1228.974) (-1229.080) [-1228.401] (-1226.598) -- 0:00:51
227500 -- (-1230.059) (-1229.398) (-1232.363) [-1232.310] * (-1228.613) (-1226.852) [-1227.176] (-1230.709) -- 0:00:50
228000 -- (-1229.466) (-1227.335) [-1226.327] (-1229.655) * (-1228.118) [-1226.319] (-1231.881) (-1234.487) -- 0:00:50
228500 -- (-1228.771) (-1227.735) (-1228.522) [-1226.678] * (-1228.123) [-1226.858] (-1235.373) (-1228.290) -- 0:00:50
229000 -- (-1227.652) [-1227.349] (-1229.026) (-1230.700) * (-1228.596) (-1226.877) [-1233.153] (-1227.511) -- 0:00:50
229500 -- [-1228.049] (-1231.355) (-1232.932) (-1228.648) * (-1228.186) (-1227.231) (-1227.542) [-1226.711] -- 0:00:50
230000 -- (-1229.389) (-1229.056) (-1230.368) [-1226.460] * (-1232.599) [-1228.030] (-1228.794) (-1226.461) -- 0:00:50
Average standard deviation of split frequencies: 0.021620
230500 -- (-1232.897) (-1229.042) [-1227.408] (-1227.565) * (-1231.946) (-1227.828) (-1227.572) [-1227.443] -- 0:00:50
231000 -- (-1228.004) [-1227.853] (-1228.861) (-1230.091) * (-1231.347) (-1232.266) [-1228.910] (-1233.819) -- 0:00:49
231500 -- [-1228.686] (-1227.235) (-1227.429) (-1231.865) * (-1231.791) (-1229.668) (-1228.933) [-1233.819] -- 0:00:49
232000 -- (-1229.567) [-1228.827] (-1232.563) (-1229.181) * (-1231.177) (-1230.624) [-1229.529] (-1229.146) -- 0:00:49
232500 -- (-1230.310) (-1226.650) (-1227.722) [-1228.202] * (-1231.405) (-1229.843) (-1227.979) [-1228.081] -- 0:00:49
233000 -- (-1235.667) (-1230.205) (-1227.108) [-1231.099] * (-1230.034) (-1227.567) [-1227.430] (-1227.870) -- 0:00:49
233500 -- (-1228.840) (-1231.732) (-1227.166) [-1231.342] * [-1228.838] (-1230.033) (-1227.398) (-1232.553) -- 0:00:49
234000 -- (-1229.037) (-1229.114) (-1227.166) [-1229.897] * (-1230.016) [-1227.945] (-1228.058) (-1229.307) -- 0:00:49
234500 -- (-1228.193) (-1228.762) [-1227.077] (-1229.130) * [-1228.175] (-1227.001) (-1228.506) (-1231.684) -- 0:00:48
235000 -- [-1227.314] (-1227.913) (-1228.407) (-1227.970) * [-1230.094] (-1227.403) (-1227.424) (-1227.156) -- 0:00:48
Average standard deviation of split frequencies: 0.020080
235500 -- [-1229.558] (-1228.420) (-1230.263) (-1233.194) * (-1229.255) (-1226.755) [-1228.912] (-1227.057) -- 0:00:48
236000 -- (-1228.594) (-1228.976) [-1228.446] (-1230.330) * (-1228.913) (-1226.524) [-1226.963] (-1227.751) -- 0:00:48
236500 -- (-1226.906) [-1228.582] (-1227.017) (-1229.364) * [-1228.880] (-1229.574) (-1232.673) (-1228.722) -- 0:00:48
237000 -- (-1227.547) (-1237.184) [-1228.685] (-1229.605) * (-1227.761) (-1227.051) (-1236.787) [-1230.187] -- 0:00:48
237500 -- (-1227.690) (-1228.859) [-1227.742] (-1228.066) * (-1227.133) (-1226.871) [-1231.061] (-1228.719) -- 0:00:48
238000 -- [-1227.898] (-1232.625) (-1228.748) (-1236.463) * (-1227.218) (-1228.333) (-1228.420) [-1226.486] -- 0:00:48
238500 -- (-1227.320) (-1231.201) (-1229.613) [-1231.141] * (-1227.151) (-1226.501) (-1228.795) [-1229.143] -- 0:00:47
239000 -- (-1226.851) (-1237.360) [-1229.422] (-1229.405) * (-1227.481) (-1230.238) [-1229.303] (-1231.286) -- 0:00:47
239500 -- (-1231.466) [-1229.260] (-1229.053) (-1229.222) * [-1229.682] (-1234.626) (-1227.382) (-1228.318) -- 0:00:47
240000 -- [-1233.064] (-1228.787) (-1230.713) (-1229.197) * [-1228.952] (-1231.579) (-1226.728) (-1232.418) -- 0:00:47
Average standard deviation of split frequencies: 0.018453
240500 -- (-1229.079) (-1230.393) (-1229.181) [-1228.873] * (-1229.730) [-1229.719] (-1227.098) (-1226.922) -- 0:00:47
241000 -- [-1227.160] (-1227.080) (-1230.519) (-1227.506) * [-1230.881] (-1232.183) (-1229.765) (-1227.390) -- 0:00:47
241500 -- (-1228.305) [-1227.134] (-1226.878) (-1227.399) * (-1230.958) (-1229.998) [-1227.487] (-1231.792) -- 0:00:47
242000 -- (-1228.049) (-1226.504) (-1229.140) [-1227.602] * [-1228.122] (-1231.013) (-1227.261) (-1228.828) -- 0:00:50
242500 -- (-1227.888) [-1226.201] (-1229.802) (-1231.276) * (-1230.464) (-1227.997) (-1227.369) [-1232.538] -- 0:00:49
243000 -- (-1226.914) [-1226.950] (-1229.284) (-1228.200) * [-1227.606] (-1229.976) (-1234.962) (-1227.868) -- 0:00:49
243500 -- (-1229.682) [-1227.704] (-1228.248) (-1227.006) * [-1236.501] (-1231.144) (-1230.242) (-1229.381) -- 0:00:49
244000 -- [-1229.317] (-1227.706) (-1227.710) (-1227.276) * (-1228.630) (-1230.840) (-1231.298) [-1228.596] -- 0:00:49
244500 -- (-1229.050) (-1228.484) [-1227.471] (-1227.405) * [-1229.497] (-1229.071) (-1234.296) (-1226.683) -- 0:00:49
245000 -- (-1228.328) [-1226.708] (-1227.161) (-1229.515) * (-1227.912) [-1226.208] (-1237.336) (-1226.734) -- 0:00:49
Average standard deviation of split frequencies: 0.017549
245500 -- [-1227.437] (-1226.718) (-1228.209) (-1228.720) * (-1228.597) (-1228.164) (-1234.681) [-1226.447] -- 0:00:49
246000 -- (-1232.843) [-1227.124] (-1228.605) (-1227.536) * (-1228.761) (-1227.965) (-1229.620) [-1226.600] -- 0:00:49
246500 -- (-1226.276) (-1226.738) (-1228.045) [-1227.972] * (-1230.208) (-1231.311) (-1229.842) [-1227.289] -- 0:00:48
247000 -- [-1230.364] (-1228.130) (-1231.409) (-1228.148) * (-1228.508) [-1231.973] (-1228.995) (-1227.195) -- 0:00:48
247500 -- (-1226.995) [-1227.359] (-1227.330) (-1227.682) * (-1231.920) (-1230.764) (-1227.802) [-1229.553] -- 0:00:48
248000 -- (-1228.755) (-1226.972) [-1228.349] (-1228.280) * (-1228.057) (-1229.490) [-1227.985] (-1229.308) -- 0:00:48
248500 -- (-1232.615) (-1227.204) (-1227.135) [-1229.286] * (-1229.208) (-1229.455) (-1228.747) [-1227.769] -- 0:00:48
249000 -- (-1229.112) [-1227.996] (-1234.011) (-1227.720) * (-1227.653) (-1230.598) [-1230.755] (-1227.771) -- 0:00:48
249500 -- (-1229.690) (-1227.421) (-1230.061) [-1227.665] * [-1228.901] (-1230.642) (-1227.531) (-1227.135) -- 0:00:48
250000 -- [-1231.062] (-1227.010) (-1229.337) (-1226.848) * (-1227.105) [-1229.319] (-1226.712) (-1228.091) -- 0:00:48
Average standard deviation of split frequencies: 0.017970
250500 -- [-1229.555] (-1226.997) (-1228.263) (-1227.729) * [-1227.194] (-1228.186) (-1228.558) (-1229.746) -- 0:00:47
251000 -- (-1231.582) (-1229.544) (-1229.178) [-1227.452] * (-1227.640) [-1229.917] (-1228.233) (-1227.109) -- 0:00:47
251500 -- (-1232.258) (-1230.629) (-1231.136) [-1228.410] * (-1231.086) (-1229.488) (-1227.015) [-1227.827] -- 0:00:47
252000 -- (-1231.144) [-1227.703] (-1233.682) (-1229.215) * (-1230.302) (-1228.516) (-1230.087) [-1227.510] -- 0:00:47
252500 -- (-1227.502) [-1227.177] (-1229.779) (-1229.652) * (-1228.262) (-1227.931) [-1233.285] (-1227.516) -- 0:00:47
253000 -- [-1228.475] (-1227.176) (-1229.643) (-1231.403) * (-1229.199) (-1229.700) (-1232.496) [-1226.704] -- 0:00:47
253500 -- (-1232.137) (-1226.610) [-1230.594] (-1229.386) * (-1229.071) [-1228.869] (-1232.102) (-1227.199) -- 0:00:47
254000 -- (-1231.574) [-1227.028] (-1228.298) (-1231.917) * (-1227.341) [-1229.959] (-1230.300) (-1227.199) -- 0:00:46
254500 -- (-1231.452) (-1230.989) (-1230.446) [-1229.731] * (-1227.900) (-1229.881) [-1230.439] (-1230.546) -- 0:00:46
255000 -- (-1228.689) [-1231.078] (-1228.070) (-1229.990) * (-1231.180) (-1229.014) [-1230.537] (-1231.222) -- 0:00:46
Average standard deviation of split frequencies: 0.018306
255500 -- (-1227.824) (-1227.708) [-1227.558] (-1228.412) * [-1227.626] (-1230.849) (-1228.161) (-1227.624) -- 0:00:46
256000 -- (-1228.596) (-1229.399) [-1229.390] (-1227.588) * [-1228.289] (-1230.845) (-1228.198) (-1226.778) -- 0:00:46
256500 -- (-1228.943) (-1231.765) [-1228.965] (-1226.766) * [-1228.036] (-1228.558) (-1230.828) (-1226.713) -- 0:00:46
257000 -- [-1228.554] (-1228.393) (-1227.952) (-1227.506) * (-1229.383) (-1231.029) (-1229.732) [-1228.959] -- 0:00:46
257500 -- (-1228.757) [-1226.792] (-1229.603) (-1228.246) * (-1227.117) [-1231.479] (-1229.712) (-1226.658) -- 0:00:46
258000 -- (-1229.713) (-1227.265) (-1227.791) [-1228.798] * [-1227.044] (-1232.189) (-1227.322) (-1229.622) -- 0:00:48
258500 -- (-1228.387) (-1227.112) [-1226.841] (-1227.082) * [-1226.884] (-1230.543) (-1227.572) (-1226.854) -- 0:00:48
259000 -- (-1228.297) (-1229.851) (-1229.285) [-1227.114] * [-1226.771] (-1230.440) (-1226.538) (-1230.010) -- 0:00:48
259500 -- (-1232.953) (-1228.516) [-1228.522] (-1229.443) * [-1230.074] (-1230.042) (-1228.868) (-1230.769) -- 0:00:48
260000 -- (-1227.045) [-1228.122] (-1226.357) (-1231.073) * (-1229.440) [-1230.798] (-1230.104) (-1229.566) -- 0:00:48
Average standard deviation of split frequencies: 0.018191
260500 -- (-1226.943) (-1228.099) (-1231.470) [-1228.805] * (-1228.204) (-1234.032) [-1229.511] (-1232.401) -- 0:00:48
261000 -- [-1231.237] (-1229.485) (-1228.480) (-1228.421) * [-1226.970] (-1227.288) (-1229.435) (-1234.154) -- 0:00:48
261500 -- (-1228.111) [-1226.973] (-1227.195) (-1228.693) * [-1227.877] (-1227.289) (-1231.119) (-1233.335) -- 0:00:48
262000 -- (-1226.515) (-1226.857) (-1227.569) [-1228.053] * [-1227.212] (-1230.482) (-1227.004) (-1229.447) -- 0:00:47
262500 -- (-1226.515) (-1228.438) (-1226.289) [-1229.450] * (-1226.939) (-1228.304) (-1226.462) [-1229.061] -- 0:00:47
263000 -- [-1228.859] (-1228.438) (-1227.406) (-1229.067) * [-1227.017] (-1228.906) (-1226.502) (-1228.250) -- 0:00:47
263500 -- (-1229.062) (-1233.421) [-1226.944] (-1228.159) * (-1227.744) (-1230.556) (-1228.278) [-1228.703] -- 0:00:47
264000 -- (-1229.002) (-1232.982) [-1227.122] (-1226.984) * (-1228.726) (-1228.512) (-1228.224) [-1236.963] -- 0:00:47
264500 -- [-1229.358] (-1227.165) (-1226.843) (-1229.199) * (-1227.468) [-1227.019] (-1227.970) (-1229.940) -- 0:00:47
265000 -- (-1228.638) [-1228.136] (-1227.313) (-1233.232) * (-1226.628) (-1226.495) (-1227.972) [-1230.105] -- 0:00:47
Average standard deviation of split frequencies: 0.016230
265500 -- (-1228.991) (-1228.239) (-1229.059) [-1227.226] * (-1230.523) (-1229.445) (-1227.005) [-1227.657] -- 0:00:47
266000 -- (-1228.083) (-1227.688) [-1230.099] (-1226.251) * (-1227.452) (-1227.216) (-1227.607) [-1231.236] -- 0:00:46
266500 -- (-1227.212) (-1226.411) [-1226.916] (-1228.759) * (-1229.400) (-1227.216) [-1227.878] (-1227.187) -- 0:00:46
267000 -- (-1228.219) (-1226.345) (-1227.453) [-1229.723] * (-1228.684) [-1228.354] (-1226.655) (-1226.242) -- 0:00:46
267500 -- (-1228.785) (-1227.366) [-1227.855] (-1229.643) * (-1228.674) [-1226.784] (-1227.968) (-1226.384) -- 0:00:46
268000 -- [-1229.804] (-1228.202) (-1227.590) (-1230.353) * (-1228.492) [-1227.698] (-1232.404) (-1226.540) -- 0:00:46
268500 -- (-1229.944) [-1228.296] (-1228.652) (-1230.158) * (-1229.402) (-1229.948) [-1228.655] (-1227.514) -- 0:00:46
269000 -- [-1227.762] (-1228.055) (-1229.584) (-1229.980) * (-1228.253) (-1231.902) [-1227.284] (-1230.624) -- 0:00:46
269500 -- (-1228.587) [-1228.183] (-1230.099) (-1231.513) * (-1227.448) [-1226.658] (-1229.637) (-1236.265) -- 0:00:46
270000 -- (-1229.892) [-1226.994] (-1229.600) (-1230.442) * [-1227.971] (-1227.365) (-1229.198) (-1226.902) -- 0:00:45
Average standard deviation of split frequencies: 0.016866
270500 -- [-1229.883] (-1227.668) (-1230.288) (-1233.320) * (-1227.331) (-1228.632) (-1227.021) [-1227.164] -- 0:00:45
271000 -- (-1226.523) [-1228.566] (-1229.333) (-1228.539) * (-1227.481) [-1227.792] (-1229.363) (-1227.683) -- 0:00:45
271500 -- (-1228.072) [-1227.453] (-1227.388) (-1228.818) * (-1228.309) [-1229.619] (-1232.958) (-1228.442) -- 0:00:45
272000 -- (-1227.041) [-1228.413] (-1227.307) (-1227.934) * [-1227.134] (-1229.888) (-1229.836) (-1228.442) -- 0:00:45
272500 -- [-1228.303] (-1227.368) (-1227.581) (-1229.036) * [-1230.242] (-1226.607) (-1230.404) (-1227.497) -- 0:00:45
273000 -- (-1228.600) [-1230.568] (-1226.672) (-1229.940) * [-1229.273] (-1230.776) (-1229.024) (-1226.944) -- 0:00:45
273500 -- (-1226.441) [-1228.745] (-1226.732) (-1228.528) * [-1230.868] (-1228.707) (-1228.491) (-1226.933) -- 0:00:45
274000 -- [-1226.170] (-1232.653) (-1226.488) (-1229.990) * (-1227.654) (-1228.988) (-1228.999) [-1229.919] -- 0:00:47
274500 -- [-1226.103] (-1237.708) (-1227.077) (-1231.580) * (-1228.303) (-1229.290) (-1229.056) [-1228.567] -- 0:00:47
275000 -- (-1226.335) (-1228.363) (-1227.613) [-1229.833] * (-1232.323) (-1228.258) (-1227.001) [-1229.267] -- 0:00:47
Average standard deviation of split frequencies: 0.016451
275500 -- (-1227.112) (-1227.094) [-1230.524] (-1228.279) * (-1227.773) (-1228.339) (-1227.095) [-1227.948] -- 0:00:47
276000 -- (-1227.406) (-1228.688) [-1230.150] (-1230.731) * (-1228.891) (-1230.937) [-1227.979] (-1230.730) -- 0:00:47
276500 -- (-1227.124) [-1227.426] (-1230.186) (-1227.642) * [-1227.131] (-1228.969) (-1231.147) (-1231.079) -- 0:00:47
277000 -- (-1227.993) (-1230.145) (-1229.906) [-1228.527] * [-1227.988] (-1228.337) (-1229.515) (-1229.051) -- 0:00:46
277500 -- (-1228.530) [-1228.007] (-1227.885) (-1231.588) * (-1227.235) (-1227.482) [-1230.832] (-1232.633) -- 0:00:46
278000 -- [-1228.573] (-1226.819) (-1226.784) (-1230.926) * [-1227.045] (-1227.283) (-1231.050) (-1230.975) -- 0:00:46
278500 -- (-1226.689) (-1227.891) (-1232.399) [-1227.929] * (-1228.622) (-1227.990) [-1230.462] (-1232.329) -- 0:00:46
279000 -- [-1227.282] (-1228.203) (-1230.350) (-1229.403) * (-1231.607) (-1228.236) (-1227.102) [-1229.718] -- 0:00:46
279500 -- [-1228.737] (-1226.675) (-1229.864) (-1226.538) * (-1227.123) (-1229.404) (-1229.747) [-1228.074] -- 0:00:46
280000 -- (-1227.413) (-1226.360) (-1230.470) [-1226.439] * (-1226.944) (-1231.197) (-1227.928) [-1230.749] -- 0:00:46
Average standard deviation of split frequencies: 0.016329
280500 -- (-1226.894) [-1226.338] (-1229.623) (-1231.161) * (-1228.462) (-1230.707) [-1228.886] (-1226.171) -- 0:00:46
281000 -- [-1228.269] (-1228.742) (-1227.551) (-1234.922) * (-1232.191) (-1226.733) (-1230.864) [-1230.346] -- 0:00:46
281500 -- [-1231.536] (-1226.759) (-1229.583) (-1233.045) * (-1228.486) (-1227.530) (-1228.146) [-1229.261] -- 0:00:45
282000 -- (-1226.997) (-1229.711) [-1228.384] (-1227.705) * [-1228.950] (-1227.497) (-1229.600) (-1229.465) -- 0:00:45
282500 -- (-1229.351) [-1229.149] (-1228.776) (-1231.153) * (-1228.668) [-1227.882] (-1228.276) (-1230.599) -- 0:00:45
283000 -- [-1230.102] (-1226.460) (-1230.700) (-1228.681) * [-1230.392] (-1226.764) (-1230.452) (-1230.919) -- 0:00:45
283500 -- (-1230.648) [-1226.577] (-1228.666) (-1227.285) * (-1232.528) (-1227.928) (-1228.360) [-1226.932] -- 0:00:45
284000 -- (-1228.075) (-1227.916) [-1231.702] (-1232.799) * (-1229.061) (-1227.929) (-1228.644) [-1227.007] -- 0:00:45
284500 -- (-1230.869) (-1231.043) (-1232.122) [-1228.689] * (-1228.627) (-1227.079) (-1227.773) [-1226.668] -- 0:00:45
285000 -- (-1228.173) (-1236.663) [-1229.282] (-1230.613) * (-1229.724) (-1226.983) [-1227.184] (-1226.951) -- 0:00:45
Average standard deviation of split frequencies: 0.016025
285500 -- (-1228.481) (-1233.617) [-1231.193] (-1228.436) * (-1228.479) (-1228.143) [-1230.331] (-1231.357) -- 0:00:45
286000 -- [-1229.594] (-1232.414) (-1230.326) (-1228.380) * [-1228.152] (-1226.700) (-1228.374) (-1228.169) -- 0:00:44
286500 -- (-1227.730) (-1227.808) [-1228.457] (-1228.157) * (-1230.125) [-1231.151] (-1227.163) (-1226.689) -- 0:00:44
287000 -- [-1230.060] (-1227.661) (-1228.614) (-1227.022) * (-1227.062) [-1229.808] (-1227.193) (-1231.533) -- 0:00:44
287500 -- (-1227.571) (-1227.098) (-1230.522) [-1228.875] * (-1226.664) (-1226.919) [-1227.723] (-1229.860) -- 0:00:44
288000 -- [-1227.907] (-1227.182) (-1228.232) (-1231.780) * (-1227.567) (-1227.279) (-1227.600) [-1227.489] -- 0:00:44
288500 -- (-1228.968) (-1227.069) [-1227.583] (-1228.224) * (-1230.016) [-1227.941] (-1228.928) (-1227.714) -- 0:00:44
289000 -- (-1228.949) (-1227.662) (-1227.401) [-1228.313] * (-1228.252) (-1228.611) [-1226.780] (-1231.557) -- 0:00:44
289500 -- (-1228.327) [-1226.312] (-1227.275) (-1228.450) * (-1228.601) (-1229.560) (-1226.965) [-1227.376] -- 0:00:44
290000 -- (-1227.448) (-1226.916) [-1229.760] (-1229.640) * (-1227.201) (-1228.230) [-1226.872] (-1228.235) -- 0:00:46
Average standard deviation of split frequencies: 0.015137
290500 -- (-1227.553) (-1227.364) [-1228.497] (-1227.104) * [-1227.229] (-1229.273) (-1226.661) (-1229.072) -- 0:00:46
291000 -- (-1227.124) [-1226.300] (-1230.509) (-1228.150) * (-1228.038) (-1228.347) [-1227.681] (-1229.740) -- 0:00:46
291500 -- [-1226.609] (-1230.321) (-1226.723) (-1226.593) * (-1229.198) [-1228.761] (-1229.161) (-1227.410) -- 0:00:46
292000 -- (-1227.434) (-1228.973) (-1227.331) [-1228.513] * (-1228.059) (-1232.312) [-1229.585] (-1230.478) -- 0:00:46
292500 -- (-1227.110) [-1230.208] (-1228.951) (-1227.142) * [-1230.630] (-1231.354) (-1228.453) (-1227.958) -- 0:00:45
293000 -- (-1235.801) (-1231.226) [-1229.769] (-1228.650) * (-1226.797) (-1231.822) [-1229.816] (-1229.345) -- 0:00:45
293500 -- (-1234.525) (-1228.842) [-1229.264] (-1227.628) * (-1229.699) [-1231.971] (-1227.196) (-1233.350) -- 0:00:45
294000 -- (-1233.760) (-1228.176) (-1229.131) [-1227.279] * (-1229.090) (-1228.932) [-1226.506] (-1228.775) -- 0:00:45
294500 -- (-1233.131) [-1226.951] (-1230.374) (-1229.267) * (-1227.264) (-1229.434) (-1226.315) [-1229.585] -- 0:00:45
295000 -- [-1227.967] (-1226.310) (-1229.044) (-1227.486) * (-1232.415) [-1227.983] (-1229.246) (-1228.912) -- 0:00:45
Average standard deviation of split frequencies: 0.014156
295500 -- [-1228.055] (-1229.629) (-1229.018) (-1227.658) * (-1229.606) (-1228.868) [-1226.548] (-1229.766) -- 0:00:45
296000 -- (-1228.638) [-1230.180] (-1228.350) (-1228.888) * (-1229.474) (-1230.226) [-1226.381] (-1228.303) -- 0:00:45
296500 -- (-1232.988) (-1228.509) (-1227.743) [-1229.525] * (-1228.111) (-1234.929) [-1228.576] (-1227.590) -- 0:00:45
297000 -- [-1229.234] (-1226.681) (-1226.842) (-1230.651) * (-1227.082) (-1228.859) (-1226.964) [-1228.332] -- 0:00:44
297500 -- (-1228.087) (-1232.114) (-1227.340) [-1233.769] * [-1228.986] (-1232.159) (-1226.727) (-1231.337) -- 0:00:44
298000 -- [-1227.510] (-1227.986) (-1226.832) (-1228.800) * (-1228.907) (-1228.240) [-1230.655] (-1229.482) -- 0:00:44
298500 -- [-1228.459] (-1227.361) (-1227.051) (-1229.160) * (-1231.395) (-1227.189) [-1228.290] (-1231.274) -- 0:00:44
299000 -- (-1229.109) (-1226.665) [-1227.868] (-1230.939) * (-1235.123) (-1227.192) [-1228.128] (-1229.437) -- 0:00:44
299500 -- (-1229.856) (-1228.978) [-1227.780] (-1230.713) * (-1229.492) [-1227.514] (-1230.179) (-1229.210) -- 0:00:44
300000 -- (-1227.750) (-1230.876) [-1227.524] (-1228.946) * (-1227.449) [-1228.778] (-1229.901) (-1228.956) -- 0:00:44
Average standard deviation of split frequencies: 0.014111
300500 -- (-1227.755) [-1227.708] (-1227.080) (-1229.431) * [-1230.133] (-1227.198) (-1229.679) (-1227.230) -- 0:00:44
301000 -- (-1229.466) (-1227.741) [-1226.194] (-1229.409) * (-1226.438) (-1227.510) [-1231.123] (-1227.568) -- 0:00:44
301500 -- (-1226.499) [-1226.211] (-1226.020) (-1227.097) * (-1238.937) (-1228.377) [-1227.480] (-1227.385) -- 0:00:44
302000 -- (-1226.225) (-1227.315) (-1227.319) [-1227.205] * (-1228.130) [-1227.674] (-1228.259) (-1227.519) -- 0:00:43
302500 -- (-1226.256) (-1228.012) (-1228.459) [-1229.350] * (-1226.474) (-1227.638) [-1228.557] (-1227.232) -- 0:00:43
303000 -- [-1229.193] (-1227.988) (-1229.557) (-1230.469) * (-1228.168) [-1229.196] (-1229.334) (-1227.388) -- 0:00:43
303500 -- (-1231.957) (-1229.683) [-1229.949] (-1229.063) * [-1229.154] (-1228.913) (-1228.452) (-1227.877) -- 0:00:43
304000 -- (-1230.372) (-1229.257) [-1227.495] (-1228.511) * [-1226.115] (-1231.498) (-1226.156) (-1230.409) -- 0:00:43
304500 -- (-1230.013) (-1227.097) (-1227.762) [-1227.486] * [-1226.116] (-1231.318) (-1227.190) (-1227.914) -- 0:00:43
305000 -- (-1229.757) [-1228.064] (-1227.680) (-1227.445) * (-1228.572) (-1231.877) [-1227.640] (-1226.446) -- 0:00:43
Average standard deviation of split frequencies: 0.013297
305500 -- (-1228.030) (-1227.541) (-1228.296) [-1228.737] * [-1227.720] (-1231.731) (-1229.023) (-1226.608) -- 0:00:43
306000 -- (-1227.921) [-1227.744] (-1226.993) (-1229.457) * (-1226.854) (-1227.158) (-1230.360) [-1227.711] -- 0:00:45
306500 -- (-1229.322) [-1228.777] (-1226.570) (-1226.385) * (-1228.845) (-1227.717) (-1229.382) [-1227.672] -- 0:00:45
307000 -- [-1228.201] (-1229.940) (-1229.871) (-1229.036) * [-1226.436] (-1231.816) (-1228.010) (-1228.167) -- 0:00:45
307500 -- (-1229.074) [-1228.562] (-1228.311) (-1227.640) * (-1231.075) (-1229.905) [-1228.064] (-1230.535) -- 0:00:45
308000 -- (-1229.376) [-1227.590] (-1227.352) (-1227.657) * [-1226.581] (-1228.957) (-1226.565) (-1228.047) -- 0:00:44
308500 -- (-1228.328) (-1228.319) [-1227.978] (-1227.071) * (-1228.366) (-1227.750) (-1229.135) [-1227.110] -- 0:00:44
309000 -- (-1228.716) (-1230.833) [-1227.968] (-1228.359) * (-1229.021) [-1229.650] (-1229.734) (-1227.391) -- 0:00:44
309500 -- (-1227.909) [-1228.326] (-1227.332) (-1231.236) * [-1231.139] (-1227.765) (-1227.821) (-1227.026) -- 0:00:44
310000 -- [-1227.104] (-1228.491) (-1227.919) (-1233.778) * (-1232.415) (-1227.522) (-1228.112) [-1227.935] -- 0:00:44
Average standard deviation of split frequencies: 0.012898
310500 -- (-1226.935) [-1229.729] (-1229.268) (-1229.125) * (-1230.553) (-1227.859) [-1230.356] (-1227.794) -- 0:00:44
311000 -- (-1226.926) (-1228.310) [-1227.698] (-1227.643) * (-1229.738) [-1226.959] (-1227.436) (-1226.910) -- 0:00:44
311500 -- (-1227.412) (-1230.097) (-1228.713) [-1227.922] * (-1229.254) (-1228.386) [-1229.993] (-1228.567) -- 0:00:44
312000 -- (-1226.537) (-1229.073) (-1229.050) [-1227.902] * (-1228.599) (-1227.891) [-1230.422] (-1228.275) -- 0:00:44
312500 -- (-1228.629) [-1228.649] (-1233.658) (-1228.515) * (-1228.645) (-1232.523) [-1230.395] (-1227.374) -- 0:00:44
313000 -- (-1230.104) [-1227.627] (-1233.105) (-1227.876) * (-1227.460) (-1228.500) (-1228.711) [-1228.376] -- 0:00:43
313500 -- (-1227.052) (-1229.507) [-1230.199] (-1230.476) * (-1227.457) (-1228.582) (-1230.342) [-1228.371] -- 0:00:43
314000 -- (-1228.907) (-1233.431) [-1231.795] (-1228.277) * (-1227.594) [-1227.750] (-1231.106) (-1227.080) -- 0:00:43
314500 -- (-1228.322) (-1234.222) (-1230.838) [-1228.371] * [-1226.627] (-1231.845) (-1229.598) (-1228.053) -- 0:00:43
315000 -- (-1228.949) (-1228.571) [-1231.028] (-1226.657) * [-1233.697] (-1228.100) (-1227.895) (-1228.448) -- 0:00:43
Average standard deviation of split frequencies: 0.013095
315500 -- (-1229.812) [-1230.110] (-1230.378) (-1229.234) * (-1231.347) [-1227.675] (-1227.003) (-1229.966) -- 0:00:43
316000 -- [-1228.184] (-1227.464) (-1228.686) (-1230.963) * (-1229.349) [-1227.069] (-1227.003) (-1230.699) -- 0:00:43
316500 -- (-1230.647) [-1228.047] (-1227.622) (-1227.949) * (-1226.956) [-1226.873] (-1227.788) (-1230.216) -- 0:00:43
317000 -- (-1232.847) (-1227.996) [-1226.475] (-1229.226) * (-1228.919) (-1226.594) (-1227.689) [-1233.056] -- 0:00:43
317500 -- (-1227.860) [-1226.791] (-1227.858) (-1230.146) * (-1228.725) [-1226.596] (-1226.936) (-1228.869) -- 0:00:42
318000 -- (-1232.073) [-1227.010] (-1230.427) (-1227.583) * [-1226.513] (-1228.967) (-1230.048) (-1229.036) -- 0:00:42
318500 -- [-1228.035] (-1230.179) (-1228.837) (-1228.286) * [-1229.653] (-1233.612) (-1228.178) (-1227.530) -- 0:00:42
319000 -- (-1227.567) (-1230.198) [-1229.305] (-1226.623) * (-1232.665) (-1227.409) [-1226.339] (-1228.988) -- 0:00:42
319500 -- (-1227.317) (-1228.099) [-1231.722] (-1231.185) * (-1227.365) (-1228.428) (-1227.240) [-1229.188] -- 0:00:42
320000 -- [-1227.101] (-1228.414) (-1229.313) (-1230.665) * [-1226.963] (-1226.511) (-1228.129) (-1227.008) -- 0:00:42
Average standard deviation of split frequencies: 0.013394
320500 -- (-1226.803) [-1226.837] (-1228.874) (-1229.147) * (-1231.429) [-1227.841] (-1229.123) (-1226.485) -- 0:00:42
321000 -- (-1226.726) (-1227.140) (-1228.741) [-1226.873] * [-1228.721] (-1229.200) (-1227.128) (-1229.423) -- 0:00:42
321500 -- (-1227.828) [-1227.997] (-1228.712) (-1230.330) * (-1230.107) [-1229.396] (-1227.975) (-1230.846) -- 0:00:42
322000 -- (-1228.333) (-1230.378) (-1226.197) [-1227.570] * (-1229.539) (-1233.073) [-1227.524] (-1231.333) -- 0:00:44
322500 -- (-1229.463) (-1228.045) (-1230.481) [-1229.443] * (-1228.753) (-1228.823) (-1227.795) [-1227.065] -- 0:00:44
323000 -- (-1230.654) [-1230.178] (-1233.271) (-1227.880) * (-1227.401) (-1229.362) (-1229.273) [-1227.777] -- 0:00:44
323500 -- [-1228.584] (-1231.164) (-1226.506) (-1229.717) * [-1229.279] (-1231.431) (-1227.972) (-1228.365) -- 0:00:43
324000 -- (-1228.565) (-1229.626) [-1228.324] (-1228.994) * (-1228.219) [-1228.719] (-1228.497) (-1227.378) -- 0:00:43
324500 -- (-1228.396) [-1228.943] (-1230.148) (-1232.486) * (-1227.201) [-1230.045] (-1228.329) (-1227.484) -- 0:00:43
325000 -- (-1228.405) (-1228.374) (-1226.814) [-1229.639] * (-1231.524) (-1228.221) (-1233.489) [-1229.283] -- 0:00:43
Average standard deviation of split frequencies: 0.012710
325500 -- [-1229.280] (-1228.479) (-1227.848) (-1230.349) * [-1230.390] (-1228.834) (-1227.867) (-1229.431) -- 0:00:43
326000 -- (-1228.254) (-1228.486) [-1229.053] (-1228.055) * (-1228.681) [-1227.632] (-1227.158) (-1231.538) -- 0:00:43
326500 -- (-1229.825) [-1230.644] (-1227.910) (-1228.718) * (-1231.511) (-1228.595) (-1226.635) [-1231.194] -- 0:00:43
327000 -- (-1232.501) (-1228.215) [-1226.910] (-1229.628) * (-1232.109) (-1229.999) (-1228.446) [-1229.742] -- 0:00:43
327500 -- (-1226.934) [-1227.758] (-1229.123) (-1228.686) * [-1227.626] (-1228.126) (-1228.637) (-1227.801) -- 0:00:43
328000 -- (-1229.778) (-1227.644) [-1226.767] (-1230.216) * (-1229.295) (-1227.511) [-1228.080] (-1227.694) -- 0:00:43
328500 -- (-1230.042) [-1228.163] (-1229.297) (-1229.837) * (-1227.828) [-1226.987] (-1228.181) (-1229.390) -- 0:00:42
329000 -- (-1230.167) [-1229.102] (-1228.592) (-1230.094) * [-1227.355] (-1226.757) (-1226.883) (-1227.829) -- 0:00:42
329500 -- (-1227.923) (-1228.561) [-1229.102] (-1228.795) * (-1229.126) [-1229.063] (-1228.352) (-1228.679) -- 0:00:42
330000 -- [-1229.439] (-1227.099) (-1229.069) (-1230.083) * (-1228.280) (-1230.399) (-1231.390) [-1227.389] -- 0:00:42
Average standard deviation of split frequencies: 0.012579
330500 -- (-1228.267) (-1228.179) (-1228.390) [-1228.025] * [-1228.443] (-1230.679) (-1229.766) (-1226.752) -- 0:00:42
331000 -- (-1229.931) (-1229.533) (-1227.177) [-1227.529] * [-1230.253] (-1233.299) (-1231.800) (-1226.701) -- 0:00:42
331500 -- (-1228.019) [-1230.130] (-1228.636) (-1228.784) * [-1226.251] (-1228.975) (-1228.668) (-1226.610) -- 0:00:42
332000 -- (-1232.640) [-1229.010] (-1232.406) (-1230.200) * [-1226.165] (-1228.511) (-1233.284) (-1227.900) -- 0:00:42
332500 -- (-1231.062) (-1226.460) (-1232.080) [-1231.134] * (-1226.927) (-1228.767) (-1227.614) [-1226.981] -- 0:00:42
333000 -- [-1231.061] (-1230.019) (-1227.952) (-1230.346) * [-1230.035] (-1230.674) (-1228.108) (-1229.683) -- 0:00:42
333500 -- (-1231.656) [-1231.018] (-1227.802) (-1231.027) * (-1228.000) (-1228.641) [-1229.197] (-1230.264) -- 0:00:41
334000 -- (-1231.100) (-1234.778) [-1226.853] (-1228.100) * (-1228.392) [-1228.362] (-1227.320) (-1227.409) -- 0:00:41
334500 -- (-1230.052) [-1228.400] (-1227.181) (-1227.916) * (-1228.490) (-1229.317) [-1228.522] (-1228.073) -- 0:00:41
335000 -- [-1229.279] (-1227.740) (-1229.260) (-1227.496) * (-1227.657) (-1227.442) [-1227.559] (-1227.558) -- 0:00:41
Average standard deviation of split frequencies: 0.012132
335500 -- (-1228.274) (-1226.803) [-1230.925] (-1228.595) * [-1227.253] (-1228.068) (-1228.486) (-1229.375) -- 0:00:41
336000 -- (-1227.539) (-1232.719) (-1230.527) [-1227.334] * (-1229.328) [-1229.251] (-1232.578) (-1232.870) -- 0:00:41
336500 -- (-1229.861) (-1226.681) [-1229.044] (-1229.332) * (-1230.036) (-1229.241) (-1234.119) [-1229.619] -- 0:00:41
337000 -- (-1230.459) [-1227.040] (-1228.849) (-1228.533) * (-1230.054) (-1228.656) (-1226.764) [-1228.144] -- 0:00:41
337500 -- (-1231.627) [-1228.138] (-1227.465) (-1229.098) * [-1228.394] (-1228.676) (-1226.825) (-1229.039) -- 0:00:43
338000 -- (-1229.934) [-1228.840] (-1227.243) (-1227.920) * [-1228.130] (-1228.056) (-1230.920) (-1229.127) -- 0:00:43
338500 -- (-1229.338) (-1229.051) [-1226.333] (-1228.914) * (-1229.242) (-1228.324) (-1229.731) [-1229.982] -- 0:00:42
339000 -- (-1227.150) (-1227.790) (-1227.224) [-1227.912] * [-1228.929] (-1226.894) (-1229.582) (-1226.825) -- 0:00:42
339500 -- (-1228.430) (-1229.702) [-1230.699] (-1228.476) * (-1228.122) (-1228.034) [-1229.487] (-1227.734) -- 0:00:42
340000 -- [-1226.698] (-1229.509) (-1229.330) (-1232.493) * [-1227.061] (-1226.309) (-1228.350) (-1228.333) -- 0:00:42
Average standard deviation of split frequencies: 0.012617
340500 -- (-1227.018) (-1227.990) [-1226.689] (-1230.577) * (-1226.452) (-1227.858) [-1230.629] (-1226.536) -- 0:00:42
341000 -- (-1229.053) (-1227.414) (-1226.615) [-1229.210] * (-1227.704) (-1228.649) [-1230.200] (-1227.469) -- 0:00:42
341500 -- (-1226.863) (-1228.228) (-1226.794) [-1228.735] * (-1228.454) (-1229.464) (-1230.090) [-1229.098] -- 0:00:42
342000 -- (-1231.447) (-1231.384) (-1228.500) [-1227.961] * (-1230.468) (-1228.224) [-1231.487] (-1234.749) -- 0:00:42
342500 -- (-1227.997) (-1229.746) [-1227.395] (-1229.269) * (-1228.098) [-1228.844] (-1230.746) (-1230.933) -- 0:00:42
343000 -- (-1227.571) (-1227.798) (-1227.594) [-1226.681] * [-1227.070] (-1228.073) (-1228.487) (-1229.962) -- 0:00:42
343500 -- [-1230.416] (-1232.123) (-1227.082) (-1227.568) * (-1228.164) [-1227.700] (-1227.840) (-1228.796) -- 0:00:42
344000 -- (-1230.001) (-1231.533) (-1227.661) [-1226.547] * (-1231.256) (-1229.332) [-1227.784] (-1231.989) -- 0:00:41
344500 -- (-1229.676) (-1231.785) (-1227.873) [-1226.574] * (-1229.864) [-1228.921] (-1231.276) (-1226.673) -- 0:00:41
345000 -- [-1226.708] (-1228.356) (-1227.713) (-1226.734) * (-1232.315) [-1227.246] (-1233.965) (-1233.959) -- 0:00:41
Average standard deviation of split frequencies: 0.011975
345500 -- (-1229.253) [-1229.777] (-1227.449) (-1228.092) * (-1232.822) [-1228.071] (-1228.975) (-1228.959) -- 0:00:41
346000 -- (-1227.575) (-1226.418) [-1227.147] (-1227.006) * (-1228.426) (-1227.480) [-1229.202] (-1230.284) -- 0:00:41
346500 -- (-1228.455) (-1228.827) [-1228.417] (-1228.043) * (-1229.169) (-1227.044) (-1228.653) [-1232.056] -- 0:00:41
347000 -- (-1228.626) (-1232.347) (-1228.430) [-1228.232] * (-1236.901) (-1231.246) [-1231.384] (-1231.891) -- 0:00:41
347500 -- (-1226.738) (-1228.704) (-1227.060) [-1227.848] * (-1231.430) [-1229.539] (-1227.712) (-1233.029) -- 0:00:41
348000 -- (-1226.549) [-1228.061] (-1227.287) (-1228.482) * (-1232.316) (-1229.701) (-1227.503) [-1231.175] -- 0:00:41
348500 -- [-1228.754] (-1226.361) (-1229.088) (-1230.243) * [-1227.830] (-1228.905) (-1227.665) (-1228.309) -- 0:00:41
349000 -- (-1227.404) [-1226.367] (-1228.785) (-1227.320) * (-1227.929) [-1228.898] (-1228.515) (-1231.809) -- 0:00:41
349500 -- (-1227.112) (-1226.938) [-1233.176] (-1231.368) * (-1228.452) [-1228.613] (-1231.227) (-1227.589) -- 0:00:40
350000 -- (-1227.101) (-1230.959) [-1232.701] (-1228.683) * (-1227.017) (-1227.955) (-1233.192) [-1227.005] -- 0:00:40
Average standard deviation of split frequencies: 0.010967
350500 -- [-1228.676] (-1228.081) (-1228.553) (-1228.128) * (-1227.788) (-1228.615) (-1230.707) [-1228.013] -- 0:00:40
351000 -- [-1227.125] (-1226.586) (-1229.867) (-1227.933) * (-1229.229) (-1230.521) (-1228.601) [-1227.181] -- 0:00:40
351500 -- [-1227.081] (-1226.884) (-1231.142) (-1228.767) * (-1227.100) (-1231.557) (-1232.826) [-1230.694] -- 0:00:40
352000 -- (-1226.896) (-1226.948) [-1227.966] (-1226.556) * [-1226.628] (-1235.068) (-1229.988) (-1229.655) -- 0:00:40
352500 -- (-1227.218) (-1228.498) [-1228.321] (-1226.704) * (-1227.078) (-1234.428) [-1229.240] (-1229.647) -- 0:00:40
353000 -- (-1229.605) (-1232.214) (-1230.084) [-1226.463] * (-1228.619) [-1227.814] (-1229.489) (-1227.222) -- 0:00:42
353500 -- (-1233.048) (-1231.750) (-1230.535) [-1227.850] * (-1227.217) (-1227.635) (-1233.057) [-1226.598] -- 0:00:42
354000 -- (-1230.094) (-1232.209) [-1226.146] (-1227.692) * (-1231.954) [-1228.039] (-1230.834) (-1227.009) -- 0:00:41
354500 -- (-1233.760) (-1228.642) [-1227.236] (-1227.246) * (-1228.680) [-1226.977] (-1229.694) (-1228.326) -- 0:00:41
355000 -- [-1228.113] (-1227.333) (-1229.222) (-1228.141) * (-1228.709) (-1227.675) (-1226.885) [-1227.994] -- 0:00:41
Average standard deviation of split frequencies: 0.010888
355500 -- [-1228.395] (-1228.253) (-1228.384) (-1227.754) * (-1229.017) [-1226.822] (-1227.475) (-1228.834) -- 0:00:41
356000 -- [-1229.582] (-1231.169) (-1228.081) (-1227.499) * (-1230.930) (-1227.853) [-1231.203] (-1227.939) -- 0:00:41
356500 -- [-1228.446] (-1229.454) (-1226.193) (-1231.578) * (-1229.080) [-1227.798] (-1231.992) (-1229.217) -- 0:00:41
357000 -- (-1227.027) (-1227.537) [-1227.458] (-1233.353) * (-1229.433) (-1229.176) [-1230.290] (-1227.342) -- 0:00:41
357500 -- [-1228.907] (-1227.364) (-1228.399) (-1229.710) * (-1228.267) (-1228.209) (-1230.864) [-1228.167] -- 0:00:41
358000 -- (-1227.700) (-1228.270) [-1230.206] (-1228.081) * (-1227.403) [-1228.569] (-1229.486) (-1228.034) -- 0:00:41
358500 -- (-1226.587) (-1227.078) [-1226.587] (-1228.072) * (-1228.630) (-1229.097) [-1229.332] (-1227.547) -- 0:00:41
359000 -- (-1230.843) (-1226.723) [-1227.670] (-1228.490) * [-1229.149] (-1230.190) (-1230.132) (-1228.862) -- 0:00:41
359500 -- [-1228.557] (-1229.867) (-1226.647) (-1227.449) * (-1232.797) [-1228.820] (-1226.886) (-1233.131) -- 0:00:40
360000 -- (-1229.012) [-1229.104] (-1226.690) (-1228.701) * (-1228.299) [-1226.500] (-1231.971) (-1230.402) -- 0:00:40
Average standard deviation of split frequencies: 0.010764
360500 -- (-1228.234) [-1228.611] (-1232.005) (-1228.086) * [-1228.947] (-1226.494) (-1228.579) (-1228.894) -- 0:00:40
361000 -- [-1227.579] (-1227.624) (-1227.631) (-1228.491) * (-1229.367) [-1226.980] (-1227.858) (-1226.570) -- 0:00:40
361500 -- (-1229.864) (-1227.463) (-1226.972) [-1227.541] * (-1230.663) [-1227.346] (-1231.667) (-1226.538) -- 0:00:40
362000 -- (-1231.091) [-1227.751] (-1227.242) (-1228.057) * (-1232.704) [-1227.871] (-1228.063) (-1229.141) -- 0:00:40
362500 -- (-1230.499) (-1231.450) (-1227.373) [-1227.880] * (-1231.974) (-1227.491) [-1228.524] (-1233.109) -- 0:00:40
363000 -- (-1231.213) (-1226.706) (-1227.332) [-1228.423] * (-1231.612) (-1229.662) [-1226.924] (-1229.551) -- 0:00:40
363500 -- (-1229.800) (-1229.925) [-1229.312] (-1228.137) * (-1227.202) (-1230.039) [-1227.518] (-1228.284) -- 0:00:40
364000 -- (-1233.240) (-1228.519) [-1226.594] (-1229.289) * (-1230.712) (-1232.453) (-1226.857) [-1227.649] -- 0:00:40
364500 -- (-1231.104) (-1228.693) (-1226.656) [-1228.051] * (-1230.294) [-1232.165] (-1229.325) (-1228.101) -- 0:00:40
365000 -- (-1228.947) [-1229.241] (-1226.725) (-1228.099) * [-1227.518] (-1231.317) (-1228.797) (-1230.625) -- 0:00:40
Average standard deviation of split frequencies: 0.011727
365500 -- (-1227.911) [-1227.183] (-1227.385) (-1227.946) * [-1227.312] (-1229.062) (-1228.726) (-1228.517) -- 0:00:39
366000 -- (-1227.749) (-1229.238) (-1229.899) [-1228.070] * (-1227.319) [-1229.166] (-1230.323) (-1227.381) -- 0:00:39
366500 -- (-1229.561) [-1226.527] (-1227.573) (-1229.442) * [-1230.041] (-1229.069) (-1227.421) (-1229.792) -- 0:00:39
367000 -- (-1231.436) (-1228.212) (-1228.506) [-1232.960] * (-1227.855) (-1229.990) (-1226.253) [-1226.826] -- 0:00:39
367500 -- (-1229.372) [-1229.825] (-1228.659) (-1229.484) * (-1227.437) (-1228.905) [-1226.125] (-1227.778) -- 0:00:39
368000 -- (-1229.765) (-1228.212) [-1229.650] (-1234.085) * (-1227.555) [-1228.170] (-1227.929) (-1227.224) -- 0:00:39
368500 -- [-1229.149] (-1227.836) (-1230.647) (-1227.242) * (-1228.275) (-1230.043) (-1228.742) [-1227.391] -- 0:00:41
369000 -- (-1229.242) (-1227.684) [-1227.290] (-1229.547) * (-1228.503) (-1228.026) (-1230.391) [-1226.748] -- 0:00:41
369500 -- [-1228.368] (-1227.051) (-1230.016) (-1227.004) * (-1230.031) [-1228.381] (-1229.507) (-1227.040) -- 0:00:40
370000 -- [-1226.622] (-1228.073) (-1227.781) (-1227.278) * (-1229.091) [-1228.961] (-1231.032) (-1226.755) -- 0:00:40
Average standard deviation of split frequencies: 0.011870
370500 -- (-1226.638) [-1226.902] (-1228.818) (-1227.468) * (-1229.032) [-1229.422] (-1227.900) (-1229.226) -- 0:00:40
371000 -- (-1226.686) (-1229.223) [-1228.701] (-1226.864) * (-1227.405) (-1228.273) (-1228.551) [-1227.676] -- 0:00:40
371500 -- (-1226.227) (-1229.442) (-1229.174) [-1227.383] * [-1227.505] (-1228.544) (-1227.273) (-1228.182) -- 0:00:40
372000 -- (-1227.450) (-1228.871) (-1229.119) [-1227.326] * (-1226.612) [-1228.073] (-1227.535) (-1231.450) -- 0:00:40
372500 -- [-1227.034] (-1230.804) (-1230.593) (-1227.044) * (-1228.333) (-1231.395) (-1228.402) [-1227.967] -- 0:00:40
373000 -- (-1231.206) (-1227.123) (-1231.571) [-1226.975] * [-1228.312] (-1227.392) (-1232.797) (-1227.652) -- 0:00:40
373500 -- [-1231.040] (-1227.806) (-1233.985) (-1227.619) * [-1228.331] (-1231.608) (-1228.698) (-1227.776) -- 0:00:40
374000 -- (-1227.413) [-1227.581] (-1236.558) (-1229.247) * (-1229.949) (-1228.330) (-1228.056) [-1227.926] -- 0:00:40
374500 -- [-1226.936] (-1227.311) (-1236.875) (-1227.718) * [-1231.486] (-1230.684) (-1226.665) (-1228.781) -- 0:00:40
375000 -- (-1228.182) (-1228.935) (-1228.703) [-1229.102] * [-1232.442] (-1226.793) (-1227.947) (-1227.534) -- 0:00:40
Average standard deviation of split frequencies: 0.011284
375500 -- (-1228.407) (-1231.188) [-1226.291] (-1228.204) * (-1229.264) (-1230.203) (-1228.622) [-1228.073] -- 0:00:39
376000 -- (-1227.881) (-1228.179) (-1226.237) [-1227.343] * (-1229.346) (-1227.626) [-1228.242] (-1227.551) -- 0:00:39
376500 -- [-1227.256] (-1230.108) (-1226.155) (-1229.018) * (-1229.678) (-1230.314) [-1231.485] (-1226.533) -- 0:00:39
377000 -- (-1229.601) (-1228.109) (-1230.347) [-1229.504] * (-1229.504) (-1226.979) (-1227.418) [-1227.333] -- 0:00:39
377500 -- (-1229.006) [-1229.215] (-1226.513) (-1227.828) * (-1229.442) (-1230.172) (-1227.964) [-1228.227] -- 0:00:39
378000 -- (-1226.746) [-1228.365] (-1228.503) (-1226.656) * (-1228.636) (-1230.607) (-1229.184) [-1228.968] -- 0:00:39
378500 -- [-1226.692] (-1228.373) (-1228.950) (-1228.339) * (-1228.261) [-1228.756] (-1232.006) (-1228.963) -- 0:00:39
379000 -- (-1228.132) (-1228.571) [-1227.185] (-1228.126) * [-1229.947] (-1228.319) (-1231.395) (-1232.204) -- 0:00:39
379500 -- (-1227.964) (-1229.531) (-1229.882) [-1227.968] * [-1227.952] (-1227.930) (-1229.075) (-1228.449) -- 0:00:39
380000 -- (-1230.805) [-1227.873] (-1227.239) (-1230.256) * (-1229.497) (-1227.687) [-1233.869] (-1227.270) -- 0:00:39
Average standard deviation of split frequencies: 0.010927
380500 -- (-1230.873) (-1227.845) [-1228.123] (-1232.203) * (-1228.042) (-1228.596) [-1228.078] (-1226.866) -- 0:00:39
381000 -- (-1228.719) [-1229.160] (-1230.186) (-1228.893) * (-1228.199) (-1227.224) [-1227.783] (-1229.064) -- 0:00:38
381500 -- (-1228.530) (-1229.122) (-1228.960) [-1227.555] * (-1227.465) (-1230.305) (-1229.931) [-1228.430] -- 0:00:38
382000 -- (-1227.867) [-1227.155] (-1229.903) (-1227.555) * [-1228.252] (-1227.750) (-1228.023) (-1227.877) -- 0:00:38
382500 -- (-1227.013) [-1226.873] (-1231.910) (-1227.220) * (-1229.597) [-1228.424] (-1227.934) (-1234.281) -- 0:00:38
383000 -- (-1226.530) (-1227.458) (-1229.857) [-1227.871] * (-1231.457) [-1229.472] (-1229.364) (-1234.538) -- 0:00:38
383500 -- (-1227.258) [-1228.251] (-1229.098) (-1227.913) * (-1231.083) [-1227.914] (-1228.205) (-1231.763) -- 0:00:38
384000 -- (-1231.119) [-1227.893] (-1230.622) (-1230.376) * (-1228.669) (-1226.539) (-1226.809) [-1227.841] -- 0:00:40
384500 -- (-1227.599) (-1227.888) [-1227.860] (-1227.182) * [-1227.474] (-1229.746) (-1229.205) (-1229.983) -- 0:00:40
385000 -- (-1228.040) (-1227.631) (-1227.478) [-1228.456] * (-1231.743) [-1228.650] (-1229.383) (-1228.900) -- 0:00:39
Average standard deviation of split frequencies: 0.010856
385500 -- (-1227.909) (-1228.855) (-1227.853) [-1228.444] * (-1229.011) [-1233.569] (-1230.593) (-1229.124) -- 0:00:39
386000 -- (-1229.375) (-1228.513) (-1228.154) [-1230.955] * (-1228.913) (-1231.526) [-1231.071] (-1227.429) -- 0:00:39
386500 -- (-1234.120) (-1233.928) (-1229.411) [-1228.537] * [-1229.943] (-1230.714) (-1228.689) (-1227.352) -- 0:00:39
387000 -- (-1231.657) (-1228.013) [-1230.193] (-1227.685) * [-1231.818] (-1232.634) (-1230.475) (-1228.858) -- 0:00:39
387500 -- (-1230.656) (-1231.234) [-1230.040] (-1227.202) * (-1233.931) (-1230.106) (-1229.834) [-1228.815] -- 0:00:39
388000 -- (-1228.398) (-1230.883) [-1227.568] (-1226.687) * (-1229.051) (-1230.700) [-1229.776] (-1232.128) -- 0:00:39
388500 -- (-1228.445) (-1227.786) (-1233.149) [-1226.384] * (-1228.435) (-1229.369) (-1228.885) [-1233.555] -- 0:00:39
389000 -- (-1228.813) [-1232.524] (-1228.042) (-1227.809) * (-1227.318) (-1230.758) [-1227.715] (-1233.576) -- 0:00:39
389500 -- (-1228.459) (-1230.447) (-1229.623) [-1233.253] * [-1226.497] (-1228.362) (-1227.822) (-1231.416) -- 0:00:39
390000 -- (-1228.479) (-1230.470) [-1228.359] (-1229.809) * (-1227.528) (-1229.676) (-1228.216) [-1228.552] -- 0:00:39
Average standard deviation of split frequencies: 0.011940
390500 -- (-1229.150) (-1230.324) [-1229.361] (-1228.182) * (-1227.204) (-1230.455) [-1228.466] (-1229.734) -- 0:00:39
391000 -- (-1227.321) (-1233.700) (-1227.324) [-1228.058] * (-1229.138) [-1230.900] (-1228.585) (-1227.868) -- 0:00:38
391500 -- [-1227.795] (-1230.100) (-1228.818) (-1231.536) * [-1228.369] (-1230.668) (-1229.172) (-1229.510) -- 0:00:38
392000 -- (-1226.662) [-1228.829] (-1226.286) (-1229.428) * [-1227.291] (-1236.265) (-1229.173) (-1227.970) -- 0:00:38
392500 -- (-1228.487) [-1227.144] (-1227.818) (-1230.391) * (-1227.148) (-1228.588) (-1228.904) [-1226.220] -- 0:00:38
393000 -- (-1228.040) [-1227.567] (-1226.914) (-1229.950) * (-1229.409) [-1227.988] (-1228.607) (-1227.480) -- 0:00:38
393500 -- (-1231.989) [-1228.660] (-1228.105) (-1227.242) * (-1230.180) (-1229.112) [-1228.059] (-1228.785) -- 0:00:38
394000 -- (-1233.642) [-1227.990] (-1228.096) (-1227.614) * (-1227.707) (-1226.935) (-1227.635) [-1229.085] -- 0:00:38
394500 -- [-1228.187] (-1227.359) (-1230.037) (-1229.225) * [-1227.914] (-1227.293) (-1228.245) (-1226.575) -- 0:00:38
395000 -- [-1227.148] (-1229.001) (-1226.731) (-1228.272) * (-1226.975) [-1227.133] (-1227.607) (-1228.519) -- 0:00:38
Average standard deviation of split frequencies: 0.011654
395500 -- [-1226.875] (-1228.026) (-1226.755) (-1230.333) * [-1228.918] (-1226.684) (-1229.969) (-1228.087) -- 0:00:38
396000 -- (-1226.552) (-1229.679) (-1227.935) [-1227.689] * (-1228.537) (-1228.833) (-1228.589) [-1233.516] -- 0:00:38
396500 -- (-1226.662) (-1231.120) (-1228.465) [-1228.122] * (-1230.711) (-1228.578) [-1229.487] (-1231.693) -- 0:00:38
397000 -- (-1229.899) (-1231.518) (-1233.369) [-1227.907] * (-1228.884) [-1231.856] (-1227.657) (-1230.140) -- 0:00:37
397500 -- (-1227.480) (-1232.539) (-1234.472) [-1227.148] * (-1226.781) (-1227.773) (-1227.538) [-1229.582] -- 0:00:37
398000 -- (-1226.485) (-1235.108) (-1227.670) [-1227.424] * (-1226.407) (-1226.336) [-1227.254] (-1227.283) -- 0:00:37
398500 -- [-1226.491] (-1232.788) (-1228.343) (-1230.302) * [-1229.985] (-1229.215) (-1227.263) (-1227.225) -- 0:00:37
399000 -- [-1226.875] (-1232.271) (-1227.889) (-1233.228) * [-1228.033] (-1227.773) (-1228.276) (-1228.412) -- 0:00:37
399500 -- (-1232.085) (-1227.291) (-1227.581) [-1230.368] * (-1228.106) (-1232.410) (-1228.084) [-1228.731] -- 0:00:37
400000 -- (-1232.873) (-1228.687) [-1230.896] (-1230.112) * (-1228.470) (-1229.647) [-1230.106] (-1230.184) -- 0:00:39
Average standard deviation of split frequencies: 0.012137
400500 -- (-1228.873) (-1227.909) (-1231.567) [-1226.414] * [-1235.676] (-1229.388) (-1231.888) (-1230.134) -- 0:00:38
401000 -- (-1234.069) [-1226.800] (-1230.356) (-1227.587) * (-1230.582) [-1227.258] (-1229.734) (-1229.508) -- 0:00:38
401500 -- (-1231.699) [-1226.068] (-1231.348) (-1226.479) * (-1229.077) (-1227.647) (-1230.167) [-1229.487] -- 0:00:38
402000 -- (-1234.598) (-1226.238) [-1230.396] (-1226.534) * (-1227.245) [-1226.573] (-1235.212) (-1228.611) -- 0:00:38
402500 -- (-1229.947) [-1226.237] (-1237.131) (-1229.719) * (-1228.907) [-1226.544] (-1230.038) (-1227.303) -- 0:00:38
403000 -- (-1229.330) (-1227.283) (-1228.531) [-1227.594] * (-1226.891) (-1228.816) (-1229.736) [-1226.450] -- 0:00:38
403500 -- [-1231.382] (-1227.220) (-1227.697) (-1229.004) * (-1227.610) (-1229.055) [-1228.187] (-1228.240) -- 0:00:38
404000 -- [-1228.094] (-1227.466) (-1228.277) (-1230.139) * (-1227.202) [-1227.113] (-1227.662) (-1227.081) -- 0:00:38
404500 -- (-1229.405) (-1227.420) (-1233.247) [-1229.950] * (-1230.036) (-1226.571) [-1227.270] (-1229.030) -- 0:00:38
405000 -- (-1230.178) (-1227.222) (-1232.579) [-1230.362] * (-1228.453) [-1226.612] (-1233.919) (-1233.196) -- 0:00:38
Average standard deviation of split frequencies: 0.012405
405500 -- [-1226.797] (-1226.806) (-1230.490) (-1229.936) * (-1228.516) (-1226.670) [-1228.931] (-1230.142) -- 0:00:38
406000 -- (-1227.466) (-1231.731) (-1227.962) [-1229.718] * (-1228.719) (-1231.219) [-1228.860] (-1227.179) -- 0:00:38
406500 -- (-1227.466) [-1229.966] (-1229.668) (-1233.187) * [-1233.684] (-1226.850) (-1232.585) (-1228.116) -- 0:00:37
407000 -- [-1228.107] (-1231.712) (-1228.813) (-1230.465) * [-1234.297] (-1228.683) (-1229.071) (-1228.197) -- 0:00:37
407500 -- [-1229.177] (-1231.243) (-1229.347) (-1228.524) * (-1227.749) (-1226.772) (-1228.820) [-1227.521] -- 0:00:37
408000 -- (-1229.149) [-1227.032] (-1228.857) (-1227.746) * [-1227.214] (-1226.779) (-1227.075) (-1229.105) -- 0:00:37
408500 -- (-1227.801) (-1228.508) [-1226.970] (-1228.713) * (-1229.713) [-1226.954] (-1227.906) (-1231.927) -- 0:00:37
409000 -- (-1231.851) (-1231.361) (-1228.303) [-1227.012] * (-1229.668) (-1226.907) (-1228.821) [-1227.111] -- 0:00:37
409500 -- (-1228.159) (-1227.362) (-1227.537) [-1229.177] * (-1230.296) (-1226.795) (-1226.564) [-1227.574] -- 0:00:37
410000 -- (-1226.571) [-1226.547] (-1227.550) (-1229.720) * [-1228.626] (-1226.834) (-1226.184) (-1229.286) -- 0:00:37
Average standard deviation of split frequencies: 0.012929
410500 -- (-1228.582) (-1231.297) (-1227.708) [-1229.100] * [-1228.311] (-1226.986) (-1227.649) (-1229.265) -- 0:00:37
411000 -- (-1228.164) (-1228.799) [-1229.259] (-1231.936) * (-1231.511) [-1228.542] (-1230.212) (-1228.387) -- 0:00:37
411500 -- (-1228.541) (-1229.743) [-1228.082] (-1233.059) * (-1227.914) (-1229.397) (-1227.797) [-1228.788] -- 0:00:37
412000 -- [-1229.177] (-1228.037) (-1227.353) (-1230.409) * (-1230.335) (-1228.086) (-1228.565) [-1228.524] -- 0:00:37
412500 -- [-1231.285] (-1230.365) (-1230.084) (-1230.548) * [-1232.464] (-1231.266) (-1228.836) (-1227.609) -- 0:00:37
413000 -- [-1230.801] (-1228.454) (-1228.551) (-1230.558) * (-1228.277) [-1227.291] (-1230.830) (-1226.859) -- 0:00:36
413500 -- (-1230.770) [-1227.849] (-1226.571) (-1228.788) * (-1226.816) (-1227.219) [-1227.789] (-1227.130) -- 0:00:36
414000 -- [-1227.694] (-1227.672) (-1227.138) (-1229.269) * (-1227.576) (-1227.611) (-1232.441) [-1230.174] -- 0:00:36
414500 -- (-1226.766) [-1228.079] (-1227.016) (-1233.138) * [-1227.550] (-1227.784) (-1231.386) (-1227.500) -- 0:00:36
415000 -- (-1231.355) [-1228.958] (-1229.632) (-1230.146) * (-1228.066) (-1228.459) [-1228.919] (-1226.913) -- 0:00:36
Average standard deviation of split frequencies: 0.012087
415500 -- (-1230.088) (-1229.980) [-1227.602] (-1229.463) * (-1229.803) [-1229.817] (-1228.097) (-1227.713) -- 0:00:36
416000 -- (-1230.855) [-1230.169] (-1227.792) (-1227.845) * (-1230.983) [-1231.238] (-1230.085) (-1227.337) -- 0:00:37
416500 -- [-1227.044] (-1228.746) (-1229.218) (-1228.136) * [-1229.235] (-1229.635) (-1232.917) (-1228.456) -- 0:00:37
417000 -- (-1229.056) [-1232.571] (-1228.493) (-1228.091) * (-1229.207) (-1227.522) (-1230.943) [-1227.135] -- 0:00:37
417500 -- (-1229.427) [-1228.459] (-1228.099) (-1226.330) * (-1227.467) (-1228.077) (-1230.381) [-1227.685] -- 0:00:37
418000 -- [-1230.959] (-1227.099) (-1234.058) (-1227.094) * (-1227.878) [-1227.153] (-1230.023) (-1227.669) -- 0:00:37
418500 -- (-1227.256) (-1228.741) (-1230.297) [-1227.564] * (-1228.547) (-1227.402) (-1232.395) [-1228.289] -- 0:00:37
419000 -- (-1230.925) (-1228.440) (-1229.842) [-1227.487] * (-1227.263) (-1228.710) (-1235.061) [-1228.445] -- 0:00:37
419500 -- (-1229.232) [-1226.937] (-1228.946) (-1227.381) * [-1228.576] (-1226.566) (-1232.675) (-1230.151) -- 0:00:37
420000 -- [-1226.753] (-1231.092) (-1228.943) (-1228.377) * (-1230.970) [-1227.424] (-1227.147) (-1230.181) -- 0:00:37
Average standard deviation of split frequencies: 0.011737
420500 -- [-1230.049] (-1230.505) (-1228.642) (-1227.609) * (-1233.732) [-1228.352] (-1227.137) (-1230.218) -- 0:00:37
421000 -- (-1229.494) (-1229.582) [-1228.944] (-1229.203) * (-1229.969) (-1228.780) (-1227.531) [-1228.997] -- 0:00:37
421500 -- (-1228.584) (-1231.679) [-1227.667] (-1228.489) * (-1230.121) (-1227.301) (-1226.370) [-1229.339] -- 0:00:37
422000 -- [-1228.944] (-1229.228) (-1230.197) (-1231.046) * [-1228.924] (-1227.371) (-1226.401) (-1227.647) -- 0:00:36
422500 -- [-1227.689] (-1228.963) (-1233.068) (-1228.500) * (-1229.540) (-1226.636) [-1226.388] (-1228.492) -- 0:00:36
423000 -- (-1231.158) (-1228.986) [-1227.707] (-1228.921) * (-1228.670) (-1228.281) (-1227.920) [-1226.868] -- 0:00:36
423500 -- [-1229.983] (-1227.779) (-1230.509) (-1227.359) * (-1229.550) (-1232.098) (-1227.913) [-1226.625] -- 0:00:36
424000 -- (-1228.726) (-1229.605) [-1230.328] (-1227.610) * (-1227.398) (-1230.203) [-1227.428] (-1227.667) -- 0:00:36
424500 -- [-1229.177] (-1228.492) (-1230.143) (-1231.088) * [-1228.004] (-1227.921) (-1230.181) (-1227.661) -- 0:00:36
425000 -- (-1229.909) (-1226.926) [-1228.587] (-1232.458) * (-1229.165) [-1228.111] (-1232.934) (-1232.370) -- 0:00:36
Average standard deviation of split frequencies: 0.012114
425500 -- (-1230.289) (-1227.572) [-1226.966] (-1231.684) * (-1227.492) (-1229.824) (-1228.796) [-1229.707] -- 0:00:36
426000 -- (-1228.588) (-1229.671) [-1228.437] (-1233.976) * (-1226.819) (-1227.026) (-1228.284) [-1229.110] -- 0:00:36
426500 -- (-1234.485) (-1228.148) (-1226.698) [-1235.965] * (-1228.803) (-1233.742) (-1229.832) [-1229.261] -- 0:00:36
427000 -- (-1228.187) (-1231.158) [-1228.927] (-1228.980) * (-1228.799) (-1233.577) [-1234.720] (-1229.689) -- 0:00:36
427500 -- [-1227.402] (-1228.405) (-1233.942) (-1226.457) * (-1227.761) (-1229.024) [-1228.606] (-1229.664) -- 0:00:36
428000 -- (-1229.534) (-1228.911) (-1228.615) [-1227.909] * [-1228.485] (-1228.988) (-1230.522) (-1228.653) -- 0:00:36
428500 -- (-1227.586) (-1228.536) [-1227.615] (-1228.215) * (-1230.159) (-1229.692) (-1228.831) [-1229.227] -- 0:00:36
429000 -- [-1227.171] (-1232.228) (-1228.089) (-1226.283) * [-1231.795] (-1234.869) (-1229.385) (-1226.373) -- 0:00:35
429500 -- (-1226.149) (-1228.356) [-1227.745] (-1227.939) * [-1228.225] (-1229.981) (-1230.062) (-1227.549) -- 0:00:35
430000 -- (-1226.105) [-1229.343] (-1228.202) (-1229.057) * (-1227.443) [-1227.064] (-1229.773) (-1226.917) -- 0:00:35
Average standard deviation of split frequencies: 0.011983
430500 -- (-1226.280) (-1231.388) [-1228.320] (-1228.667) * (-1232.329) (-1228.318) [-1228.601] (-1227.821) -- 0:00:35
431000 -- [-1226.752] (-1228.998) (-1227.257) (-1227.872) * (-1229.088) (-1228.469) (-1228.196) [-1226.726] -- 0:00:35
431500 -- (-1226.550) (-1229.559) [-1226.914] (-1230.676) * (-1226.496) [-1227.555] (-1227.837) (-1227.557) -- 0:00:35
432000 -- (-1226.594) (-1228.670) [-1228.006] (-1230.596) * (-1227.181) [-1227.173] (-1233.750) (-1232.042) -- 0:00:35
432500 -- (-1230.653) [-1227.571] (-1228.290) (-1229.102) * (-1226.203) (-1228.430) [-1235.561] (-1229.132) -- 0:00:36
433000 -- (-1228.119) (-1229.338) [-1231.568] (-1228.551) * (-1228.701) (-1230.614) [-1227.870] (-1227.667) -- 0:00:36
433500 -- (-1226.343) (-1227.571) [-1230.309] (-1231.015) * (-1230.087) (-1232.061) (-1229.423) [-1226.751] -- 0:00:36
434000 -- [-1231.472] (-1229.111) (-1228.946) (-1228.650) * (-1230.928) (-1230.381) (-1229.748) [-1227.174] -- 0:00:36
434500 -- (-1230.966) [-1227.373] (-1228.942) (-1227.149) * (-1228.883) [-1229.353] (-1231.526) (-1230.629) -- 0:00:36
435000 -- (-1230.823) (-1228.078) (-1226.280) [-1227.506] * (-1232.663) (-1229.240) (-1228.047) [-1229.679] -- 0:00:36
Average standard deviation of split frequencies: 0.012292
435500 -- (-1228.943) (-1231.369) (-1230.487) [-1226.837] * (-1229.364) (-1229.806) [-1228.133] (-1226.446) -- 0:00:36
436000 -- (-1228.288) (-1228.694) (-1227.965) [-1227.178] * (-1230.537) [-1227.066] (-1228.492) (-1227.095) -- 0:00:36
436500 -- (-1228.780) (-1226.921) [-1229.448] (-1228.154) * (-1230.051) [-1230.206] (-1227.521) (-1226.977) -- 0:00:36
437000 -- (-1229.871) [-1227.426] (-1228.213) (-1227.382) * [-1230.453] (-1228.134) (-1227.138) (-1227.594) -- 0:00:36
437500 -- [-1229.212] (-1228.035) (-1228.216) (-1227.078) * (-1234.386) [-1228.765] (-1227.233) (-1226.835) -- 0:00:36
438000 -- [-1228.730] (-1227.121) (-1228.599) (-1231.569) * (-1232.603) (-1229.027) (-1228.214) [-1229.007] -- 0:00:35
438500 -- [-1226.859] (-1230.114) (-1236.067) (-1227.905) * (-1228.079) (-1229.162) [-1228.473] (-1227.956) -- 0:00:35
439000 -- (-1226.591) (-1229.452) (-1227.261) [-1226.951] * [-1228.663] (-1229.234) (-1230.640) (-1226.485) -- 0:00:35
439500 -- (-1230.665) (-1228.361) [-1227.593] (-1229.324) * (-1230.734) [-1230.596] (-1231.374) (-1229.122) -- 0:00:35
440000 -- [-1227.896] (-1233.121) (-1226.859) (-1228.815) * (-1226.767) [-1228.340] (-1227.752) (-1232.517) -- 0:00:35
Average standard deviation of split frequencies: 0.013075
440500 -- (-1229.918) (-1231.772) (-1232.283) [-1227.803] * (-1226.957) (-1229.656) [-1227.698] (-1231.664) -- 0:00:35
441000 -- [-1229.142] (-1228.537) (-1229.843) (-1228.167) * (-1227.128) [-1226.545] (-1230.250) (-1229.278) -- 0:00:35
441500 -- [-1230.710] (-1229.004) (-1229.894) (-1229.491) * (-1229.320) (-1227.971) (-1231.247) [-1227.598] -- 0:00:35
442000 -- (-1229.902) [-1226.688] (-1230.811) (-1228.375) * (-1235.988) (-1228.262) [-1229.322] (-1231.067) -- 0:00:35
442500 -- (-1229.097) [-1230.204] (-1228.833) (-1229.094) * (-1227.969) (-1226.964) [-1230.422] (-1228.482) -- 0:00:35
443000 -- (-1228.043) (-1228.823) (-1232.008) [-1227.429] * (-1232.011) [-1227.937] (-1229.308) (-1228.203) -- 0:00:35
443500 -- (-1227.284) (-1226.098) [-1229.737] (-1227.497) * [-1229.210] (-1229.421) (-1228.570) (-1226.489) -- 0:00:35
444000 -- [-1226.135] (-1227.636) (-1228.933) (-1227.488) * (-1229.861) [-1229.910] (-1229.835) (-1227.312) -- 0:00:35
444500 -- [-1232.218] (-1230.660) (-1230.130) (-1229.045) * (-1228.731) (-1228.200) (-1229.541) [-1226.468] -- 0:00:34
445000 -- (-1227.894) (-1226.729) (-1229.866) [-1228.338] * (-1229.478) (-1228.926) [-1227.938] (-1234.162) -- 0:00:34
Average standard deviation of split frequencies: 0.012850
445500 -- (-1229.751) (-1229.423) [-1228.724] (-1227.030) * (-1231.073) [-1227.106] (-1232.001) (-1236.973) -- 0:00:34
446000 -- [-1230.166] (-1229.428) (-1228.777) (-1231.272) * [-1232.063] (-1235.482) (-1232.035) (-1239.257) -- 0:00:34
446500 -- (-1229.630) (-1229.167) [-1228.461] (-1228.404) * (-1226.891) (-1232.982) [-1229.952] (-1227.000) -- 0:00:34
447000 -- (-1232.562) [-1227.627] (-1228.182) (-1226.949) * (-1228.573) (-1229.899) [-1229.589] (-1229.611) -- 0:00:34
447500 -- (-1230.840) (-1229.168) [-1229.699] (-1228.663) * (-1228.318) (-1228.391) [-1229.275] (-1232.594) -- 0:00:34
448000 -- (-1227.405) (-1229.197) [-1231.694] (-1231.349) * (-1229.453) (-1228.316) [-1229.505] (-1228.779) -- 0:00:34
448500 -- (-1227.231) (-1231.332) (-1228.763) [-1226.820] * [-1228.741] (-1228.931) (-1229.543) (-1231.537) -- 0:00:35
449000 -- (-1228.758) (-1231.746) [-1229.378] (-1226.602) * (-1231.261) (-1227.221) [-1229.892] (-1226.706) -- 0:00:35
449500 -- (-1227.875) (-1229.495) [-1228.694] (-1226.297) * (-1234.379) (-1230.606) [-1230.993] (-1226.310) -- 0:00:35
450000 -- (-1228.253) (-1228.681) (-1228.965) [-1227.346] * (-1228.159) (-1227.634) [-1229.648] (-1226.671) -- 0:00:35
Average standard deviation of split frequencies: 0.012167
450500 -- (-1228.510) (-1229.075) [-1228.700] (-1229.005) * (-1230.132) [-1228.239] (-1229.539) (-1229.147) -- 0:00:35
451000 -- (-1227.001) (-1229.001) [-1228.056] (-1228.735) * (-1230.132) (-1234.796) [-1227.525] (-1228.333) -- 0:00:35
451500 -- (-1227.633) (-1227.050) (-1229.755) [-1228.119] * (-1229.538) [-1227.703] (-1230.627) (-1228.380) -- 0:00:35
452000 -- (-1228.627) (-1228.533) [-1228.464] (-1226.356) * (-1233.147) (-1227.103) [-1231.643] (-1228.223) -- 0:00:35
452500 -- (-1229.139) (-1227.999) [-1226.502] (-1231.387) * (-1229.853) [-1226.980] (-1229.059) (-1227.434) -- 0:00:35
453000 -- (-1231.125) [-1227.994] (-1229.143) (-1228.402) * (-1229.244) [-1226.991] (-1226.894) (-1231.859) -- 0:00:35
453500 -- (-1228.668) [-1227.955] (-1229.565) (-1227.820) * (-1226.982) (-1226.881) [-1227.245] (-1227.534) -- 0:00:34
454000 -- (-1227.407) [-1228.351] (-1229.301) (-1227.448) * (-1228.752) [-1229.463] (-1228.409) (-1230.146) -- 0:00:34
454500 -- (-1228.451) (-1227.373) [-1231.354] (-1228.228) * (-1226.763) [-1226.307] (-1228.890) (-1232.935) -- 0:00:34
455000 -- (-1227.598) [-1227.308] (-1227.851) (-1227.373) * (-1230.619) (-1228.771) [-1227.694] (-1232.343) -- 0:00:34
Average standard deviation of split frequencies: 0.011807
455500 -- (-1227.432) (-1228.753) (-1227.280) [-1229.480] * (-1229.350) (-1231.878) [-1231.060] (-1229.247) -- 0:00:34
456000 -- (-1227.767) (-1227.386) [-1232.096] (-1230.285) * [-1228.565] (-1227.843) (-1227.775) (-1232.208) -- 0:00:34
456500 -- (-1228.486) (-1227.251) (-1227.991) [-1228.958] * (-1228.590) (-1227.991) [-1228.129] (-1231.801) -- 0:00:34
457000 -- (-1227.681) (-1230.969) [-1227.944] (-1228.511) * (-1229.796) [-1229.512] (-1227.614) (-1231.805) -- 0:00:34
457500 -- (-1227.754) (-1227.914) (-1226.835) [-1226.530] * [-1229.754] (-1228.095) (-1227.203) (-1229.397) -- 0:00:34
458000 -- (-1228.056) (-1228.886) (-1226.268) [-1227.680] * (-1229.066) (-1229.386) (-1228.274) [-1228.983] -- 0:00:34
458500 -- (-1227.578) [-1228.600] (-1227.326) (-1229.685) * (-1227.634) [-1226.994] (-1230.809) (-1230.879) -- 0:00:34
459000 -- (-1227.999) [-1229.145] (-1230.718) (-1228.447) * (-1228.355) (-1227.106) [-1229.482] (-1229.847) -- 0:00:34
459500 -- (-1228.994) (-1228.995) [-1226.435] (-1233.619) * [-1228.404] (-1226.799) (-1230.931) (-1230.294) -- 0:00:34
460000 -- (-1228.177) (-1227.900) [-1227.009] (-1228.666) * (-1229.516) (-1226.614) (-1230.574) [-1228.347] -- 0:00:34
Average standard deviation of split frequencies: 0.012280
460500 -- [-1226.553] (-1228.609) (-1229.523) (-1231.973) * (-1226.757) [-1226.639] (-1228.354) (-1231.701) -- 0:00:33
461000 -- [-1230.389] (-1227.671) (-1229.939) (-1231.247) * (-1227.688) (-1228.289) (-1226.560) [-1230.525] -- 0:00:33
461500 -- (-1228.138) [-1228.286] (-1228.108) (-1231.075) * [-1227.691] (-1228.754) (-1229.159) (-1229.345) -- 0:00:33
462000 -- (-1228.266) (-1230.266) (-1226.537) [-1229.176] * (-1231.847) [-1231.901] (-1229.115) (-1228.771) -- 0:00:33
462500 -- (-1228.191) [-1227.293] (-1227.939) (-1227.679) * (-1230.264) (-1230.121) (-1228.093) [-1231.723] -- 0:00:33
463000 -- (-1228.037) (-1226.805) [-1231.586] (-1228.101) * (-1230.174) (-1228.340) [-1226.726] (-1226.999) -- 0:00:33
463500 -- [-1228.876] (-1227.340) (-1232.088) (-1227.378) * (-1227.645) [-1231.875] (-1230.603) (-1227.103) -- 0:00:33
464000 -- (-1229.297) (-1227.836) (-1226.616) [-1226.814] * [-1230.196] (-1227.604) (-1231.138) (-1228.131) -- 0:00:33
464500 -- (-1228.908) (-1226.258) [-1226.628] (-1226.770) * (-1227.441) (-1227.947) (-1231.317) [-1228.117] -- 0:00:34
465000 -- (-1226.919) (-1226.274) (-1226.406) [-1230.550] * (-1227.658) (-1228.625) (-1228.759) [-1227.713] -- 0:00:34
Average standard deviation of split frequencies: 0.012033
465500 -- (-1228.173) (-1227.071) (-1228.980) [-1230.898] * (-1227.065) (-1228.536) (-1228.487) [-1230.904] -- 0:00:34
466000 -- (-1229.483) (-1230.200) [-1227.923] (-1229.332) * [-1228.156] (-1228.887) (-1229.453) (-1231.604) -- 0:00:34
466500 -- (-1228.710) (-1229.984) (-1230.194) [-1229.911] * (-1231.071) (-1227.468) (-1227.951) [-1227.504] -- 0:00:34
467000 -- [-1227.975] (-1232.056) (-1227.332) (-1232.651) * (-1229.782) (-1227.475) [-1226.852] (-1227.677) -- 0:00:34
467500 -- [-1229.506] (-1228.137) (-1229.662) (-1231.344) * (-1228.378) (-1226.633) [-1226.879] (-1227.008) -- 0:00:34
468000 -- (-1231.448) [-1228.869] (-1227.744) (-1232.451) * (-1231.166) (-1226.756) [-1230.070] (-1229.144) -- 0:00:34
468500 -- (-1228.893) [-1227.459] (-1227.991) (-1227.348) * [-1230.057] (-1228.030) (-1227.410) (-1232.127) -- 0:00:34
469000 -- (-1228.008) [-1227.337] (-1234.791) (-1227.752) * (-1226.340) (-1227.417) [-1228.345] (-1228.221) -- 0:00:33
469500 -- [-1230.775] (-1228.021) (-1227.510) (-1230.472) * (-1229.518) [-1228.757] (-1227.670) (-1228.008) -- 0:00:33
470000 -- (-1230.654) (-1231.002) (-1227.656) [-1229.244] * (-1226.820) (-1229.946) (-1229.142) [-1226.289] -- 0:00:33
Average standard deviation of split frequencies: 0.012493
470500 -- (-1236.679) [-1229.936] (-1228.318) (-1227.427) * (-1227.310) (-1229.702) (-1226.491) [-1227.474] -- 0:00:33
471000 -- (-1231.614) (-1229.358) (-1228.598) [-1228.282] * [-1230.079] (-1229.709) (-1228.657) (-1230.460) -- 0:00:33
471500 -- [-1229.363] (-1230.015) (-1231.732) (-1227.974) * (-1231.674) [-1229.776] (-1228.834) (-1227.025) -- 0:00:33
472000 -- [-1226.761] (-1226.451) (-1228.902) (-1228.804) * [-1227.806] (-1229.202) (-1229.192) (-1231.411) -- 0:00:33
472500 -- [-1229.848] (-1228.590) (-1229.043) (-1234.033) * (-1230.389) (-1231.219) [-1226.853] (-1228.897) -- 0:00:33
473000 -- (-1228.902) [-1227.725] (-1228.817) (-1228.592) * (-1231.913) (-1226.506) (-1228.296) [-1229.200] -- 0:00:33
473500 -- (-1230.446) [-1227.903] (-1229.818) (-1226.557) * [-1231.668] (-1229.556) (-1228.437) (-1227.088) -- 0:00:33
474000 -- [-1229.679] (-1229.338) (-1231.035) (-1226.553) * (-1227.445) (-1234.518) (-1227.783) [-1226.931] -- 0:00:33
474500 -- [-1228.958] (-1230.196) (-1229.840) (-1226.729) * (-1227.516) (-1229.875) [-1227.952] (-1227.256) -- 0:00:33
475000 -- (-1229.812) [-1229.255] (-1228.369) (-1228.673) * (-1229.273) (-1234.019) (-1231.838) [-1228.699] -- 0:00:33
Average standard deviation of split frequencies: 0.013095
475500 -- [-1227.612] (-1229.127) (-1230.174) (-1229.416) * (-1231.312) [-1230.687] (-1227.112) (-1227.300) -- 0:00:33
476000 -- (-1228.713) (-1228.025) (-1229.057) [-1227.226] * [-1229.059] (-1228.100) (-1229.788) (-1228.835) -- 0:00:33
476500 -- [-1226.821] (-1229.822) (-1227.050) (-1227.876) * (-1227.815) [-1229.068] (-1230.245) (-1236.304) -- 0:00:32
477000 -- (-1226.917) [-1227.460] (-1229.713) (-1228.843) * (-1227.131) (-1228.800) [-1227.521] (-1233.429) -- 0:00:32
477500 -- [-1227.228] (-1228.461) (-1232.375) (-1227.550) * [-1230.631] (-1230.739) (-1227.168) (-1231.799) -- 0:00:32
478000 -- (-1227.082) (-1230.155) [-1229.298] (-1227.134) * (-1226.095) (-1229.127) (-1228.375) [-1227.517] -- 0:00:32
478500 -- (-1228.235) (-1230.258) (-1233.434) [-1226.473] * (-1228.680) (-1228.784) [-1229.327] (-1227.627) -- 0:00:32
479000 -- (-1227.552) (-1228.996) [-1229.066] (-1228.391) * (-1229.634) (-1228.165) [-1228.244] (-1228.263) -- 0:00:32
479500 -- (-1234.314) [-1228.330] (-1228.312) (-1227.968) * (-1228.712) [-1230.029] (-1228.000) (-1228.173) -- 0:00:32
480000 -- (-1235.119) (-1228.013) [-1226.676] (-1227.060) * (-1231.766) (-1229.643) [-1226.636] (-1231.174) -- 0:00:32
Average standard deviation of split frequencies: 0.012314
480500 -- [-1227.894] (-1230.937) (-1228.696) (-1230.270) * [-1227.336] (-1232.794) (-1229.370) (-1229.453) -- 0:00:33
481000 -- (-1227.670) [-1228.898] (-1229.774) (-1228.578) * (-1228.709) (-1229.091) [-1227.406] (-1230.618) -- 0:00:33
481500 -- [-1227.557] (-1231.583) (-1228.822) (-1227.988) * (-1228.606) (-1227.027) [-1226.908] (-1229.146) -- 0:00:33
482000 -- (-1226.674) (-1227.180) (-1228.996) [-1226.438] * (-1228.368) (-1227.589) [-1226.695] (-1226.641) -- 0:00:33
482500 -- (-1230.383) [-1227.371] (-1227.506) (-1228.445) * (-1226.668) (-1227.673) (-1230.483) [-1229.185] -- 0:00:33
483000 -- [-1227.925] (-1227.012) (-1228.671) (-1228.522) * (-1226.460) (-1230.018) [-1230.022] (-1228.580) -- 0:00:33
483500 -- (-1232.131) [-1227.633] (-1226.369) (-1227.835) * [-1230.329] (-1227.730) (-1229.032) (-1227.733) -- 0:00:33
484000 -- (-1227.447) (-1228.396) [-1226.843] (-1227.737) * [-1229.029] (-1231.654) (-1226.953) (-1228.236) -- 0:00:33
484500 -- (-1227.952) (-1228.778) (-1227.730) [-1227.271] * (-1231.205) (-1226.905) (-1226.946) [-1229.969] -- 0:00:32
485000 -- (-1229.555) (-1231.728) [-1227.745] (-1227.859) * (-1229.327) (-1226.317) (-1229.194) [-1228.017] -- 0:00:32
Average standard deviation of split frequencies: 0.011478
485500 -- (-1227.491) [-1229.604] (-1228.283) (-1227.641) * (-1230.279) [-1232.004] (-1229.636) (-1227.131) -- 0:00:32
486000 -- [-1226.394] (-1226.788) (-1226.237) (-1233.220) * (-1227.289) (-1231.625) [-1231.235] (-1226.965) -- 0:00:32
486500 -- [-1231.508] (-1228.373) (-1228.975) (-1227.048) * [-1226.533] (-1227.981) (-1228.689) (-1227.197) -- 0:00:32
487000 -- (-1228.820) (-1226.939) (-1227.190) [-1227.025] * (-1226.762) [-1227.710] (-1226.214) (-1229.397) -- 0:00:32
487500 -- (-1230.700) (-1228.498) (-1229.043) [-1227.048] * (-1226.333) (-1226.638) [-1229.327] (-1227.232) -- 0:00:32
488000 -- (-1229.073) (-1228.365) [-1228.697] (-1227.810) * (-1227.165) (-1226.634) (-1228.991) [-1229.035] -- 0:00:32
488500 -- (-1230.159) (-1228.149) [-1231.747] (-1227.148) * [-1227.689] (-1227.634) (-1227.630) (-1228.880) -- 0:00:32
489000 -- (-1228.422) (-1228.715) (-1228.286) [-1226.739] * [-1227.698] (-1228.454) (-1226.556) (-1228.043) -- 0:00:32
489500 -- [-1227.453] (-1226.668) (-1227.268) (-1228.103) * (-1231.608) [-1229.917] (-1229.043) (-1230.207) -- 0:00:32
490000 -- (-1228.522) (-1227.267) [-1226.647] (-1226.598) * [-1227.442] (-1229.985) (-1226.757) (-1229.014) -- 0:00:32
Average standard deviation of split frequencies: 0.011369
490500 -- (-1231.376) (-1227.047) [-1226.797] (-1227.382) * (-1227.205) (-1229.135) (-1226.947) [-1229.478] -- 0:00:32
491000 -- (-1229.611) [-1227.433] (-1227.271) (-1227.602) * (-1227.159) [-1227.703] (-1226.081) (-1232.301) -- 0:00:32
491500 -- [-1227.501] (-1226.241) (-1228.750) (-1228.706) * (-1226.773) (-1228.429) [-1226.472] (-1228.447) -- 0:00:32
492000 -- [-1229.704] (-1228.711) (-1228.261) (-1227.741) * [-1226.554] (-1228.330) (-1227.095) (-1228.623) -- 0:00:32
492500 -- [-1227.670] (-1229.644) (-1229.570) (-1228.430) * (-1226.455) (-1229.206) [-1227.054] (-1227.026) -- 0:00:31
493000 -- (-1228.715) [-1229.924] (-1227.906) (-1228.564) * (-1227.079) (-1227.076) [-1226.224] (-1227.376) -- 0:00:31
493500 -- [-1226.654] (-1230.099) (-1229.005) (-1229.213) * (-1230.649) [-1227.334] (-1227.531) (-1227.888) -- 0:00:31
494000 -- (-1227.222) [-1228.190] (-1229.795) (-1226.967) * (-1228.891) (-1232.516) [-1227.507] (-1226.976) -- 0:00:31
494500 -- [-1228.131] (-1227.553) (-1232.012) (-1228.373) * (-1229.565) (-1232.065) [-1227.294] (-1228.277) -- 0:00:31
495000 -- (-1227.929) [-1228.103] (-1230.127) (-1227.864) * [-1228.225] (-1228.371) (-1226.505) (-1229.596) -- 0:00:31
Average standard deviation of split frequencies: 0.011247
495500 -- (-1227.114) (-1228.334) (-1228.650) [-1227.909] * (-1228.035) [-1227.363] (-1228.466) (-1226.880) -- 0:00:31
496000 -- (-1229.646) (-1227.955) [-1229.130] (-1227.952) * [-1227.468] (-1227.260) (-1226.889) (-1226.677) -- 0:00:31
496500 -- (-1226.399) [-1230.036] (-1229.638) (-1228.557) * (-1228.627) (-1228.726) (-1226.718) [-1226.824] -- 0:00:31
497000 -- (-1226.927) (-1228.568) (-1229.734) [-1228.229] * [-1227.227] (-1227.557) (-1228.825) (-1229.009) -- 0:00:32
497500 -- [-1226.404] (-1228.074) (-1229.722) (-1228.432) * [-1227.647] (-1227.520) (-1226.660) (-1228.312) -- 0:00:32
498000 -- (-1229.217) (-1229.518) (-1226.478) [-1226.950] * (-1227.454) (-1228.987) [-1226.915] (-1228.318) -- 0:00:32
498500 -- (-1227.186) (-1229.552) (-1227.699) [-1227.063] * (-1228.821) (-1232.020) [-1226.920] (-1231.592) -- 0:00:32
499000 -- (-1228.014) (-1231.220) [-1228.557] (-1227.009) * (-1227.268) (-1230.985) (-1228.880) [-1227.252] -- 0:00:32
499500 -- (-1227.116) (-1229.584) (-1228.597) [-1228.531] * [-1227.703] (-1226.356) (-1227.998) (-1226.361) -- 0:00:32
500000 -- (-1228.608) [-1229.679] (-1227.008) (-1230.124) * (-1228.652) (-1227.675) [-1226.560] (-1227.470) -- 0:00:32
Average standard deviation of split frequencies: 0.010776
500500 -- (-1227.534) (-1228.957) [-1227.289] (-1228.973) * (-1227.605) [-1228.011] (-1226.305) (-1226.554) -- 0:00:31
501000 -- (-1233.681) (-1228.342) [-1228.559] (-1231.119) * (-1228.679) (-1227.365) [-1226.694] (-1228.031) -- 0:00:31
501500 -- (-1230.684) (-1228.789) (-1226.856) [-1227.205] * (-1228.503) [-1229.996] (-1226.694) (-1229.202) -- 0:00:31
502000 -- (-1227.460) [-1228.584] (-1228.996) (-1228.404) * [-1228.816] (-1234.274) (-1236.423) (-1230.028) -- 0:00:31
502500 -- [-1228.016] (-1228.618) (-1229.331) (-1228.352) * (-1227.245) (-1232.427) (-1227.565) [-1231.735] -- 0:00:31
503000 -- (-1228.018) (-1227.048) (-1226.868) [-1227.378] * (-1230.109) (-1231.683) [-1227.321] (-1228.927) -- 0:00:31
503500 -- (-1228.042) [-1228.534] (-1226.853) (-1228.363) * [-1228.631] (-1228.898) (-1226.973) (-1229.199) -- 0:00:31
504000 -- (-1230.087) (-1232.775) (-1226.853) [-1228.797] * (-1228.374) [-1231.093] (-1227.580) (-1234.760) -- 0:00:31
504500 -- (-1229.331) (-1228.598) (-1228.866) [-1228.064] * [-1230.362] (-1226.799) (-1227.713) (-1227.415) -- 0:00:31
505000 -- [-1228.845] (-1229.327) (-1227.424) (-1228.903) * (-1233.567) [-1226.752] (-1227.081) (-1227.109) -- 0:00:31
Average standard deviation of split frequencies: 0.010507
505500 -- [-1229.926] (-1228.844) (-1230.266) (-1230.630) * (-1233.535) (-1231.138) (-1227.271) [-1227.091] -- 0:00:31
506000 -- [-1226.997] (-1228.117) (-1228.014) (-1226.590) * (-1232.015) (-1231.305) [-1228.455] (-1226.909) -- 0:00:31
506500 -- (-1227.451) (-1227.596) (-1227.002) [-1226.590] * (-1232.757) (-1232.338) (-1228.413) [-1232.962] -- 0:00:31
507000 -- (-1230.133) (-1229.331) (-1233.678) [-1228.433] * (-1227.482) (-1228.185) (-1226.847) [-1231.433] -- 0:00:31
507500 -- (-1228.580) (-1229.155) (-1235.801) [-1226.769] * (-1226.915) [-1230.468] (-1228.240) (-1228.095) -- 0:00:31
508000 -- (-1231.961) (-1229.434) [-1227.009] (-1227.416) * (-1230.920) (-1226.878) [-1226.654] (-1232.462) -- 0:00:30
508500 -- (-1238.529) (-1226.578) (-1227.310) [-1227.913] * (-1229.058) [-1227.921] (-1228.350) (-1229.223) -- 0:00:30
509000 -- (-1227.300) (-1226.918) [-1230.957] (-1229.932) * (-1227.381) [-1231.669] (-1226.606) (-1229.255) -- 0:00:30
509500 -- (-1227.663) (-1228.377) (-1232.476) [-1228.629] * (-1226.527) [-1227.164] (-1228.061) (-1227.606) -- 0:00:30
510000 -- (-1226.657) (-1228.193) (-1230.107) [-1226.510] * (-1228.920) [-1229.268] (-1227.429) (-1227.041) -- 0:00:30
Average standard deviation of split frequencies: 0.009693
510500 -- [-1228.373] (-1226.936) (-1235.212) (-1231.748) * (-1226.581) (-1231.305) (-1231.366) [-1226.406] -- 0:00:30
511000 -- (-1229.108) (-1228.005) (-1233.201) [-1229.033] * (-1226.450) (-1231.114) (-1227.893) [-1228.591] -- 0:00:30
511500 -- (-1228.050) [-1228.898] (-1227.419) (-1229.032) * [-1226.922] (-1231.292) (-1227.911) (-1230.889) -- 0:00:30
512000 -- (-1229.456) (-1228.922) (-1228.090) [-1231.216] * [-1227.096] (-1226.640) (-1227.203) (-1228.235) -- 0:00:30
512500 -- [-1227.780] (-1229.170) (-1230.489) (-1228.726) * (-1228.574) [-1227.334] (-1228.113) (-1230.006) -- 0:00:30
513000 -- (-1226.321) (-1227.893) (-1226.303) [-1230.223] * [-1234.560] (-1227.323) (-1226.249) (-1227.726) -- 0:00:31
513500 -- (-1227.389) (-1228.748) [-1226.432] (-1227.413) * (-1228.223) (-1227.150) (-1226.449) [-1227.828] -- 0:00:31
514000 -- (-1227.358) (-1227.610) [-1226.641] (-1230.343) * [-1226.849] (-1227.506) (-1226.639) (-1227.721) -- 0:00:31
514500 -- (-1228.883) (-1227.490) (-1231.859) [-1227.670] * (-1226.792) (-1227.287) (-1228.469) [-1226.762] -- 0:00:31
515000 -- [-1227.472] (-1230.359) (-1226.245) (-1227.916) * (-1228.208) (-1227.361) (-1228.261) [-1226.874] -- 0:00:31
Average standard deviation of split frequencies: 0.009440
515500 -- (-1228.563) (-1230.726) (-1227.211) [-1228.853] * (-1226.741) (-1226.706) (-1227.758) [-1229.317] -- 0:00:31
516000 -- [-1229.049] (-1232.313) (-1230.666) (-1227.258) * (-1226.724) [-1227.238] (-1228.109) (-1230.038) -- 0:00:30
516500 -- (-1229.181) [-1231.698] (-1231.181) (-1229.488) * (-1230.175) (-1227.015) [-1229.479] (-1228.063) -- 0:00:30
517000 -- (-1228.589) (-1230.854) (-1229.853) [-1231.955] * (-1228.361) (-1228.946) (-1231.133) [-1226.768] -- 0:00:30
517500 -- (-1227.349) (-1233.525) [-1232.618] (-1228.312) * (-1229.517) [-1227.722] (-1228.674) (-1227.707) -- 0:00:30
518000 -- (-1227.079) [-1231.511] (-1228.202) (-1229.866) * (-1233.778) (-1229.610) (-1228.691) [-1228.004] -- 0:00:30
518500 -- (-1229.034) (-1228.430) [-1228.877] (-1229.982) * (-1229.176) [-1226.152] (-1233.019) (-1227.982) -- 0:00:30
519000 -- [-1227.685] (-1228.618) (-1230.892) (-1229.417) * [-1229.006] (-1227.795) (-1228.049) (-1227.866) -- 0:00:30
519500 -- (-1226.824) [-1228.013] (-1228.801) (-1228.986) * (-1229.127) (-1230.050) (-1227.654) [-1229.666] -- 0:00:30
520000 -- (-1230.694) (-1227.672) (-1228.180) [-1229.220] * (-1227.099) [-1228.078] (-1227.053) (-1227.962) -- 0:00:30
Average standard deviation of split frequencies: 0.009160
520500 -- (-1226.971) [-1231.409] (-1226.832) (-1228.714) * (-1228.424) (-1233.332) (-1227.787) [-1227.283] -- 0:00:30
521000 -- [-1226.896] (-1228.826) (-1227.117) (-1227.226) * (-1227.499) (-1232.363) (-1229.839) [-1226.816] -- 0:00:30
521500 -- (-1227.343) (-1227.320) [-1230.557] (-1229.074) * [-1231.613] (-1231.612) (-1230.930) (-1226.750) -- 0:00:30
522000 -- (-1230.299) [-1226.641] (-1230.295) (-1226.285) * (-1233.774) [-1230.194] (-1230.133) (-1228.082) -- 0:00:30
522500 -- (-1231.286) (-1234.737) (-1227.955) [-1226.605] * [-1232.980] (-1229.528) (-1232.057) (-1228.371) -- 0:00:30
523000 -- (-1229.566) (-1231.476) [-1227.775] (-1226.837) * (-1229.258) (-1230.095) (-1228.026) [-1227.604] -- 0:00:30
523500 -- (-1227.307) (-1227.368) (-1226.699) [-1229.178] * (-1233.392) (-1227.817) [-1227.794] (-1229.231) -- 0:00:30
524000 -- (-1227.575) (-1226.345) [-1229.322] (-1229.011) * (-1228.626) [-1232.452] (-1226.450) (-1228.946) -- 0:00:29
524500 -- (-1227.853) (-1227.932) [-1228.150] (-1227.023) * (-1231.458) (-1226.502) (-1226.490) [-1227.290] -- 0:00:29
525000 -- (-1228.041) (-1230.686) [-1227.886] (-1229.056) * (-1232.728) (-1230.380) (-1226.556) [-1226.985] -- 0:00:29
Average standard deviation of split frequencies: 0.009012
525500 -- (-1229.252) (-1228.739) (-1226.677) [-1230.343] * (-1230.966) (-1227.936) [-1227.935] (-1226.821) -- 0:00:29
526000 -- (-1231.403) [-1230.347] (-1230.099) (-1229.637) * (-1228.776) (-1227.649) (-1226.615) [-1227.748] -- 0:00:29
526500 -- (-1229.032) (-1226.539) [-1227.515] (-1228.323) * (-1228.145) [-1226.964] (-1226.553) (-1226.825) -- 0:00:29
527000 -- (-1229.140) [-1230.640] (-1226.665) (-1232.178) * [-1228.087] (-1230.610) (-1227.290) (-1229.444) -- 0:00:29
527500 -- (-1227.851) (-1234.073) [-1230.195] (-1226.961) * (-1228.613) (-1228.983) (-1229.237) [-1226.570] -- 0:00:29
528000 -- [-1231.117] (-1231.519) (-1231.940) (-1227.016) * (-1229.975) (-1227.159) [-1227.835] (-1226.888) -- 0:00:29
528500 -- (-1228.890) (-1237.397) [-1228.061] (-1227.394) * (-1230.605) [-1227.285] (-1228.257) (-1226.521) -- 0:00:29
529000 -- (-1227.185) (-1231.376) (-1231.290) [-1226.402] * (-1226.727) (-1240.156) (-1231.000) [-1228.030] -- 0:00:30
529500 -- [-1231.668] (-1228.976) (-1230.396) (-1226.574) * (-1227.474) (-1229.277) [-1226.807] (-1229.648) -- 0:00:30
530000 -- (-1229.468) [-1228.778] (-1228.565) (-1226.913) * [-1227.076] (-1229.277) (-1226.945) (-1227.500) -- 0:00:30
Average standard deviation of split frequencies: 0.008883
530500 -- (-1231.166) [-1226.481] (-1228.092) (-1228.678) * (-1229.881) (-1228.409) (-1229.581) [-1229.514] -- 0:00:30
531000 -- (-1232.412) (-1227.804) [-1226.545] (-1228.293) * (-1229.584) [-1228.128] (-1230.054) (-1227.068) -- 0:00:30
531500 -- (-1229.801) [-1228.722] (-1227.073) (-1230.950) * [-1226.939] (-1226.619) (-1230.032) (-1228.021) -- 0:00:29
532000 -- (-1230.947) [-1229.132] (-1228.613) (-1231.549) * (-1229.024) (-1227.092) (-1230.815) [-1228.867] -- 0:00:29
532500 -- (-1230.288) [-1231.864] (-1229.855) (-1229.165) * [-1226.870] (-1226.379) (-1230.546) (-1227.965) -- 0:00:29
533000 -- [-1227.145] (-1230.099) (-1227.014) (-1231.062) * (-1227.324) (-1226.326) [-1229.263] (-1229.589) -- 0:00:29
533500 -- (-1229.113) (-1230.162) [-1229.726] (-1230.483) * (-1226.978) (-1227.254) (-1227.474) [-1227.811] -- 0:00:29
534000 -- [-1227.959] (-1227.379) (-1227.494) (-1228.343) * [-1226.545] (-1227.772) (-1227.080) (-1227.673) -- 0:00:29
534500 -- [-1227.270] (-1228.895) (-1232.527) (-1229.334) * (-1227.558) (-1226.984) [-1228.126] (-1227.507) -- 0:00:29
535000 -- (-1230.093) (-1227.880) [-1229.731] (-1228.721) * [-1227.516] (-1229.322) (-1228.674) (-1227.536) -- 0:00:29
Average standard deviation of split frequencies: 0.008640
535500 -- (-1228.823) [-1231.897] (-1228.582) (-1227.738) * (-1228.065) (-1230.717) [-1228.381] (-1228.098) -- 0:00:29
536000 -- (-1228.472) (-1232.374) [-1228.918] (-1227.628) * (-1229.828) [-1227.976] (-1227.411) (-1228.415) -- 0:00:29
536500 -- [-1227.689] (-1229.336) (-1228.086) (-1229.618) * (-1229.073) (-1228.400) [-1228.642] (-1226.888) -- 0:00:29
537000 -- [-1227.895] (-1228.754) (-1230.985) (-1233.450) * (-1230.697) (-1227.950) [-1227.635] (-1226.888) -- 0:00:29
537500 -- (-1226.594) (-1228.388) (-1229.450) [-1228.811] * (-1230.531) (-1226.861) [-1227.065] (-1229.731) -- 0:00:29
538000 -- (-1228.564) (-1229.308) (-1231.164) [-1227.130] * (-1230.866) (-1233.426) [-1227.573] (-1227.681) -- 0:00:29
538500 -- (-1229.249) (-1228.027) (-1228.122) [-1229.263] * (-1229.201) (-1229.592) (-1226.798) [-1226.409] -- 0:00:29
539000 -- (-1229.936) (-1228.354) [-1228.970] (-1230.757) * [-1227.147] (-1228.277) (-1227.159) (-1229.882) -- 0:00:29
539500 -- (-1227.086) (-1233.083) [-1227.201] (-1228.970) * (-1226.781) (-1226.895) (-1227.391) [-1229.845] -- 0:00:29
540000 -- [-1228.085] (-1230.314) (-1227.710) (-1229.737) * (-1229.996) (-1227.839) (-1227.983) [-1232.367] -- 0:00:28
Average standard deviation of split frequencies: 0.009642
540500 -- (-1229.057) [-1228.757] (-1228.658) (-1227.299) * [-1227.641] (-1230.198) (-1229.498) (-1235.889) -- 0:00:28
541000 -- (-1227.697) [-1227.217] (-1228.479) (-1228.070) * [-1227.114] (-1230.439) (-1228.706) (-1231.611) -- 0:00:28
541500 -- (-1227.286) (-1234.923) [-1227.813] (-1228.420) * (-1227.291) (-1229.783) [-1229.549] (-1231.401) -- 0:00:28
542000 -- (-1227.013) (-1231.211) (-1228.204) [-1229.898] * (-1230.626) (-1228.683) (-1229.685) [-1226.833] -- 0:00:28
542500 -- (-1228.287) [-1227.747] (-1229.108) (-1228.304) * (-1230.318) (-1228.148) [-1229.445] (-1226.937) -- 0:00:28
543000 -- (-1228.438) [-1231.012] (-1228.321) (-1230.212) * (-1227.766) (-1226.919) (-1227.028) [-1226.773] -- 0:00:28
543500 -- (-1227.559) (-1227.398) (-1228.190) [-1231.402] * (-1227.469) (-1228.974) [-1226.607] (-1227.221) -- 0:00:28
544000 -- [-1226.692] (-1227.675) (-1226.437) (-1229.738) * [-1227.887] (-1228.981) (-1230.321) (-1228.111) -- 0:00:28
544500 -- (-1228.508) (-1227.250) [-1230.432] (-1231.153) * (-1227.105) [-1227.851] (-1230.146) (-1231.277) -- 0:00:28
545000 -- (-1232.069) (-1230.127) [-1229.627] (-1231.554) * (-1226.930) [-1227.721] (-1228.631) (-1227.731) -- 0:00:29
Average standard deviation of split frequencies: 0.010056
545500 -- (-1232.693) (-1231.739) [-1228.437] (-1229.101) * [-1228.841] (-1229.441) (-1228.137) (-1232.062) -- 0:00:29
546000 -- (-1230.949) [-1229.290] (-1228.844) (-1227.681) * (-1228.560) (-1231.631) [-1226.814] (-1229.356) -- 0:00:29
546500 -- (-1226.286) [-1229.120] (-1227.698) (-1228.341) * (-1230.066) [-1230.229] (-1228.129) (-1228.033) -- 0:00:29
547000 -- (-1226.150) (-1228.643) [-1228.844] (-1229.226) * (-1228.942) [-1230.110] (-1226.785) (-1227.411) -- 0:00:28
547500 -- (-1228.557) [-1227.255] (-1228.104) (-1228.582) * (-1228.896) (-1227.523) (-1226.958) [-1227.325] -- 0:00:28
548000 -- (-1226.608) [-1227.212] (-1228.621) (-1232.057) * (-1227.686) (-1229.161) [-1227.754] (-1228.894) -- 0:00:28
548500 -- (-1227.803) [-1229.763] (-1227.432) (-1237.014) * [-1227.019] (-1226.653) (-1229.692) (-1227.921) -- 0:00:28
549000 -- (-1229.049) [-1228.549] (-1226.672) (-1229.655) * [-1227.315] (-1228.960) (-1227.812) (-1227.469) -- 0:00:28
549500 -- (-1230.846) (-1232.913) [-1229.124] (-1228.163) * (-1227.458) [-1229.338] (-1227.108) (-1227.707) -- 0:00:28
550000 -- (-1229.988) (-1227.127) (-1227.649) [-1228.617] * (-1227.034) (-1229.744) (-1228.139) [-1228.082] -- 0:00:28
Average standard deviation of split frequencies: 0.010754
550500 -- (-1230.407) (-1227.545) (-1227.969) [-1226.125] * (-1227.379) (-1235.293) (-1226.789) [-1228.330] -- 0:00:28
551000 -- (-1227.572) [-1228.026] (-1227.245) (-1228.814) * [-1228.476] (-1232.765) (-1229.492) (-1227.629) -- 0:00:28
551500 -- (-1227.966) (-1226.560) [-1228.540] (-1227.683) * (-1228.952) (-1227.692) [-1232.675] (-1226.785) -- 0:00:28
552000 -- (-1228.355) (-1226.941) [-1228.662] (-1227.581) * [-1228.745] (-1227.568) (-1236.268) (-1227.717) -- 0:00:28
552500 -- (-1228.760) (-1231.404) (-1229.297) [-1227.581] * (-1232.548) (-1231.429) [-1226.572] (-1227.619) -- 0:00:28
553000 -- (-1227.530) (-1232.784) (-1229.566) [-1227.222] * (-1229.625) [-1229.297] (-1229.795) (-1229.416) -- 0:00:28
553500 -- (-1231.528) [-1230.940] (-1229.154) (-1228.913) * (-1229.319) [-1227.969] (-1230.487) (-1227.585) -- 0:00:28
554000 -- (-1229.727) [-1230.569] (-1231.682) (-1228.046) * [-1229.196] (-1229.533) (-1231.619) (-1227.672) -- 0:00:28
554500 -- (-1230.214) (-1226.991) [-1229.576] (-1235.431) * (-1232.387) (-1228.732) (-1230.252) [-1228.446] -- 0:00:28
555000 -- [-1230.816] (-1232.199) (-1227.310) (-1228.614) * (-1226.548) [-1229.933] (-1228.571) (-1227.915) -- 0:00:28
Average standard deviation of split frequencies: 0.010068
555500 -- (-1229.862) (-1226.669) (-1228.122) [-1228.502] * [-1226.101] (-1228.882) (-1230.501) (-1230.038) -- 0:00:28
556000 -- [-1228.805] (-1228.080) (-1229.495) (-1228.349) * (-1226.885) (-1227.032) (-1227.879) [-1229.390] -- 0:00:27
556500 -- [-1229.102] (-1227.818) (-1226.389) (-1226.978) * [-1226.983] (-1235.472) (-1226.833) (-1227.728) -- 0:00:27
557000 -- (-1226.853) [-1226.935] (-1226.990) (-1228.131) * (-1231.016) (-1227.454) (-1230.485) [-1231.137] -- 0:00:27
557500 -- (-1227.936) [-1227.857] (-1229.934) (-1226.461) * [-1229.582] (-1227.516) (-1227.405) (-1229.685) -- 0:00:27
558000 -- (-1228.120) (-1229.894) [-1234.549] (-1229.263) * (-1228.688) (-1226.484) [-1227.517] (-1226.863) -- 0:00:27
558500 -- (-1230.128) (-1231.312) (-1231.316) [-1228.512] * [-1228.222] (-1227.845) (-1226.817) (-1227.773) -- 0:00:27
559000 -- [-1227.703] (-1230.471) (-1230.710) (-1229.144) * (-1228.066) (-1227.018) [-1227.561] (-1229.559) -- 0:00:27
559500 -- [-1227.799] (-1232.898) (-1227.196) (-1234.317) * (-1227.496) (-1230.511) (-1228.824) [-1227.063] -- 0:00:27
560000 -- (-1229.473) [-1229.086] (-1227.064) (-1228.127) * (-1228.926) (-1230.537) [-1228.710] (-1230.384) -- 0:00:27
Average standard deviation of split frequencies: 0.010090
560500 -- (-1231.397) (-1230.479) [-1230.520] (-1228.012) * (-1231.196) (-1227.629) (-1229.387) [-1227.329] -- 0:00:27
561000 -- [-1227.542] (-1230.052) (-1229.207) (-1228.920) * [-1228.698] (-1228.083) (-1227.566) (-1228.379) -- 0:00:28
561500 -- (-1228.316) [-1226.664] (-1229.563) (-1230.407) * (-1229.759) [-1229.335] (-1228.741) (-1227.283) -- 0:00:28
562000 -- (-1227.763) (-1228.153) [-1227.954] (-1229.247) * (-1229.090) [-1227.882] (-1227.685) (-1227.675) -- 0:00:28
562500 -- (-1228.333) (-1228.231) (-1232.120) [-1226.286] * (-1230.701) [-1235.124] (-1228.907) (-1229.789) -- 0:00:28
563000 -- [-1231.082] (-1228.461) (-1227.032) (-1228.549) * [-1228.551] (-1235.290) (-1227.803) (-1232.644) -- 0:00:27
563500 -- [-1226.976] (-1228.699) (-1226.634) (-1227.952) * (-1229.324) (-1228.739) [-1227.500] (-1231.319) -- 0:00:27
564000 -- (-1228.688) (-1227.834) (-1227.350) [-1227.936] * (-1230.425) (-1228.269) [-1230.350] (-1231.847) -- 0:00:27
564500 -- (-1229.887) [-1228.162] (-1228.922) (-1229.097) * (-1228.407) [-1228.571] (-1227.876) (-1226.950) -- 0:00:27
565000 -- (-1229.063) (-1230.576) [-1228.367] (-1229.732) * (-1228.941) (-1228.561) (-1227.958) [-1228.996] -- 0:00:27
Average standard deviation of split frequencies: 0.009942
565500 -- (-1226.934) (-1227.412) [-1228.233] (-1227.910) * (-1230.605) (-1228.189) (-1227.617) [-1226.730] -- 0:00:27
566000 -- (-1228.291) (-1227.925) (-1231.388) [-1228.237] * (-1233.011) [-1227.714] (-1228.966) (-1229.583) -- 0:00:27
566500 -- (-1230.155) [-1226.624] (-1227.565) (-1228.631) * (-1227.683) (-1228.221) [-1231.782] (-1233.781) -- 0:00:27
567000 -- [-1227.844] (-1229.711) (-1227.823) (-1228.721) * [-1227.616] (-1227.240) (-1227.011) (-1229.741) -- 0:00:27
567500 -- [-1228.753] (-1229.858) (-1229.161) (-1229.257) * (-1231.117) (-1227.522) [-1229.498] (-1229.401) -- 0:00:27
568000 -- (-1228.381) (-1226.718) (-1227.968) [-1228.827] * (-1229.790) [-1229.045] (-1227.070) (-1228.806) -- 0:00:27
568500 -- (-1226.213) [-1226.948] (-1237.902) (-1228.181) * (-1226.911) (-1232.663) (-1228.536) [-1226.547] -- 0:00:27
569000 -- (-1227.556) (-1227.212) (-1232.795) [-1228.639] * [-1227.171] (-1232.547) (-1228.425) (-1231.117) -- 0:00:27
569500 -- (-1226.931) [-1228.492] (-1228.716) (-1227.228) * [-1227.650] (-1228.991) (-1230.117) (-1227.764) -- 0:00:27
570000 -- (-1229.776) (-1228.725) [-1227.513] (-1226.626) * [-1227.703] (-1226.857) (-1230.532) (-1228.006) -- 0:00:27
Average standard deviation of split frequencies: 0.009448
570500 -- (-1226.973) (-1226.876) (-1230.628) [-1226.926] * [-1227.530] (-1228.224) (-1227.105) (-1229.630) -- 0:00:27
571000 -- [-1228.231] (-1227.965) (-1228.446) (-1228.496) * (-1229.906) [-1231.184] (-1232.028) (-1229.740) -- 0:00:27
571500 -- [-1230.146] (-1227.619) (-1227.921) (-1227.197) * (-1227.207) (-1230.417) (-1228.820) [-1228.110] -- 0:00:26
572000 -- [-1226.397] (-1230.227) (-1227.148) (-1227.932) * (-1231.290) (-1227.071) (-1227.452) [-1227.389] -- 0:00:26
572500 -- (-1228.303) (-1228.058) (-1228.725) [-1231.009] * [-1226.589] (-1227.430) (-1230.844) (-1227.674) -- 0:00:26
573000 -- (-1229.860) (-1228.430) (-1228.742) [-1230.535] * (-1226.514) (-1227.954) [-1229.091] (-1226.448) -- 0:00:26
573500 -- (-1228.126) (-1228.013) (-1226.745) [-1228.681] * (-1226.827) (-1227.450) [-1229.232] (-1228.909) -- 0:00:26
574000 -- (-1227.557) [-1230.590] (-1226.950) (-1229.695) * (-1233.900) [-1228.347] (-1230.190) (-1228.238) -- 0:00:26
574500 -- (-1226.740) [-1228.593] (-1229.542) (-1229.120) * (-1229.730) (-1234.550) [-1228.649] (-1230.855) -- 0:00:26
575000 -- (-1228.597) [-1229.913] (-1228.441) (-1228.886) * (-1227.323) (-1232.518) (-1227.657) [-1227.980] -- 0:00:26
Average standard deviation of split frequencies: 0.009565
575500 -- (-1228.561) (-1227.586) (-1228.016) [-1228.424] * (-1228.938) [-1226.065] (-1226.864) (-1226.677) -- 0:00:26
576000 -- (-1229.997) (-1230.542) [-1227.014] (-1227.771) * (-1227.373) (-1228.253) (-1227.390) [-1228.200] -- 0:00:26
576500 -- (-1229.557) [-1229.434] (-1226.476) (-1229.663) * [-1227.467] (-1228.224) (-1231.654) (-1226.677) -- 0:00:26
577000 -- (-1229.075) (-1229.115) [-1226.345] (-1229.789) * (-1228.336) (-1229.920) (-1230.034) [-1228.993] -- 0:00:27
577500 -- (-1230.903) [-1230.776] (-1226.270) (-1229.775) * (-1228.839) (-1226.808) [-1227.457] (-1226.786) -- 0:00:27
578000 -- (-1227.708) (-1227.831) (-1227.658) [-1226.526] * (-1227.816) (-1227.468) (-1230.012) [-1226.628] -- 0:00:27
578500 -- (-1227.919) (-1231.660) (-1227.323) [-1227.469] * (-1229.989) (-1228.142) (-1230.379) [-1229.373] -- 0:00:26
579000 -- (-1227.421) (-1230.720) (-1227.333) [-1226.775] * (-1227.022) (-1232.272) (-1226.631) [-1228.156] -- 0:00:26
579500 -- (-1232.630) (-1229.236) (-1229.120) [-1228.039] * [-1227.655] (-1230.491) (-1228.909) (-1229.875) -- 0:00:26
580000 -- (-1226.721) (-1228.227) (-1228.189) [-1227.556] * (-1233.337) [-1229.762] (-1228.537) (-1227.679) -- 0:00:26
Average standard deviation of split frequencies: 0.009184
580500 -- (-1227.647) (-1229.890) [-1226.260] (-1228.606) * [-1230.056] (-1230.106) (-1230.250) (-1228.018) -- 0:00:26
581000 -- (-1229.584) (-1229.814) [-1226.636] (-1226.698) * (-1229.343) (-1228.824) (-1230.428) [-1229.560] -- 0:00:26
581500 -- (-1228.634) [-1228.040] (-1227.521) (-1227.021) * (-1228.264) (-1228.238) [-1226.898] (-1228.288) -- 0:00:26
582000 -- [-1226.859] (-1228.593) (-1227.509) (-1228.662) * (-1227.422) [-1229.928] (-1228.558) (-1228.200) -- 0:00:26
582500 -- (-1227.413) [-1227.178] (-1228.520) (-1228.144) * (-1228.006) (-1227.861) [-1231.098] (-1234.900) -- 0:00:26
583000 -- [-1227.515] (-1228.296) (-1230.070) (-1227.836) * [-1228.599] (-1229.503) (-1227.399) (-1229.706) -- 0:00:26
583500 -- [-1228.390] (-1228.632) (-1228.643) (-1228.531) * [-1227.326] (-1228.464) (-1227.248) (-1227.354) -- 0:00:26
584000 -- (-1231.463) [-1226.972] (-1227.271) (-1228.539) * (-1229.242) [-1227.607] (-1228.132) (-1230.641) -- 0:00:26
584500 -- (-1232.543) (-1228.435) (-1226.865) [-1230.582] * (-1232.832) [-1230.379] (-1228.656) (-1227.765) -- 0:00:26
585000 -- (-1230.977) [-1228.973] (-1226.308) (-1228.203) * (-1233.581) [-1228.280] (-1231.780) (-1228.146) -- 0:00:26
Average standard deviation of split frequencies: 0.009000
585500 -- (-1227.671) [-1228.395] (-1229.256) (-1231.591) * [-1230.076] (-1230.941) (-1229.378) (-1227.856) -- 0:00:26
586000 -- (-1229.485) (-1228.935) [-1227.529] (-1230.039) * (-1227.577) (-1229.629) (-1227.728) [-1228.110] -- 0:00:26
586500 -- (-1229.581) [-1227.934] (-1226.949) (-1229.438) * (-1228.169) (-1232.572) (-1232.593) [-1228.223] -- 0:00:26
587000 -- (-1227.480) (-1226.631) [-1226.259] (-1227.073) * [-1226.620] (-1228.959) (-1227.403) (-1228.412) -- 0:00:26
587500 -- (-1226.484) [-1226.042] (-1234.665) (-1226.242) * [-1228.401] (-1229.521) (-1227.082) (-1228.148) -- 0:00:25
588000 -- (-1232.303) (-1226.047) [-1228.514] (-1226.357) * (-1232.169) [-1229.953] (-1227.406) (-1227.884) -- 0:00:25
588500 -- (-1231.615) (-1226.968) [-1227.857] (-1230.689) * [-1228.867] (-1227.495) (-1229.256) (-1228.577) -- 0:00:25
589000 -- (-1230.127) [-1227.366] (-1228.176) (-1232.022) * (-1227.563) (-1232.037) (-1232.204) [-1227.168] -- 0:00:25
589500 -- (-1229.999) (-1226.453) [-1227.980] (-1228.966) * (-1226.737) [-1228.039] (-1229.645) (-1230.972) -- 0:00:25
590000 -- (-1231.940) [-1226.409] (-1228.534) (-1228.073) * (-1229.024) (-1229.922) [-1229.702] (-1227.744) -- 0:00:25
Average standard deviation of split frequencies: 0.009028
590500 -- (-1234.102) (-1226.661) (-1227.337) [-1227.949] * (-1226.985) [-1227.541] (-1230.421) (-1236.659) -- 0:00:25
591000 -- (-1227.575) [-1226.825] (-1232.975) (-1226.921) * (-1226.980) (-1230.093) (-1227.806) [-1228.973] -- 0:00:25
591500 -- (-1229.279) [-1234.941] (-1227.045) (-1230.036) * (-1231.386) (-1232.455) (-1227.549) [-1230.696] -- 0:00:25
592000 -- [-1228.808] (-1231.811) (-1229.898) (-1230.821) * [-1232.544] (-1231.970) (-1227.221) (-1229.583) -- 0:00:25
592500 -- (-1226.774) [-1228.917] (-1235.510) (-1230.142) * [-1231.274] (-1230.599) (-1230.104) (-1227.425) -- 0:00:25
593000 -- (-1226.606) (-1228.142) (-1229.304) [-1229.240] * (-1228.882) (-1227.377) (-1228.217) [-1228.341] -- 0:00:26
593500 -- [-1227.292] (-1227.462) (-1228.901) (-1229.358) * (-1227.113) (-1228.274) (-1227.610) [-1230.689] -- 0:00:26
594000 -- (-1227.064) (-1226.917) [-1228.069] (-1228.798) * (-1227.084) [-1229.373] (-1227.392) (-1229.737) -- 0:00:25
594500 -- (-1227.169) (-1226.557) [-1229.397] (-1226.823) * (-1227.803) (-1230.129) (-1226.920) [-1229.512] -- 0:00:25
595000 -- (-1232.720) (-1226.424) (-1230.815) [-1227.563] * [-1227.399] (-1230.796) (-1228.157) (-1227.201) -- 0:00:25
Average standard deviation of split frequencies: 0.008997
595500 -- (-1228.852) (-1226.613) (-1230.524) [-1227.871] * [-1228.894] (-1228.395) (-1232.592) (-1231.283) -- 0:00:25
596000 -- (-1229.221) [-1227.433] (-1232.163) (-1226.617) * (-1228.572) [-1229.318] (-1229.597) (-1228.103) -- 0:00:25
596500 -- (-1227.487) (-1226.837) [-1227.277] (-1230.703) * [-1228.537] (-1229.804) (-1228.970) (-1231.609) -- 0:00:25
597000 -- (-1228.089) (-1233.271) (-1229.944) [-1228.112] * (-1228.897) [-1228.418] (-1227.366) (-1229.134) -- 0:00:25
597500 -- (-1226.930) [-1227.349] (-1227.523) (-1228.003) * (-1227.123) (-1227.924) [-1227.175] (-1228.744) -- 0:00:25
598000 -- (-1231.892) (-1228.664) [-1229.352] (-1228.967) * (-1228.043) (-1227.164) [-1227.082] (-1228.987) -- 0:00:25
598500 -- (-1228.157) (-1227.904) (-1232.181) [-1229.959] * (-1228.305) (-1230.066) (-1227.518) [-1230.211] -- 0:00:25
599000 -- (-1228.364) (-1226.723) (-1230.867) [-1228.719] * [-1228.888] (-1227.983) (-1228.929) (-1234.048) -- 0:00:25
599500 -- (-1228.736) (-1228.704) (-1232.343) [-1228.650] * (-1228.200) (-1226.819) [-1226.494] (-1228.523) -- 0:00:25
600000 -- (-1229.181) (-1227.568) (-1234.129) [-1227.745] * (-1228.820) (-1227.140) [-1227.605] (-1229.134) -- 0:00:25
Average standard deviation of split frequencies: 0.010006
600500 -- (-1229.392) (-1229.842) [-1229.079] (-1227.963) * (-1227.723) (-1230.297) (-1229.708) [-1229.002] -- 0:00:25
601000 -- (-1230.895) (-1230.962) [-1227.397] (-1231.866) * (-1226.802) (-1231.397) [-1228.805] (-1229.294) -- 0:00:25
601500 -- (-1228.833) [-1231.714] (-1227.015) (-1229.745) * [-1227.676] (-1235.866) (-1229.668) (-1226.986) -- 0:00:25
602000 -- [-1230.599] (-1229.762) (-1229.921) (-1228.679) * (-1231.622) [-1227.686] (-1233.122) (-1229.212) -- 0:00:25
602500 -- (-1228.322) (-1229.893) [-1228.543] (-1232.496) * [-1229.039] (-1229.892) (-1237.865) (-1233.625) -- 0:00:25
603000 -- (-1228.076) [-1228.151] (-1231.081) (-1236.634) * [-1228.382] (-1230.038) (-1233.549) (-1229.030) -- 0:00:25
603500 -- (-1228.760) (-1229.960) [-1227.096] (-1233.429) * (-1229.291) (-1228.189) [-1233.260] (-1228.842) -- 0:00:24
604000 -- (-1229.460) (-1229.142) (-1227.018) [-1226.256] * (-1227.551) [-1231.327] (-1228.224) (-1231.291) -- 0:00:24
604500 -- (-1229.967) (-1228.730) (-1226.496) [-1227.214] * (-1229.998) [-1231.656] (-1227.927) (-1227.634) -- 0:00:24
605000 -- (-1230.422) (-1228.845) [-1227.082] (-1227.694) * (-1228.503) (-1230.057) [-1226.581] (-1227.959) -- 0:00:24
Average standard deviation of split frequencies: 0.009967
605500 -- (-1231.144) (-1232.296) (-1228.584) [-1226.946] * (-1232.124) (-1233.759) [-1228.927] (-1234.022) -- 0:00:24
606000 -- (-1230.101) (-1228.656) (-1228.577) [-1229.905] * [-1229.170] (-1229.780) (-1228.630) (-1228.286) -- 0:00:24
606500 -- (-1231.464) [-1229.448] (-1226.665) (-1226.849) * (-1227.142) (-1234.587) [-1229.274] (-1226.659) -- 0:00:24
607000 -- (-1227.716) (-1230.116) (-1228.581) [-1227.811] * [-1229.749] (-1235.174) (-1232.537) (-1228.642) -- 0:00:24
607500 -- (-1230.074) [-1229.184] (-1228.757) (-1226.901) * (-1227.737) (-1234.400) [-1228.289] (-1228.133) -- 0:00:24
608000 -- (-1231.057) (-1228.900) [-1227.241] (-1226.295) * (-1227.847) (-1228.980) [-1226.651] (-1227.446) -- 0:00:24
608500 -- (-1228.567) (-1229.929) [-1228.807] (-1226.944) * (-1227.256) (-1228.375) [-1226.617] (-1228.750) -- 0:00:24
609000 -- (-1228.633) [-1230.273] (-1232.247) (-1226.875) * (-1228.915) (-1226.538) [-1228.413] (-1231.618) -- 0:00:25
609500 -- (-1228.976) (-1227.435) (-1231.897) [-1228.263] * [-1226.509] (-1232.515) (-1227.539) (-1232.154) -- 0:00:24
610000 -- (-1228.042) [-1228.228] (-1230.098) (-1226.542) * [-1227.716] (-1230.478) (-1231.933) (-1229.953) -- 0:00:24
Average standard deviation of split frequencies: 0.009746
610500 -- [-1228.263] (-1229.196) (-1226.544) (-1229.516) * (-1228.916) [-1230.981] (-1230.756) (-1229.564) -- 0:00:24
611000 -- (-1227.646) (-1232.219) (-1226.983) [-1226.810] * (-1229.812) (-1231.533) [-1229.276] (-1228.866) -- 0:00:24
611500 -- (-1229.195) [-1227.455] (-1230.201) (-1228.324) * (-1228.555) (-1226.676) (-1228.783) [-1227.146] -- 0:00:24
612000 -- (-1227.398) (-1229.386) [-1227.794] (-1228.134) * [-1227.245] (-1229.389) (-1230.017) (-1229.395) -- 0:00:24
612500 -- (-1229.715) (-1227.966) (-1229.251) [-1228.114] * (-1228.171) (-1228.390) [-1229.274] (-1229.449) -- 0:00:24
613000 -- (-1228.725) (-1228.143) (-1226.924) [-1229.222] * (-1229.832) [-1228.626] (-1228.179) (-1226.221) -- 0:00:24
613500 -- (-1228.668) (-1228.638) (-1228.413) [-1227.874] * (-1226.890) [-1227.009] (-1228.654) (-1226.255) -- 0:00:24
614000 -- [-1227.918] (-1227.820) (-1231.353) (-1228.681) * (-1229.279) (-1227.346) (-1227.491) [-1226.578] -- 0:00:24
614500 -- (-1231.609) [-1227.512] (-1230.301) (-1226.509) * (-1227.567) (-1227.474) [-1227.193] (-1227.865) -- 0:00:24
615000 -- (-1230.642) [-1230.938] (-1233.329) (-1227.004) * (-1227.771) (-1226.300) (-1230.556) [-1230.251] -- 0:00:24
Average standard deviation of split frequencies: 0.009661
615500 -- (-1231.318) (-1228.521) [-1232.101] (-1226.868) * (-1226.928) [-1228.386] (-1227.708) (-1232.158) -- 0:00:24
616000 -- (-1228.244) (-1231.097) (-1227.949) [-1231.298] * (-1228.855) (-1227.302) [-1228.765] (-1227.143) -- 0:00:24
616500 -- (-1228.494) (-1227.296) (-1228.031) [-1231.751] * (-1231.244) (-1229.639) [-1229.157] (-1228.436) -- 0:00:24
617000 -- (-1229.649) (-1227.192) (-1228.746) [-1230.027] * (-1228.226) [-1227.597] (-1231.397) (-1230.168) -- 0:00:24
617500 -- [-1232.879] (-1226.667) (-1227.575) (-1229.004) * (-1228.745) (-1232.779) (-1232.444) [-1228.088] -- 0:00:24
618000 -- (-1228.333) (-1229.063) (-1228.828) [-1229.251] * (-1228.764) [-1227.564] (-1229.145) (-1228.436) -- 0:00:24
618500 -- (-1228.861) (-1228.980) (-1230.007) [-1227.706] * (-1231.260) [-1230.900] (-1228.572) (-1229.461) -- 0:00:24
619000 -- (-1227.239) [-1229.459] (-1229.711) (-1227.954) * (-1230.926) (-1230.854) (-1227.186) [-1230.769] -- 0:00:24
619500 -- (-1228.081) (-1227.047) (-1226.313) [-1229.636] * (-1230.665) (-1226.689) [-1227.538] (-1228.194) -- 0:00:23
620000 -- (-1227.902) (-1228.204) [-1227.549] (-1227.909) * (-1226.161) (-1228.915) (-1229.065) [-1228.034] -- 0:00:23
Average standard deviation of split frequencies: 0.010228
620500 -- (-1226.999) (-1228.000) [-1230.008] (-1229.280) * (-1227.676) (-1228.326) [-1229.033] (-1228.487) -- 0:00:23
621000 -- (-1228.863) (-1229.741) (-1227.171) [-1228.925] * (-1228.388) (-1230.164) [-1229.892] (-1229.248) -- 0:00:23
621500 -- [-1227.479] (-1229.660) (-1228.075) (-1232.068) * (-1238.255) (-1231.260) (-1230.621) [-1228.704] -- 0:00:23
622000 -- (-1228.066) (-1228.608) (-1227.846) [-1226.554] * (-1230.803) [-1226.880] (-1229.163) (-1229.409) -- 0:00:23
622500 -- (-1227.393) (-1228.103) [-1226.860] (-1226.592) * (-1227.578) (-1229.867) [-1226.834] (-1228.039) -- 0:00:23
623000 -- [-1229.312] (-1228.787) (-1230.015) (-1228.062) * [-1229.861] (-1228.137) (-1227.291) (-1229.465) -- 0:00:23
623500 -- (-1228.086) [-1227.536] (-1230.227) (-1231.613) * [-1230.207] (-1227.285) (-1227.979) (-1229.627) -- 0:00:23
624000 -- (-1227.145) [-1229.049] (-1230.774) (-1229.431) * (-1226.625) [-1228.426] (-1230.558) (-1228.608) -- 0:00:23
624500 -- (-1227.625) (-1230.799) (-1228.168) [-1227.499] * (-1226.673) [-1228.691] (-1230.378) (-1229.479) -- 0:00:23
625000 -- (-1229.845) (-1227.974) [-1227.094] (-1228.549) * (-1226.900) [-1226.571] (-1227.883) (-1228.588) -- 0:00:23
Average standard deviation of split frequencies: 0.010448
625500 -- (-1230.799) [-1231.146] (-1228.818) (-1226.783) * (-1228.153) (-1229.733) (-1229.075) [-1228.172] -- 0:00:23
626000 -- (-1231.327) [-1229.695] (-1227.423) (-1226.732) * (-1228.544) [-1229.589] (-1228.820) (-1226.856) -- 0:00:23
626500 -- (-1227.741) (-1226.587) [-1229.390] (-1226.643) * [-1227.018] (-1227.370) (-1231.252) (-1226.421) -- 0:00:23
627000 -- [-1227.199] (-1228.146) (-1228.391) (-1227.084) * (-1231.753) (-1228.249) (-1227.770) [-1227.405] -- 0:00:23
627500 -- (-1231.870) [-1229.345] (-1227.662) (-1229.755) * [-1226.844] (-1228.527) (-1231.817) (-1228.406) -- 0:00:23
628000 -- [-1229.120] (-1228.155) (-1227.189) (-1228.491) * (-1226.413) [-1227.411] (-1231.364) (-1229.038) -- 0:00:23
628500 -- (-1228.710) (-1230.464) [-1227.164] (-1227.239) * (-1229.029) (-1229.168) (-1227.041) [-1229.014] -- 0:00:23
629000 -- (-1232.620) (-1227.723) (-1227.205) [-1227.400] * (-1228.099) (-1228.196) [-1230.476] (-1228.928) -- 0:00:23
629500 -- [-1231.580] (-1230.854) (-1231.809) (-1228.258) * (-1228.555) [-1227.621] (-1229.987) (-1229.061) -- 0:00:23
630000 -- (-1228.427) (-1230.910) (-1231.383) [-1227.754] * (-1228.518) [-1228.376] (-1233.984) (-1230.653) -- 0:00:23
Average standard deviation of split frequencies: 0.010465
630500 -- (-1227.339) [-1228.176] (-1231.548) (-1226.523) * [-1226.935] (-1226.182) (-1230.300) (-1227.449) -- 0:00:23
631000 -- (-1228.457) [-1228.314] (-1228.753) (-1233.003) * (-1227.035) (-1226.182) (-1228.485) [-1229.077] -- 0:00:23
631500 -- (-1226.560) (-1228.428) [-1227.176] (-1228.242) * (-1228.098) (-1226.409) [-1228.186] (-1226.972) -- 0:00:23
632000 -- (-1227.856) (-1229.731) [-1227.501] (-1227.786) * (-1230.686) [-1228.184] (-1229.937) (-1227.213) -- 0:00:23
632500 -- (-1229.165) (-1227.658) [-1227.875] (-1227.569) * [-1226.986] (-1226.556) (-1228.555) (-1226.300) -- 0:00:23
633000 -- (-1228.473) [-1228.791] (-1229.106) (-1230.630) * (-1226.099) (-1226.705) (-1228.193) [-1227.213] -- 0:00:23
633500 -- [-1226.879] (-1228.568) (-1227.057) (-1230.442) * (-1232.855) [-1229.568] (-1226.816) (-1230.078) -- 0:00:23
634000 -- (-1228.075) (-1226.526) (-1228.300) [-1226.963] * [-1230.822] (-1228.820) (-1227.674) (-1229.578) -- 0:00:23
634500 -- (-1228.304) (-1226.613) [-1227.518] (-1226.971) * (-1232.570) (-1228.494) (-1228.105) [-1228.709] -- 0:00:23
635000 -- [-1230.533] (-1228.244) (-1230.035) (-1227.812) * [-1229.361] (-1230.829) (-1227.122) (-1227.805) -- 0:00:22
Average standard deviation of split frequencies: 0.010229
635500 -- (-1232.112) [-1228.387] (-1229.781) (-1229.692) * (-1229.023) (-1228.863) (-1226.909) [-1228.361] -- 0:00:22
636000 -- (-1227.212) (-1229.332) [-1230.010] (-1231.308) * (-1231.553) [-1228.022] (-1227.358) (-1228.232) -- 0:00:22
636500 -- [-1226.237] (-1228.484) (-1234.353) (-1228.551) * (-1229.815) [-1227.017] (-1228.947) (-1228.529) -- 0:00:22
637000 -- (-1226.445) [-1229.542] (-1228.691) (-1228.249) * [-1229.332] (-1227.066) (-1230.127) (-1228.537) -- 0:00:22
637500 -- (-1226.829) [-1228.592] (-1227.495) (-1227.263) * (-1229.215) (-1227.873) (-1226.830) [-1230.622] -- 0:00:22
638000 -- [-1229.764] (-1228.534) (-1228.683) (-1227.279) * (-1226.792) (-1228.415) (-1227.545) [-1227.857] -- 0:00:22
638500 -- (-1230.475) (-1228.606) [-1228.414] (-1227.701) * (-1227.631) [-1230.771] (-1227.995) (-1226.472) -- 0:00:22
639000 -- [-1231.690] (-1229.102) (-1231.474) (-1227.877) * [-1228.912] (-1229.785) (-1226.779) (-1226.472) -- 0:00:22
639500 -- (-1228.282) (-1229.144) (-1228.291) [-1227.736] * [-1230.014] (-1227.214) (-1228.774) (-1226.744) -- 0:00:22
640000 -- (-1230.559) [-1229.237] (-1227.236) (-1228.525) * [-1229.867] (-1230.306) (-1227.787) (-1228.647) -- 0:00:22
Average standard deviation of split frequencies: 0.010056
640500 -- [-1227.783] (-1227.671) (-1227.770) (-1230.181) * (-1228.868) (-1227.870) (-1228.402) [-1228.477] -- 0:00:22
641000 -- (-1228.157) (-1228.532) (-1228.000) [-1228.522] * [-1232.557] (-1231.038) (-1231.954) (-1229.723) -- 0:00:22
641500 -- (-1232.100) [-1227.629] (-1227.511) (-1228.107) * [-1233.148] (-1226.971) (-1229.726) (-1230.411) -- 0:00:22
642000 -- [-1228.124] (-1228.269) (-1227.948) (-1228.011) * (-1230.587) (-1226.676) (-1226.867) [-1228.977] -- 0:00:22
642500 -- [-1229.558] (-1231.107) (-1229.774) (-1227.421) * (-1228.838) (-1228.336) [-1228.304] (-1229.866) -- 0:00:22
643000 -- (-1229.666) (-1229.254) (-1228.928) [-1227.372] * (-1228.378) (-1232.877) [-1226.467] (-1229.271) -- 0:00:22
643500 -- [-1226.956] (-1230.242) (-1228.615) (-1228.451) * (-1227.792) (-1230.906) [-1226.389] (-1230.083) -- 0:00:22
644000 -- (-1227.158) (-1227.862) (-1230.368) [-1227.905] * (-1228.567) [-1228.904] (-1228.672) (-1228.991) -- 0:00:22
644500 -- (-1227.050) (-1227.336) [-1232.822] (-1230.480) * (-1228.451) [-1229.096] (-1227.526) (-1227.315) -- 0:00:22
645000 -- (-1227.089) (-1228.377) [-1228.699] (-1231.413) * (-1230.383) [-1230.785] (-1227.639) (-1226.376) -- 0:00:22
Average standard deviation of split frequencies: 0.010079
645500 -- [-1226.583] (-1227.583) (-1228.715) (-1227.744) * [-1229.272] (-1230.047) (-1229.445) (-1226.669) -- 0:00:22
646000 -- (-1227.560) (-1227.528) (-1228.162) [-1227.814] * (-1230.287) [-1229.450] (-1227.300) (-1232.184) -- 0:00:22
646500 -- [-1228.345] (-1227.461) (-1227.212) (-1227.604) * (-1227.682) (-1231.131) [-1229.607] (-1234.238) -- 0:00:22
647000 -- (-1231.316) (-1228.079) [-1229.004] (-1233.562) * [-1227.488] (-1227.429) (-1230.081) (-1235.565) -- 0:00:22
647500 -- [-1229.497] (-1227.627) (-1229.309) (-1228.654) * [-1229.182] (-1233.894) (-1227.414) (-1227.651) -- 0:00:22
648000 -- (-1229.207) [-1227.570] (-1227.148) (-1228.479) * (-1229.234) (-1235.452) (-1229.764) [-1227.268] -- 0:00:22
648500 -- (-1229.439) [-1229.390] (-1230.794) (-1230.697) * (-1227.289) (-1227.891) (-1228.246) [-1228.442] -- 0:00:22
649000 -- [-1227.480] (-1229.437) (-1227.427) (-1230.482) * (-1229.797) (-1226.980) [-1230.294] (-1229.841) -- 0:00:22
649500 -- (-1229.369) (-1229.333) (-1228.685) [-1230.994] * (-1227.111) [-1228.585] (-1233.346) (-1228.506) -- 0:00:22
650000 -- (-1229.983) (-1229.772) [-1228.040] (-1229.866) * [-1226.668] (-1228.912) (-1230.837) (-1228.290) -- 0:00:22
Average standard deviation of split frequencies: 0.010324
650500 -- (-1232.947) [-1230.162] (-1226.936) (-1227.846) * (-1230.397) [-1229.681] (-1226.898) (-1227.139) -- 0:00:22
651000 -- (-1228.314) (-1233.602) [-1226.729] (-1227.606) * (-1229.091) (-1228.791) (-1227.880) [-1230.579] -- 0:00:21
651500 -- (-1229.868) (-1230.603) (-1226.577) [-1227.891] * (-1226.536) (-1228.258) (-1227.787) [-1227.685] -- 0:00:21
652000 -- (-1227.501) (-1230.651) (-1228.778) [-1227.679] * (-1226.491) (-1230.110) [-1226.363] (-1227.060) -- 0:00:21
652500 -- (-1230.217) (-1235.151) [-1228.572] (-1230.000) * (-1230.441) (-1228.937) [-1226.868] (-1230.412) -- 0:00:21
653000 -- (-1228.060) (-1228.296) [-1230.660] (-1228.988) * (-1232.454) (-1228.972) [-1227.058] (-1228.878) -- 0:00:21
653500 -- (-1227.316) (-1227.625) [-1233.412] (-1230.776) * (-1228.417) [-1227.067] (-1228.737) (-1228.211) -- 0:00:21
654000 -- (-1227.605) [-1228.182] (-1232.003) (-1231.398) * (-1228.459) [-1226.801] (-1226.449) (-1231.850) -- 0:00:21
654500 -- (-1226.159) (-1228.013) [-1231.656] (-1229.376) * [-1228.107] (-1226.305) (-1229.537) (-1226.726) -- 0:00:21
655000 -- [-1228.245] (-1228.572) (-1229.420) (-1232.984) * (-1227.787) (-1235.328) [-1231.955] (-1233.125) -- 0:00:21
Average standard deviation of split frequencies: 0.010348
655500 -- [-1228.687] (-1228.846) (-1227.845) (-1230.101) * (-1228.650) (-1227.801) (-1231.090) [-1229.166] -- 0:00:21
656000 -- (-1227.774) (-1227.540) (-1228.592) [-1228.119] * (-1228.579) (-1228.753) (-1227.814) [-1226.436] -- 0:00:21
656500 -- (-1230.621) [-1229.676] (-1229.140) (-1227.389) * [-1228.306] (-1230.247) (-1227.692) (-1231.879) -- 0:00:21
657000 -- (-1229.352) [-1230.206] (-1228.038) (-1226.903) * (-1228.218) [-1229.209] (-1228.575) (-1228.904) -- 0:00:21
657500 -- (-1227.469) [-1228.756] (-1228.264) (-1227.953) * (-1228.827) [-1227.653] (-1226.996) (-1230.414) -- 0:00:21
658000 -- (-1229.865) (-1229.404) [-1228.447] (-1227.309) * (-1229.848) (-1227.545) [-1227.461] (-1232.149) -- 0:00:21
658500 -- [-1229.064] (-1227.612) (-1228.680) (-1228.540) * (-1232.627) [-1227.173] (-1230.855) (-1227.223) -- 0:00:21
659000 -- (-1230.325) [-1228.651] (-1228.570) (-1230.039) * (-1229.148) (-1228.582) [-1229.845] (-1227.004) -- 0:00:21
659500 -- (-1231.744) [-1227.987] (-1228.864) (-1228.301) * (-1228.768) (-1233.139) [-1228.694] (-1227.536) -- 0:00:21
660000 -- (-1230.058) [-1226.982] (-1228.244) (-1229.061) * [-1226.510] (-1234.106) (-1228.327) (-1226.993) -- 0:00:21
Average standard deviation of split frequencies: 0.009894
660500 -- [-1229.610] (-1226.439) (-1227.522) (-1229.887) * [-1226.513] (-1227.485) (-1227.148) (-1231.451) -- 0:00:21
661000 -- [-1228.281] (-1227.883) (-1227.284) (-1231.649) * (-1226.885) [-1226.788] (-1227.168) (-1226.483) -- 0:00:21
661500 -- [-1228.025] (-1229.177) (-1231.739) (-1228.816) * (-1227.238) (-1227.115) [-1227.922] (-1228.418) -- 0:00:21
662000 -- (-1226.598) [-1228.077] (-1228.229) (-1227.084) * [-1228.767] (-1228.074) (-1229.144) (-1234.005) -- 0:00:21
662500 -- (-1232.742) (-1228.844) [-1227.475] (-1227.114) * (-1230.270) (-1228.506) [-1230.267] (-1231.917) -- 0:00:21
663000 -- (-1228.685) (-1227.996) (-1228.169) [-1227.395] * (-1228.933) [-1232.503] (-1227.546) (-1227.566) -- 0:00:21
663500 -- (-1229.797) (-1227.612) [-1227.805] (-1227.220) * (-1228.771) (-1228.556) [-1228.331] (-1227.033) -- 0:00:21
664000 -- (-1229.144) (-1226.836) [-1228.040] (-1226.549) * (-1227.482) (-1228.331) [-1231.176] (-1229.925) -- 0:00:21
664500 -- [-1228.724] (-1231.154) (-1228.138) (-1226.540) * (-1231.747) [-1228.772] (-1231.285) (-1230.792) -- 0:00:21
665000 -- (-1227.287) (-1229.163) (-1228.604) [-1226.881] * [-1228.291] (-1228.382) (-1230.446) (-1226.364) -- 0:00:21
Average standard deviation of split frequencies: 0.010664
665500 -- [-1229.764] (-1230.715) (-1231.763) (-1226.608) * (-1228.708) (-1228.222) [-1230.191] (-1229.582) -- 0:00:21
666000 -- (-1231.674) [-1231.729] (-1228.849) (-1228.333) * (-1230.990) [-1227.116] (-1227.430) (-1226.456) -- 0:00:21
666500 -- [-1227.841] (-1228.438) (-1226.624) (-1229.691) * [-1226.898] (-1227.600) (-1230.135) (-1227.125) -- 0:00:21
667000 -- (-1229.876) (-1229.630) (-1226.568) [-1226.934] * (-1230.949) (-1227.966) (-1231.623) [-1227.936] -- 0:00:20
667500 -- (-1229.952) (-1228.972) (-1227.949) [-1230.045] * (-1233.406) (-1228.011) (-1227.260) [-1226.826] -- 0:00:20
668000 -- (-1228.930) (-1227.969) (-1226.372) [-1226.715] * (-1228.594) (-1227.995) [-1227.620] (-1230.980) -- 0:00:20
668500 -- (-1229.581) [-1226.616] (-1230.732) (-1227.949) * (-1227.425) (-1227.729) [-1229.904] (-1228.793) -- 0:00:20
669000 -- (-1229.727) [-1232.090] (-1227.269) (-1228.300) * (-1230.261) (-1227.929) (-1228.988) [-1226.528] -- 0:00:20
669500 -- (-1231.094) [-1231.675] (-1227.605) (-1229.102) * (-1229.090) (-1227.242) (-1230.194) [-1226.936] -- 0:00:20
670000 -- (-1228.367) (-1230.024) (-1227.026) [-1231.324] * (-1229.568) (-1228.083) (-1227.498) [-1229.654] -- 0:00:20
Average standard deviation of split frequencies: 0.009840
670500 -- (-1231.193) [-1232.175] (-1228.224) (-1229.974) * (-1232.273) [-1226.750] (-1230.929) (-1229.148) -- 0:00:20
671000 -- (-1226.879) (-1229.699) (-1226.660) [-1228.126] * (-1228.844) [-1226.523] (-1228.374) (-1227.407) -- 0:00:20
671500 -- [-1227.612] (-1226.816) (-1234.284) (-1228.287) * [-1227.999] (-1230.432) (-1228.515) (-1228.057) -- 0:00:20
672000 -- [-1229.680] (-1227.945) (-1231.155) (-1228.908) * (-1227.341) (-1228.224) [-1228.684] (-1229.336) -- 0:00:20
672500 -- (-1232.687) (-1228.787) (-1233.191) [-1226.278] * (-1227.651) [-1227.289] (-1229.456) (-1227.296) -- 0:00:20
673000 -- (-1229.702) (-1228.040) (-1230.830) [-1228.545] * [-1231.582] (-1228.696) (-1228.746) (-1228.236) -- 0:00:20
673500 -- (-1230.489) (-1232.459) (-1228.473) [-1229.313] * (-1228.933) [-1227.448] (-1227.965) (-1227.718) -- 0:00:20
674000 -- [-1228.458] (-1231.357) (-1228.809) (-1229.119) * (-1226.356) (-1227.529) (-1228.962) [-1228.112] -- 0:00:20
674500 -- (-1230.073) (-1234.306) (-1229.498) [-1228.421] * (-1229.516) (-1228.952) (-1227.449) [-1228.053] -- 0:00:20
675000 -- (-1226.851) (-1229.374) (-1228.198) [-1227.663] * [-1229.624] (-1230.816) (-1228.703) (-1227.512) -- 0:00:20
Average standard deviation of split frequencies: 0.009856
675500 -- [-1226.248] (-1228.524) (-1228.387) (-1230.632) * (-1229.378) (-1230.644) (-1228.613) [-1226.983] -- 0:00:20
676000 -- (-1228.166) (-1230.967) [-1227.925] (-1227.404) * (-1232.083) (-1230.526) [-1228.101] (-1229.187) -- 0:00:20
676500 -- [-1228.189] (-1227.230) (-1228.422) (-1226.654) * (-1231.281) (-1230.613) [-1228.311] (-1229.496) -- 0:00:20
677000 -- (-1229.164) [-1229.781] (-1229.147) (-1227.009) * [-1229.664] (-1228.921) (-1226.330) (-1228.129) -- 0:00:20
677500 -- (-1231.827) (-1228.231) [-1226.655] (-1230.381) * (-1226.749) (-1229.830) [-1226.860] (-1227.559) -- 0:00:20
678000 -- (-1228.783) (-1229.852) [-1227.554] (-1229.569) * (-1229.972) (-1229.253) (-1226.952) [-1227.559] -- 0:00:20
678500 -- [-1228.658] (-1227.992) (-1229.729) (-1228.694) * [-1227.786] (-1228.152) (-1226.971) (-1228.054) -- 0:00:20
679000 -- [-1226.627] (-1229.385) (-1228.266) (-1228.794) * (-1227.235) (-1228.801) [-1226.742] (-1227.727) -- 0:00:20
679500 -- (-1227.870) (-1226.620) (-1226.711) [-1227.871] * [-1226.186] (-1227.702) (-1227.201) (-1231.732) -- 0:00:20
680000 -- (-1226.091) (-1226.925) (-1227.511) [-1228.305] * (-1228.884) (-1227.729) [-1228.412] (-1229.962) -- 0:00:20
Average standard deviation of split frequencies: 0.010019
680500 -- [-1226.770] (-1228.858) (-1229.993) (-1226.993) * [-1227.158] (-1226.905) (-1233.152) (-1229.087) -- 0:00:20
681000 -- (-1228.070) (-1230.026) [-1228.576] (-1226.961) * (-1227.985) (-1229.241) (-1230.307) [-1228.393] -- 0:00:20
681500 -- (-1229.255) (-1230.365) [-1228.133] (-1228.148) * (-1228.028) [-1228.155] (-1226.277) (-1227.883) -- 0:00:20
682000 -- [-1231.106] (-1232.116) (-1231.293) (-1227.301) * (-1227.217) (-1228.888) [-1227.312] (-1229.311) -- 0:00:20
682500 -- (-1227.277) (-1238.711) [-1229.237] (-1227.637) * (-1228.271) (-1227.645) [-1227.117] (-1228.281) -- 0:00:20
683000 -- [-1228.116] (-1234.047) (-1228.410) (-1227.021) * [-1229.866] (-1226.832) (-1227.418) (-1227.255) -- 0:00:19
683500 -- (-1227.607) (-1228.955) [-1230.055] (-1229.358) * (-1229.892) [-1227.918] (-1227.394) (-1237.478) -- 0:00:19
684000 -- (-1227.271) [-1229.586] (-1229.404) (-1229.279) * (-1230.559) [-1226.537] (-1227.759) (-1226.731) -- 0:00:19
684500 -- [-1228.188] (-1227.012) (-1229.142) (-1232.113) * (-1229.844) (-1227.602) (-1228.959) [-1227.452] -- 0:00:19
685000 -- [-1227.431] (-1230.550) (-1229.179) (-1226.913) * (-1229.990) [-1226.656] (-1227.673) (-1228.342) -- 0:00:19
Average standard deviation of split frequencies: 0.009804
685500 -- (-1226.809) (-1228.772) [-1227.202] (-1226.710) * (-1227.610) (-1228.703) (-1227.015) [-1228.274] -- 0:00:19
686000 -- (-1227.409) (-1227.167) (-1226.699) [-1228.102] * (-1230.278) (-1229.019) [-1226.841] (-1232.283) -- 0:00:19
686500 -- (-1227.416) (-1229.056) [-1229.309] (-1226.898) * (-1228.583) (-1228.891) (-1226.837) [-1230.396] -- 0:00:19
687000 -- (-1227.239) (-1229.537) [-1228.062] (-1228.202) * (-1227.594) (-1229.688) (-1228.157) [-1231.663] -- 0:00:19
687500 -- (-1227.774) (-1231.028) [-1227.238] (-1227.974) * (-1228.316) (-1230.929) (-1228.372) [-1228.811] -- 0:00:19
688000 -- (-1226.504) (-1228.403) [-1226.734] (-1232.447) * [-1230.018] (-1229.256) (-1229.040) (-1227.231) -- 0:00:19
688500 -- (-1228.368) (-1228.089) (-1229.837) [-1228.466] * (-1231.566) [-1226.384] (-1227.942) (-1228.833) -- 0:00:19
689000 -- (-1232.560) (-1232.749) (-1235.876) [-1227.454] * [-1229.748] (-1227.242) (-1227.406) (-1228.233) -- 0:00:19
689500 -- [-1228.130] (-1227.441) (-1227.989) (-1228.630) * (-1229.367) (-1235.184) [-1227.390] (-1231.857) -- 0:00:19
690000 -- (-1228.034) [-1228.874] (-1229.472) (-1228.099) * (-1230.989) (-1232.838) (-1229.421) [-1230.239] -- 0:00:19
Average standard deviation of split frequencies: 0.010056
690500 -- [-1229.894] (-1230.048) (-1228.080) (-1228.581) * (-1230.868) (-1227.138) [-1227.566] (-1228.799) -- 0:00:19
691000 -- (-1228.433) [-1228.006] (-1226.820) (-1229.931) * (-1229.524) [-1227.025] (-1230.017) (-1230.223) -- 0:00:19
691500 -- [-1229.347] (-1230.995) (-1228.524) (-1228.252) * (-1228.956) [-1228.062] (-1228.028) (-1229.991) -- 0:00:19
692000 -- (-1231.345) [-1228.353] (-1229.516) (-1227.442) * [-1228.234] (-1236.088) (-1228.685) (-1227.365) -- 0:00:19
692500 -- (-1232.046) (-1229.504) [-1228.788] (-1227.350) * (-1227.246) (-1227.160) [-1229.406] (-1229.143) -- 0:00:19
693000 -- (-1228.392) [-1228.367] (-1228.694) (-1227.448) * [-1227.527] (-1228.759) (-1229.767) (-1227.213) -- 0:00:19
693500 -- [-1227.146] (-1227.046) (-1226.866) (-1231.797) * (-1228.121) (-1228.098) (-1230.024) [-1229.172] -- 0:00:19
694000 -- (-1228.156) (-1226.628) [-1230.274] (-1228.577) * (-1232.297) (-1229.036) (-1227.562) [-1226.631] -- 0:00:19
694500 -- (-1228.730) (-1227.948) (-1228.994) [-1228.776] * (-1234.578) [-1227.855] (-1226.837) (-1226.895) -- 0:00:19
695000 -- (-1229.542) [-1228.063] (-1228.729) (-1230.562) * (-1231.230) [-1226.720] (-1226.239) (-1226.895) -- 0:00:19
Average standard deviation of split frequencies: 0.009527
695500 -- (-1231.936) (-1226.634) (-1229.010) [-1228.898] * (-1234.807) (-1227.039) [-1227.798] (-1232.234) -- 0:00:19
696000 -- (-1232.359) [-1226.638] (-1228.611) (-1229.948) * (-1236.474) (-1231.247) [-1228.708] (-1230.139) -- 0:00:19
696500 -- (-1227.594) [-1226.853] (-1226.940) (-1229.404) * (-1229.974) [-1227.475] (-1228.619) (-1229.976) -- 0:00:19
697000 -- (-1228.332) (-1226.864) (-1230.887) [-1227.009] * (-1228.978) [-1227.499] (-1227.133) (-1228.549) -- 0:00:19
697500 -- (-1228.265) [-1227.878] (-1227.794) (-1228.452) * (-1229.109) [-1227.546] (-1227.130) (-1226.781) -- 0:00:19
698000 -- (-1227.203) (-1226.891) (-1229.294) [-1230.704] * [-1228.684] (-1228.692) (-1229.960) (-1226.872) -- 0:00:19
698500 -- (-1227.495) (-1227.051) (-1229.517) [-1228.434] * (-1231.265) (-1228.344) (-1227.597) [-1227.515] -- 0:00:18
699000 -- (-1230.443) (-1227.014) [-1227.634] (-1226.484) * (-1228.438) (-1226.413) [-1230.417] (-1227.308) -- 0:00:18
699500 -- [-1230.426] (-1228.729) (-1228.025) (-1226.905) * (-1227.811) [-1226.638] (-1228.686) (-1228.007) -- 0:00:18
700000 -- (-1231.300) [-1232.200] (-1227.033) (-1228.510) * (-1228.144) [-1230.243] (-1227.322) (-1227.238) -- 0:00:18
Average standard deviation of split frequencies: 0.009554
700500 -- (-1226.687) [-1228.730] (-1227.426) (-1233.653) * (-1228.633) (-1231.308) [-1227.774] (-1227.961) -- 0:00:18
701000 -- [-1229.325] (-1228.157) (-1228.068) (-1229.869) * (-1228.571) [-1227.769] (-1227.882) (-1228.128) -- 0:00:18
701500 -- (-1227.080) (-1228.605) (-1227.437) [-1228.403] * (-1230.143) [-1226.978] (-1227.283) (-1228.323) -- 0:00:18
702000 -- (-1227.703) [-1228.448] (-1226.904) (-1227.113) * [-1230.743] (-1229.264) (-1226.906) (-1230.089) -- 0:00:18
702500 -- (-1227.267) (-1230.234) [-1228.122] (-1226.429) * (-1226.680) (-1227.755) (-1227.200) [-1226.872] -- 0:00:18
703000 -- (-1227.834) (-1228.952) (-1228.976) [-1226.940] * (-1226.579) (-1230.529) [-1227.007] (-1227.237) -- 0:00:18
703500 -- [-1228.562] (-1230.301) (-1232.396) (-1226.861) * (-1228.545) (-1229.175) [-1231.407] (-1229.995) -- 0:00:18
704000 -- (-1230.419) [-1228.274] (-1229.363) (-1231.231) * (-1228.527) (-1226.773) (-1227.800) [-1227.712] -- 0:00:18
704500 -- (-1232.381) (-1226.671) [-1228.087] (-1228.470) * (-1228.753) (-1228.367) (-1228.348) [-1227.742] -- 0:00:18
705000 -- (-1231.392) (-1226.837) [-1232.169] (-1227.041) * (-1229.592) [-1229.478] (-1228.319) (-1226.494) -- 0:00:18
Average standard deviation of split frequencies: 0.009214
705500 -- (-1228.924) [-1226.723] (-1227.695) (-1234.206) * (-1230.152) [-1226.841] (-1232.018) (-1227.036) -- 0:00:18
706000 -- (-1231.027) (-1227.580) [-1228.064] (-1228.391) * (-1229.300) (-1229.075) [-1227.165] (-1227.197) -- 0:00:18
706500 -- (-1229.158) [-1229.734] (-1227.387) (-1228.486) * (-1228.251) [-1229.484] (-1226.751) (-1226.345) -- 0:00:18
707000 -- [-1227.883] (-1228.244) (-1228.210) (-1231.512) * (-1234.381) [-1231.402] (-1228.118) (-1231.118) -- 0:00:18
707500 -- (-1227.747) [-1230.379] (-1226.935) (-1228.947) * [-1229.518] (-1226.985) (-1227.149) (-1229.793) -- 0:00:18
708000 -- (-1229.371) (-1227.472) [-1227.977] (-1226.870) * (-1227.169) (-1231.353) [-1230.265] (-1229.984) -- 0:00:18
708500 -- (-1229.438) (-1228.470) [-1227.248] (-1228.751) * (-1228.033) (-1229.601) (-1227.186) [-1226.615] -- 0:00:18
709000 -- (-1227.460) (-1227.923) (-1226.191) [-1227.221] * [-1231.763] (-1227.340) (-1226.959) (-1230.683) -- 0:00:18
709500 -- (-1226.681) (-1227.872) (-1227.225) [-1226.877] * [-1230.015] (-1227.271) (-1227.580) (-1227.740) -- 0:00:18
710000 -- (-1227.505) (-1230.185) [-1226.821] (-1227.486) * [-1229.661] (-1230.863) (-1226.700) (-1228.979) -- 0:00:18
Average standard deviation of split frequencies: 0.009660
710500 -- (-1229.258) (-1227.146) [-1227.382] (-1227.057) * (-1229.113) [-1229.209] (-1228.849) (-1229.864) -- 0:00:18
711000 -- (-1227.676) [-1228.456] (-1227.666) (-1226.984) * (-1229.985) (-1230.472) [-1228.725] (-1226.566) -- 0:00:18
711500 -- (-1228.200) (-1228.391) [-1230.849] (-1229.622) * (-1232.973) (-1235.072) (-1229.532) [-1226.746] -- 0:00:18
712000 -- (-1230.760) (-1231.019) [-1228.104] (-1229.219) * (-1227.816) (-1231.918) (-1228.485) [-1226.635] -- 0:00:18
712500 -- (-1230.641) [-1227.320] (-1228.555) (-1231.046) * (-1229.970) (-1227.743) (-1231.994) [-1226.511] -- 0:00:18
713000 -- (-1228.951) (-1228.057) [-1230.427] (-1228.910) * (-1229.420) [-1229.064] (-1227.742) (-1226.538) -- 0:00:18
713500 -- [-1228.561] (-1232.116) (-1227.328) (-1228.245) * [-1229.431] (-1227.960) (-1226.847) (-1226.655) -- 0:00:18
714000 -- (-1229.173) (-1232.351) (-1228.010) [-1228.158] * (-1228.213) (-1228.352) (-1227.595) [-1227.488] -- 0:00:18
714500 -- (-1229.617) (-1230.990) (-1230.718) [-1227.388] * (-1226.261) [-1227.661] (-1227.612) (-1231.934) -- 0:00:17
715000 -- [-1230.527] (-1227.037) (-1229.165) (-1229.482) * (-1228.453) [-1228.400] (-1227.158) (-1228.728) -- 0:00:17
Average standard deviation of split frequencies: 0.009382
715500 -- (-1229.565) [-1227.967] (-1228.019) (-1229.693) * [-1227.580] (-1227.483) (-1227.861) (-1228.279) -- 0:00:17
716000 -- [-1231.282] (-1230.450) (-1227.464) (-1227.673) * (-1230.614) [-1227.841] (-1229.183) (-1228.495) -- 0:00:17
716500 -- (-1226.221) (-1229.972) (-1227.521) [-1227.787] * (-1229.043) (-1228.800) [-1226.536] (-1228.588) -- 0:00:17
717000 -- [-1226.319] (-1229.749) (-1227.876) (-1228.170) * (-1227.955) [-1226.984] (-1228.147) (-1227.598) -- 0:00:17
717500 -- (-1227.507) [-1228.211] (-1227.269) (-1229.450) * (-1227.196) [-1230.920] (-1228.989) (-1226.464) -- 0:00:17
718000 -- (-1229.031) (-1229.479) (-1227.614) [-1229.103] * (-1228.020) (-1226.865) (-1227.490) [-1226.935] -- 0:00:17
718500 -- (-1228.526) (-1230.953) [-1228.408] (-1227.712) * (-1227.862) [-1227.386] (-1228.308) (-1227.289) -- 0:00:17
719000 -- (-1227.282) [-1226.206] (-1227.864) (-1227.073) * (-1230.065) (-1226.245) [-1227.397] (-1228.946) -- 0:00:17
719500 -- (-1229.487) (-1226.342) [-1228.534] (-1226.152) * (-1227.073) (-1229.712) [-1228.378] (-1227.012) -- 0:00:17
720000 -- (-1227.960) [-1230.144] (-1227.906) (-1226.847) * (-1230.060) (-1228.654) [-1228.213] (-1229.770) -- 0:00:17
Average standard deviation of split frequencies: 0.008994
720500 -- [-1229.852] (-1228.880) (-1227.323) (-1226.755) * (-1229.201) (-1226.799) [-1227.739] (-1229.546) -- 0:00:17
721000 -- (-1229.674) [-1226.946] (-1227.902) (-1226.913) * (-1230.127) [-1227.817] (-1229.791) (-1230.324) -- 0:00:17
721500 -- (-1231.046) [-1226.929] (-1233.405) (-1226.786) * (-1229.210) (-1227.086) (-1235.492) [-1228.354] -- 0:00:17
722000 -- (-1228.912) (-1229.055) [-1228.985] (-1227.674) * (-1227.460) [-1227.363] (-1229.834) (-1228.452) -- 0:00:17
722500 -- (-1228.073) (-1227.689) [-1227.404] (-1228.584) * (-1228.556) (-1231.094) [-1226.392] (-1227.028) -- 0:00:17
723000 -- (-1227.761) (-1229.351) (-1228.216) [-1227.939] * (-1227.911) [-1230.406] (-1227.315) (-1228.256) -- 0:00:17
723500 -- (-1227.221) (-1227.877) (-1227.541) [-1229.858] * [-1230.561] (-1229.310) (-1227.036) (-1227.500) -- 0:00:17
724000 -- [-1227.272] (-1229.042) (-1230.164) (-1228.706) * (-1226.345) (-1228.247) [-1227.172] (-1226.996) -- 0:00:17
724500 -- (-1230.566) (-1226.607) (-1227.116) [-1228.594] * (-1227.566) (-1229.135) [-1227.389] (-1228.017) -- 0:00:17
725000 -- (-1228.160) [-1227.190] (-1227.301) (-1227.123) * (-1226.213) (-1228.825) (-1227.771) [-1229.154] -- 0:00:17
Average standard deviation of split frequencies: 0.009537
725500 -- (-1226.793) (-1226.988) (-1229.206) [-1227.356] * (-1229.054) [-1226.394] (-1228.997) (-1228.023) -- 0:00:17
726000 -- (-1228.619) (-1230.428) (-1230.371) [-1227.973] * (-1226.965) (-1226.631) (-1227.073) [-1231.308] -- 0:00:17
726500 -- (-1229.800) (-1229.758) [-1227.513] (-1228.112) * (-1227.637) [-1228.778] (-1226.532) (-1229.471) -- 0:00:17
727000 -- (-1228.883) [-1228.357] (-1226.459) (-1230.104) * [-1227.531] (-1228.410) (-1226.532) (-1231.653) -- 0:00:17
727500 -- (-1227.116) (-1227.943) (-1226.770) [-1227.857] * [-1229.521] (-1229.462) (-1226.532) (-1230.083) -- 0:00:17
728000 -- [-1227.448] (-1226.386) (-1227.440) (-1226.874) * (-1227.570) (-1229.108) [-1229.113] (-1229.111) -- 0:00:17
728500 -- (-1227.252) (-1226.552) [-1227.389] (-1227.657) * (-1227.060) (-1227.312) [-1228.022] (-1234.622) -- 0:00:17
729000 -- [-1228.715] (-1226.954) (-1231.938) (-1227.492) * (-1226.907) [-1227.041] (-1228.944) (-1236.567) -- 0:00:17
729500 -- [-1226.979] (-1227.764) (-1228.119) (-1229.437) * (-1230.624) (-1228.022) (-1229.335) [-1226.622] -- 0:00:17
730000 -- (-1228.204) [-1227.444] (-1228.115) (-1228.877) * (-1230.059) [-1228.484] (-1229.149) (-1226.762) -- 0:00:17
Average standard deviation of split frequencies: 0.009234
730500 -- (-1229.206) [-1230.673] (-1233.657) (-1227.164) * (-1228.076) (-1231.060) (-1229.804) [-1229.942] -- 0:00:16
731000 -- (-1229.601) [-1228.842] (-1230.494) (-1228.981) * (-1228.295) (-1228.246) [-1230.127] (-1228.351) -- 0:00:16
731500 -- (-1229.954) [-1228.236] (-1227.873) (-1231.759) * [-1228.631] (-1229.460) (-1229.326) (-1227.949) -- 0:00:16
732000 -- (-1228.434) [-1226.948] (-1229.275) (-1231.476) * [-1227.432] (-1230.307) (-1228.412) (-1227.386) -- 0:00:16
732500 -- (-1226.992) (-1227.132) (-1229.521) [-1229.945] * [-1227.371] (-1227.344) (-1228.229) (-1229.098) -- 0:00:16
733000 -- (-1227.022) (-1227.741) (-1228.275) [-1229.735] * [-1229.438] (-1226.978) (-1230.082) (-1229.791) -- 0:00:16
733500 -- [-1227.071] (-1230.545) (-1228.569) (-1230.286) * (-1228.874) (-1228.377) (-1229.651) [-1227.363] -- 0:00:16
734000 -- [-1229.118] (-1228.595) (-1227.612) (-1233.382) * (-1232.669) (-1226.209) [-1227.982] (-1229.559) -- 0:00:16
734500 -- [-1228.501] (-1226.829) (-1227.404) (-1227.663) * [-1228.011] (-1229.012) (-1228.088) (-1230.131) -- 0:00:16
735000 -- (-1228.598) (-1229.184) [-1228.888] (-1230.044) * (-1228.614) [-1229.506] (-1228.866) (-1231.210) -- 0:00:16
Average standard deviation of split frequencies: 0.009407
735500 -- [-1227.668] (-1238.462) (-1229.149) (-1228.154) * (-1229.437) (-1228.769) (-1229.308) [-1228.807] -- 0:00:16
736000 -- [-1227.858] (-1229.563) (-1229.074) (-1226.492) * (-1228.487) (-1228.314) (-1228.840) [-1227.346] -- 0:00:16
736500 -- (-1227.621) (-1229.844) (-1228.670) [-1227.536] * [-1227.342] (-1230.894) (-1227.516) (-1229.728) -- 0:00:16
737000 -- (-1228.026) [-1230.091] (-1229.736) (-1227.087) * (-1235.379) [-1230.218] (-1226.777) (-1227.573) -- 0:00:16
737500 -- [-1229.705] (-1227.577) (-1229.037) (-1228.391) * (-1231.064) (-1227.938) [-1227.495] (-1230.649) -- 0:00:16
738000 -- [-1228.997] (-1226.935) (-1228.075) (-1232.246) * [-1230.895] (-1230.285) (-1228.407) (-1231.205) -- 0:00:16
738500 -- (-1229.620) [-1227.294] (-1231.427) (-1233.469) * [-1231.423] (-1232.881) (-1227.071) (-1231.863) -- 0:00:16
739000 -- (-1227.546) (-1227.102) (-1228.764) [-1232.474] * [-1228.112] (-1228.415) (-1230.252) (-1228.328) -- 0:00:16
739500 -- (-1230.482) [-1227.728] (-1227.519) (-1232.511) * [-1228.457] (-1230.051) (-1227.354) (-1231.077) -- 0:00:16
740000 -- [-1229.899] (-1227.896) (-1232.181) (-1227.573) * (-1228.462) (-1229.557) [-1226.970] (-1231.774) -- 0:00:16
Average standard deviation of split frequencies: 0.008871
740500 -- [-1229.816] (-1227.444) (-1230.910) (-1228.369) * (-1230.329) [-1232.183] (-1228.223) (-1231.057) -- 0:00:16
741000 -- (-1229.466) (-1229.362) (-1228.339) [-1226.821] * (-1228.167) (-1229.654) (-1226.870) [-1229.529] -- 0:00:16
741500 -- (-1229.760) (-1229.940) [-1232.185] (-1226.794) * (-1230.056) (-1226.921) [-1229.548] (-1227.508) -- 0:00:16
742000 -- (-1230.807) (-1229.475) (-1229.837) [-1229.560] * [-1226.985] (-1231.176) (-1234.803) (-1227.504) -- 0:00:16
742500 -- (-1229.424) (-1229.827) (-1229.114) [-1230.471] * (-1227.225) (-1231.532) (-1229.437) [-1227.060] -- 0:00:16
743000 -- (-1227.767) (-1229.075) [-1226.727] (-1228.121) * (-1228.085) (-1228.832) [-1226.410] (-1230.739) -- 0:00:16
743500 -- (-1229.195) [-1228.568] (-1227.038) (-1227.676) * (-1227.679) (-1227.605) [-1227.247] (-1230.517) -- 0:00:16
744000 -- (-1227.572) (-1228.996) (-1229.628) [-1228.130] * (-1229.857) [-1226.604] (-1229.040) (-1230.572) -- 0:00:16
744500 -- [-1228.712] (-1228.723) (-1230.481) (-1231.267) * (-1233.160) [-1226.590] (-1229.021) (-1229.300) -- 0:00:16
745000 -- [-1227.662] (-1228.183) (-1229.045) (-1229.271) * (-1231.301) [-1226.271] (-1230.901) (-1230.219) -- 0:00:16
Average standard deviation of split frequencies: 0.009044
745500 -- (-1227.728) (-1229.166) [-1229.366] (-1228.331) * (-1231.687) [-1228.895] (-1228.689) (-1230.836) -- 0:00:16
746000 -- (-1227.884) [-1227.096] (-1228.099) (-1230.688) * [-1229.966] (-1229.864) (-1227.738) (-1227.457) -- 0:00:16
746500 -- [-1230.704] (-1228.652) (-1229.248) (-1227.674) * (-1227.373) [-1229.282] (-1227.140) (-1229.141) -- 0:00:15
747000 -- (-1228.112) (-1229.855) (-1228.506) [-1227.042] * (-1228.792) [-1231.764] (-1227.697) (-1226.831) -- 0:00:15
747500 -- (-1226.929) (-1230.880) (-1228.301) [-1228.845] * (-1228.865) [-1229.130] (-1231.304) (-1230.250) -- 0:00:15
748000 -- (-1228.745) (-1229.681) (-1229.150) [-1226.860] * (-1227.168) (-1229.522) [-1228.854] (-1228.061) -- 0:00:15
748500 -- [-1228.253] (-1229.797) (-1230.631) (-1227.231) * [-1228.649] (-1229.585) (-1226.701) (-1227.159) -- 0:00:15
749000 -- (-1230.383) [-1231.682] (-1230.701) (-1231.667) * [-1228.665] (-1230.231) (-1226.699) (-1229.241) -- 0:00:15
749500 -- [-1228.508] (-1228.740) (-1230.831) (-1228.330) * (-1230.265) (-1228.874) [-1229.610] (-1228.646) -- 0:00:15
750000 -- (-1226.491) [-1227.745] (-1229.157) (-1232.338) * (-1230.048) (-1228.398) [-1229.828] (-1228.691) -- 0:00:15
Average standard deviation of split frequencies: 0.009420
750500 -- [-1226.863] (-1231.614) (-1227.704) (-1234.707) * (-1227.103) (-1227.866) [-1227.787] (-1227.484) -- 0:00:15
751000 -- (-1229.669) [-1228.108] (-1231.308) (-1228.250) * [-1229.670] (-1228.542) (-1229.087) (-1226.644) -- 0:00:15
751500 -- [-1227.846] (-1228.841) (-1230.434) (-1228.226) * [-1228.673] (-1230.372) (-1227.854) (-1232.097) -- 0:00:15
752000 -- [-1226.345] (-1229.008) (-1229.129) (-1230.902) * (-1227.651) (-1226.799) (-1227.530) [-1228.771] -- 0:00:15
752500 -- (-1227.311) (-1227.386) [-1230.714] (-1229.888) * (-1232.455) [-1229.333] (-1231.052) (-1233.884) -- 0:00:15
753000 -- [-1228.450] (-1227.299) (-1227.873) (-1227.327) * (-1232.784) [-1229.792] (-1227.454) (-1231.658) -- 0:00:15
753500 -- (-1227.892) [-1228.548] (-1226.790) (-1228.624) * [-1229.168] (-1226.609) (-1227.760) (-1227.987) -- 0:00:15
754000 -- [-1227.241] (-1229.356) (-1227.241) (-1229.729) * (-1229.183) (-1227.006) [-1230.311] (-1227.647) -- 0:00:15
754500 -- (-1228.864) (-1226.617) [-1228.116] (-1229.044) * (-1228.369) [-1227.162] (-1228.875) (-1227.473) -- 0:00:15
755000 -- (-1230.877) (-1229.948) (-1231.250) [-1228.305] * [-1227.111] (-1226.351) (-1230.213) (-1227.111) -- 0:00:15
Average standard deviation of split frequencies: 0.009236
755500 -- (-1230.843) (-1227.852) [-1231.421] (-1226.307) * [-1227.612] (-1227.362) (-1228.291) (-1227.184) -- 0:00:15
756000 -- (-1232.356) [-1228.157] (-1228.559) (-1230.932) * (-1228.084) [-1227.006] (-1227.718) (-1230.905) -- 0:00:15
756500 -- [-1231.941] (-1230.028) (-1227.106) (-1229.336) * [-1228.515] (-1227.026) (-1226.985) (-1230.887) -- 0:00:15
757000 -- (-1230.104) [-1227.321] (-1227.141) (-1228.165) * (-1230.862) (-1226.696) (-1228.676) [-1228.345] -- 0:00:15
757500 -- [-1228.170] (-1229.354) (-1227.612) (-1228.463) * (-1229.487) (-1227.184) (-1226.396) [-1229.605] -- 0:00:15
758000 -- (-1232.726) (-1228.230) [-1229.112] (-1230.657) * (-1230.934) [-1229.386] (-1228.695) (-1228.925) -- 0:00:15
758500 -- [-1227.483] (-1229.703) (-1228.311) (-1226.690) * (-1227.902) (-1227.260) (-1227.795) [-1227.586] -- 0:00:15
759000 -- [-1228.298] (-1227.056) (-1228.722) (-1228.181) * (-1228.730) (-1228.627) (-1228.570) [-1226.321] -- 0:00:15
759500 -- (-1229.358) [-1228.729] (-1227.071) (-1227.534) * (-1228.591) (-1229.704) [-1226.984] (-1226.647) -- 0:00:15
760000 -- (-1227.813) [-1228.004] (-1228.675) (-1227.120) * (-1230.314) (-1229.403) (-1229.973) [-1229.183] -- 0:00:15
Average standard deviation of split frequencies: 0.008947
760500 -- (-1229.251) (-1228.319) [-1228.867] (-1226.951) * (-1231.341) (-1229.935) (-1229.545) [-1230.532] -- 0:00:15
761000 -- (-1231.575) (-1230.187) (-1229.808) [-1227.148] * (-1230.178) [-1228.314] (-1227.754) (-1227.662) -- 0:00:15
761500 -- (-1228.576) [-1229.017] (-1230.055) (-1234.518) * [-1232.621] (-1229.162) (-1228.476) (-1228.351) -- 0:00:15
762000 -- (-1227.709) (-1228.901) [-1227.327] (-1227.275) * (-1228.462) (-1227.217) [-1229.605] (-1226.934) -- 0:00:14
762500 -- (-1227.228) [-1229.586] (-1227.501) (-1231.771) * (-1227.383) (-1226.580) (-1230.791) [-1227.598] -- 0:00:14
763000 -- (-1229.562) (-1229.279) (-1228.994) [-1230.806] * [-1231.187] (-1230.800) (-1230.077) (-1229.356) -- 0:00:14
763500 -- (-1232.180) [-1229.645] (-1228.578) (-1237.736) * (-1230.404) (-1228.332) (-1230.623) [-1227.615] -- 0:00:14
764000 -- (-1230.914) [-1229.451] (-1227.583) (-1232.230) * (-1230.265) (-1229.291) [-1230.313] (-1229.645) -- 0:00:14
764500 -- (-1233.247) (-1228.850) (-1230.239) [-1227.228] * (-1228.309) [-1229.855] (-1228.739) (-1229.548) -- 0:00:14
765000 -- (-1228.930) [-1229.157] (-1229.227) (-1229.425) * [-1227.912] (-1229.539) (-1227.446) (-1227.788) -- 0:00:14
Average standard deviation of split frequencies: 0.008577
765500 -- (-1229.198) (-1230.281) [-1228.894] (-1228.299) * (-1231.573) (-1226.797) [-1230.920] (-1235.383) -- 0:00:14
766000 -- (-1229.908) (-1229.581) [-1229.087] (-1228.022) * (-1230.766) (-1226.785) [-1230.043] (-1229.272) -- 0:00:14
766500 -- [-1230.793] (-1230.378) (-1226.960) (-1227.111) * (-1230.645) (-1229.674) (-1226.708) [-1230.592] -- 0:00:14
767000 -- (-1231.036) (-1228.937) (-1228.512) [-1229.317] * [-1227.769] (-1231.387) (-1228.820) (-1226.384) -- 0:00:14
767500 -- (-1230.563) (-1233.448) [-1227.230] (-1231.544) * [-1227.035] (-1228.912) (-1229.184) (-1227.672) -- 0:00:14
768000 -- (-1229.907) (-1226.607) [-1226.827] (-1229.441) * [-1227.044] (-1231.027) (-1230.038) (-1227.665) -- 0:00:14
768500 -- (-1228.540) (-1231.121) [-1229.171] (-1229.834) * (-1227.041) [-1229.778] (-1229.235) (-1228.357) -- 0:00:14
769000 -- (-1227.778) [-1229.468] (-1229.027) (-1227.560) * (-1233.925) (-1227.829) (-1233.021) [-1228.807] -- 0:00:14
769500 -- (-1227.628) (-1233.846) (-1226.525) [-1228.417] * (-1228.552) (-1229.520) (-1231.135) [-1228.008] -- 0:00:14
770000 -- [-1227.863] (-1229.864) (-1226.045) (-1238.743) * (-1230.228) (-1231.029) [-1228.250] (-1226.721) -- 0:00:14
Average standard deviation of split frequencies: 0.008716
770500 -- (-1227.649) [-1232.621] (-1226.368) (-1233.322) * (-1228.230) (-1229.217) (-1231.445) [-1230.365] -- 0:00:14
771000 -- (-1227.845) [-1226.986] (-1227.094) (-1227.700) * [-1230.726] (-1231.125) (-1227.605) (-1229.889) -- 0:00:14
771500 -- (-1227.619) (-1229.485) (-1227.195) [-1227.118] * (-1227.885) [-1227.989] (-1231.189) (-1228.782) -- 0:00:14
772000 -- (-1229.611) [-1228.806] (-1228.045) (-1227.489) * (-1228.176) [-1228.780] (-1231.017) (-1226.972) -- 0:00:14
772500 -- [-1228.452] (-1227.318) (-1228.921) (-1226.337) * (-1227.563) [-1228.848] (-1228.705) (-1227.884) -- 0:00:14
773000 -- [-1229.654] (-1229.307) (-1229.978) (-1229.690) * (-1227.565) (-1227.906) (-1230.701) [-1227.411] -- 0:00:14
773500 -- (-1227.838) (-1232.298) [-1228.866] (-1231.386) * [-1230.186] (-1227.967) (-1231.061) (-1229.865) -- 0:00:14
774000 -- (-1231.809) (-1228.876) (-1229.641) [-1228.899] * (-1232.560) [-1228.105] (-1230.967) (-1228.989) -- 0:00:14
774500 -- (-1227.100) (-1227.465) (-1228.564) [-1226.741] * (-1234.470) [-1226.888] (-1229.042) (-1228.558) -- 0:00:14
775000 -- (-1227.871) (-1228.691) [-1226.473] (-1231.793) * (-1226.862) (-1231.028) (-1228.860) [-1227.078] -- 0:00:14
Average standard deviation of split frequencies: 0.008998
775500 -- (-1233.532) [-1227.732] (-1227.089) (-1227.106) * (-1226.844) (-1227.118) (-1228.237) [-1226.446] -- 0:00:14
776000 -- (-1230.821) (-1229.149) (-1227.127) [-1227.077] * (-1226.584) [-1226.888] (-1228.434) (-1226.654) -- 0:00:14
776500 -- (-1230.774) (-1226.756) [-1227.384] (-1227.690) * (-1227.933) (-1231.984) (-1227.992) [-1227.179] -- 0:00:14
777000 -- (-1227.712) (-1228.448) (-1227.150) [-1226.965] * [-1232.497] (-1226.989) (-1226.619) (-1229.050) -- 0:00:14
777500 -- [-1227.712] (-1227.691) (-1231.818) (-1232.374) * (-1228.385) (-1229.455) (-1226.941) [-1227.920] -- 0:00:14
778000 -- [-1228.902] (-1228.868) (-1228.145) (-1229.036) * (-1228.372) (-1227.442) [-1227.367] (-1229.047) -- 0:00:13
778500 -- (-1228.599) [-1227.731] (-1231.610) (-1230.330) * (-1230.625) [-1229.279] (-1228.397) (-1228.308) -- 0:00:13
779000 -- [-1229.275] (-1231.332) (-1229.825) (-1229.908) * (-1227.184) (-1227.171) (-1229.023) [-1228.272] -- 0:00:13
779500 -- [-1228.608] (-1226.347) (-1228.051) (-1229.138) * [-1226.340] (-1228.452) (-1228.381) (-1230.388) -- 0:00:13
780000 -- (-1228.841) (-1229.354) (-1229.671) [-1228.097] * (-1227.923) [-1231.279] (-1228.846) (-1229.196) -- 0:00:13
Average standard deviation of split frequencies: 0.008869
780500 -- (-1227.115) (-1232.976) (-1229.497) [-1228.183] * [-1230.956] (-1228.347) (-1234.605) (-1227.753) -- 0:00:13
781000 -- (-1229.798) (-1235.089) [-1228.912] (-1227.582) * (-1229.076) (-1229.311) (-1229.726) [-1229.696] -- 0:00:13
781500 -- [-1226.545] (-1227.872) (-1227.688) (-1226.858) * [-1227.238] (-1228.830) (-1227.790) (-1229.393) -- 0:00:13
782000 -- (-1231.440) [-1228.601] (-1230.605) (-1231.427) * [-1227.893] (-1229.402) (-1230.407) (-1228.728) -- 0:00:13
782500 -- (-1229.428) [-1227.060] (-1229.927) (-1230.464) * (-1230.385) [-1228.226] (-1228.887) (-1227.186) -- 0:00:13
783000 -- (-1231.072) (-1229.658) [-1228.896] (-1230.520) * [-1228.528] (-1230.076) (-1228.473) (-1228.004) -- 0:00:13
783500 -- (-1230.106) (-1228.010) [-1230.446] (-1227.820) * [-1228.167] (-1231.229) (-1227.942) (-1226.907) -- 0:00:13
784000 -- (-1229.355) (-1227.421) [-1229.920] (-1228.466) * [-1228.492] (-1230.696) (-1226.367) (-1227.758) -- 0:00:13
784500 -- [-1229.078] (-1230.120) (-1229.546) (-1229.257) * (-1228.925) (-1229.371) [-1228.390] (-1227.116) -- 0:00:13
785000 -- (-1227.676) (-1231.559) [-1228.034] (-1228.219) * [-1229.042] (-1229.930) (-1229.046) (-1228.418) -- 0:00:13
Average standard deviation of split frequencies: 0.008659
785500 -- [-1228.388] (-1228.383) (-1229.735) (-1227.077) * (-1228.251) (-1228.546) (-1227.982) [-1227.512] -- 0:00:13
786000 -- (-1229.880) [-1229.021] (-1227.138) (-1228.174) * (-1226.511) (-1226.828) [-1227.096] (-1229.151) -- 0:00:13
786500 -- [-1232.731] (-1229.327) (-1227.773) (-1233.086) * [-1228.223] (-1229.366) (-1231.287) (-1227.542) -- 0:00:13
787000 -- (-1228.000) (-1229.293) (-1227.968) [-1229.383] * [-1227.049] (-1233.171) (-1228.444) (-1227.328) -- 0:00:13
787500 -- (-1229.459) (-1227.983) [-1230.179] (-1228.431) * (-1226.832) (-1231.332) [-1228.798] (-1229.403) -- 0:00:13
788000 -- (-1231.367) [-1227.816] (-1226.923) (-1226.764) * [-1228.802] (-1228.643) (-1228.234) (-1227.394) -- 0:00:13
788500 -- (-1227.619) (-1230.312) [-1227.403] (-1229.030) * (-1235.945) [-1227.610] (-1228.744) (-1228.988) -- 0:00:13
789000 -- (-1230.300) (-1233.878) (-1228.984) [-1227.431] * (-1231.911) (-1228.978) (-1230.139) [-1228.587] -- 0:00:13
789500 -- (-1230.556) [-1233.920] (-1231.229) (-1229.305) * (-1230.598) [-1228.799] (-1228.204) (-1228.656) -- 0:00:13
790000 -- (-1228.937) (-1231.728) [-1227.550] (-1228.215) * (-1227.620) [-1227.251] (-1227.667) (-1230.324) -- 0:00:13
Average standard deviation of split frequencies: 0.008571
790500 -- (-1229.380) (-1227.694) (-1227.208) [-1230.026] * (-1226.787) [-1229.600] (-1229.463) (-1226.325) -- 0:00:13
791000 -- (-1228.510) (-1231.721) (-1228.695) [-1226.713] * (-1227.190) (-1227.245) (-1229.057) [-1227.643] -- 0:00:13
791500 -- [-1232.068] (-1227.964) (-1230.751) (-1230.750) * (-1227.469) (-1226.949) [-1227.260] (-1227.011) -- 0:00:13
792000 -- [-1228.820] (-1231.961) (-1230.505) (-1226.680) * (-1228.620) [-1231.570] (-1226.959) (-1227.817) -- 0:00:13
792500 -- (-1229.224) [-1227.746] (-1227.776) (-1229.979) * (-1231.475) (-1227.358) (-1227.043) [-1227.107] -- 0:00:13
793000 -- [-1227.466] (-1227.016) (-1230.227) (-1227.677) * [-1231.487] (-1226.583) (-1227.520) (-1228.938) -- 0:00:13
793500 -- (-1227.562) (-1228.117) (-1235.204) [-1227.314] * (-1231.592) (-1228.424) [-1228.986] (-1228.842) -- 0:00:13
794000 -- (-1227.048) [-1228.317] (-1229.474) (-1232.484) * (-1230.323) (-1227.386) [-1226.644] (-1236.128) -- 0:00:12
794500 -- (-1229.504) (-1228.578) [-1226.475] (-1226.810) * (-1230.743) (-1227.523) [-1226.961] (-1228.880) -- 0:00:12
795000 -- [-1228.326] (-1227.341) (-1227.382) (-1227.732) * (-1229.119) [-1228.184] (-1229.541) (-1228.072) -- 0:00:12
Average standard deviation of split frequencies: 0.008550
795500 -- (-1228.938) [-1228.684] (-1226.781) (-1228.481) * (-1227.901) (-1227.473) [-1226.635] (-1228.190) -- 0:00:12
796000 -- (-1227.881) (-1232.532) (-1228.115) [-1227.445] * (-1227.856) (-1227.724) [-1226.662] (-1228.794) -- 0:00:12
796500 -- (-1230.401) (-1229.627) (-1230.406) [-1226.979] * [-1228.971] (-1228.756) (-1227.039) (-1229.946) -- 0:00:12
797000 -- (-1226.230) (-1228.913) [-1232.646] (-1229.819) * (-1227.124) (-1229.374) (-1230.437) [-1231.005] -- 0:00:12
797500 -- (-1227.730) (-1231.668) (-1227.989) [-1229.841] * (-1229.564) (-1231.371) (-1229.765) [-1231.183] -- 0:00:12
798000 -- (-1228.374) (-1226.748) (-1229.050) [-1231.456] * (-1229.875) (-1228.017) [-1229.059] (-1227.750) -- 0:00:12
798500 -- (-1228.218) (-1226.572) (-1229.536) [-1231.213] * (-1231.181) (-1228.339) (-1227.078) [-1227.331] -- 0:00:12
799000 -- (-1228.323) (-1227.297) (-1228.546) [-1228.522] * (-1227.295) (-1227.017) [-1227.155] (-1226.983) -- 0:00:12
799500 -- (-1229.188) (-1228.728) [-1228.323] (-1227.044) * (-1229.570) (-1230.437) [-1228.971] (-1228.087) -- 0:00:12
800000 -- [-1228.163] (-1234.855) (-1226.459) (-1227.211) * (-1227.397) (-1228.531) (-1232.652) [-1226.725] -- 0:00:12
Average standard deviation of split frequencies: 0.008282
800500 -- [-1227.348] (-1233.966) (-1228.132) (-1228.766) * (-1226.914) (-1226.602) (-1230.714) [-1230.120] -- 0:00:12
801000 -- [-1228.582] (-1232.445) (-1227.894) (-1229.131) * (-1227.210) [-1228.499] (-1228.883) (-1228.572) -- 0:00:12
801500 -- (-1227.603) [-1227.833] (-1228.341) (-1228.676) * (-1231.180) [-1228.092] (-1226.711) (-1228.480) -- 0:00:12
802000 -- [-1228.081] (-1228.552) (-1228.348) (-1229.536) * [-1226.529] (-1230.152) (-1230.918) (-1229.590) -- 0:00:12
802500 -- (-1228.211) (-1228.326) (-1229.765) [-1228.244] * (-1226.541) (-1231.414) [-1228.923] (-1231.324) -- 0:00:12
803000 -- [-1228.362] (-1227.180) (-1230.004) (-1228.891) * [-1227.373] (-1228.341) (-1227.063) (-1237.675) -- 0:00:12
803500 -- (-1228.557) [-1227.907] (-1229.049) (-1228.074) * [-1226.590] (-1227.495) (-1227.231) (-1232.904) -- 0:00:12
804000 -- (-1228.790) [-1228.470] (-1229.572) (-1230.662) * (-1228.226) (-1227.998) (-1229.887) [-1226.758] -- 0:00:12
804500 -- [-1227.514] (-1227.720) (-1227.087) (-1230.359) * (-1228.686) [-1227.231] (-1228.208) (-1227.203) -- 0:00:12
805000 -- [-1228.066] (-1227.551) (-1228.506) (-1228.402) * (-1227.235) (-1227.302) [-1227.435] (-1227.179) -- 0:00:12
Average standard deviation of split frequencies: 0.008344
805500 -- (-1228.066) (-1229.337) [-1232.937] (-1228.752) * (-1228.618) (-1228.322) [-1227.486] (-1228.517) -- 0:00:12
806000 -- (-1230.455) (-1230.291) (-1230.297) [-1229.169] * (-1230.144) [-1230.006] (-1233.983) (-1228.835) -- 0:00:12
806500 -- [-1228.656] (-1226.445) (-1227.399) (-1231.484) * (-1230.498) [-1227.059] (-1229.922) (-1227.299) -- 0:00:12
807000 -- (-1229.456) [-1227.079] (-1227.591) (-1230.520) * (-1228.514) (-1228.052) (-1228.829) [-1230.575] -- 0:00:12
807500 -- (-1226.894) [-1227.837] (-1227.515) (-1228.295) * (-1227.092) [-1227.412] (-1227.457) (-1228.685) -- 0:00:12
808000 -- [-1234.342] (-1229.673) (-1227.322) (-1227.086) * (-1229.288) [-1228.380] (-1227.349) (-1227.853) -- 0:00:12
808500 -- (-1229.091) (-1232.194) [-1226.878] (-1231.938) * (-1230.582) (-1230.941) (-1226.995) [-1228.917] -- 0:00:12
809000 -- (-1229.283) (-1228.044) [-1226.704] (-1228.044) * (-1228.825) (-1231.942) (-1227.409) [-1229.843] -- 0:00:12
809500 -- (-1227.718) [-1227.459] (-1226.917) (-1228.816) * (-1229.281) (-1229.066) (-1230.349) [-1229.444] -- 0:00:12
810000 -- (-1227.771) [-1229.418] (-1227.047) (-1227.316) * (-1227.460) [-1227.821] (-1226.290) (-1233.299) -- 0:00:11
Average standard deviation of split frequencies: 0.008374
810500 -- (-1226.611) (-1229.443) (-1231.154) [-1227.242] * (-1230.002) (-1229.186) [-1227.995] (-1228.091) -- 0:00:11
811000 -- (-1228.234) (-1229.861) [-1229.472] (-1228.673) * (-1231.733) (-1230.740) (-1228.786) [-1228.082] -- 0:00:11
811500 -- [-1228.397] (-1229.781) (-1230.079) (-1229.425) * (-1229.716) (-1227.964) [-1227.801] (-1229.441) -- 0:00:11
812000 -- (-1228.644) [-1233.220] (-1228.267) (-1231.189) * [-1227.822] (-1227.889) (-1226.805) (-1229.369) -- 0:00:11
812500 -- (-1226.863) (-1233.413) (-1233.033) [-1229.312] * [-1227.349] (-1227.494) (-1227.592) (-1228.421) -- 0:00:11
813000 -- (-1227.319) (-1230.704) (-1227.649) [-1227.193] * (-1227.473) (-1227.224) [-1227.351] (-1228.429) -- 0:00:11
813500 -- (-1229.153) (-1233.093) [-1228.286] (-1226.434) * (-1228.622) [-1227.581] (-1227.408) (-1232.105) -- 0:00:11
814000 -- (-1228.210) [-1228.705] (-1226.430) (-1227.893) * (-1226.319) (-1229.865) (-1227.373) [-1232.859] -- 0:00:11
814500 -- [-1231.711] (-1227.913) (-1227.987) (-1227.832) * [-1228.777] (-1227.226) (-1231.585) (-1231.235) -- 0:00:11
815000 -- (-1228.572) (-1230.133) (-1227.646) [-1229.356] * (-1228.804) (-1228.623) [-1227.200] (-1227.466) -- 0:00:11
Average standard deviation of split frequencies: 0.007433
815500 -- (-1229.582) [-1227.484] (-1228.292) (-1230.395) * (-1228.237) (-1229.604) [-1230.114] (-1227.484) -- 0:00:11
816000 -- (-1228.917) [-1226.456] (-1227.977) (-1230.294) * (-1229.006) [-1229.068] (-1226.279) (-1230.670) -- 0:00:11
816500 -- (-1231.479) (-1226.608) [-1227.135] (-1228.775) * (-1227.247) (-1231.098) [-1227.944] (-1227.279) -- 0:00:11
817000 -- (-1228.475) (-1229.781) [-1226.664] (-1227.811) * (-1226.948) [-1227.647] (-1229.556) (-1229.090) -- 0:00:11
817500 -- (-1228.342) (-1228.935) (-1231.511) [-1228.302] * (-1227.354) [-1227.647] (-1227.968) (-1228.012) -- 0:00:11
818000 -- (-1228.829) (-1227.372) [-1227.882] (-1227.684) * [-1228.676] (-1230.798) (-1229.195) (-1229.166) -- 0:00:11
818500 -- (-1227.868) (-1227.192) (-1228.807) [-1228.982] * (-1228.446) (-1227.124) [-1226.364] (-1228.039) -- 0:00:11
819000 -- (-1228.859) (-1231.943) [-1228.803] (-1227.090) * (-1227.490) (-1226.113) (-1230.134) [-1227.028] -- 0:00:11
819500 -- [-1229.990] (-1232.857) (-1226.167) (-1229.773) * (-1226.832) (-1232.978) (-1227.727) [-1228.583] -- 0:00:11
820000 -- (-1229.825) [-1231.831] (-1227.917) (-1231.664) * (-1226.832) (-1229.731) [-1231.269] (-1229.787) -- 0:00:11
Average standard deviation of split frequencies: 0.007123
820500 -- (-1228.670) (-1232.399) (-1230.856) [-1230.367] * (-1226.839) (-1229.903) [-1232.039] (-1229.057) -- 0:00:11
821000 -- (-1229.150) (-1232.398) [-1226.484] (-1227.119) * [-1226.818] (-1229.372) (-1232.559) (-1228.188) -- 0:00:11
821500 -- [-1228.462] (-1232.116) (-1230.433) (-1227.828) * (-1227.295) [-1230.196] (-1230.938) (-1229.029) -- 0:00:11
822000 -- (-1227.737) (-1229.959) (-1227.421) [-1226.789] * (-1227.516) (-1227.466) [-1227.110] (-1228.194) -- 0:00:11
822500 -- [-1229.843] (-1227.595) (-1231.722) (-1227.300) * (-1233.650) (-1226.545) (-1227.833) [-1227.132] -- 0:00:11
823000 -- (-1229.498) (-1226.980) (-1231.308) [-1230.471] * (-1229.245) [-1229.863] (-1227.306) (-1228.323) -- 0:00:11
823500 -- (-1229.192) [-1229.448] (-1230.628) (-1229.510) * [-1227.784] (-1227.220) (-1230.582) (-1227.159) -- 0:00:11
824000 -- (-1229.160) [-1226.677] (-1234.091) (-1226.899) * (-1226.831) (-1231.413) (-1228.902) [-1227.451] -- 0:00:11
824500 -- (-1227.114) (-1226.807) [-1229.520] (-1226.764) * (-1226.037) (-1231.040) [-1227.962] (-1227.162) -- 0:00:11
825000 -- (-1227.664) (-1228.804) [-1227.211] (-1227.050) * (-1230.335) (-1226.832) (-1227.695) [-1228.608] -- 0:00:11
Average standard deviation of split frequencies: 0.007077
825500 -- (-1227.637) (-1228.479) (-1227.300) [-1230.707] * (-1230.064) (-1228.417) [-1228.746] (-1229.679) -- 0:00:10
826000 -- (-1228.163) (-1227.906) (-1228.016) [-1227.923] * (-1228.761) [-1229.110] (-1230.305) (-1226.350) -- 0:00:10
826500 -- (-1230.869) [-1226.994] (-1231.004) (-1228.672) * (-1233.295) (-1227.890) (-1227.467) [-1229.312] -- 0:00:10
827000 -- [-1227.942] (-1227.268) (-1227.121) (-1228.918) * (-1230.728) [-1226.927] (-1226.513) (-1227.680) -- 0:00:10
827500 -- [-1229.043] (-1226.968) (-1228.425) (-1227.301) * (-1231.414) (-1226.741) (-1226.701) [-1229.342] -- 0:00:10
828000 -- (-1228.068) [-1228.305] (-1229.014) (-1228.295) * (-1229.174) (-1229.850) (-1227.871) [-1228.091] -- 0:00:10
828500 -- (-1227.359) [-1228.313] (-1230.499) (-1227.101) * [-1229.088] (-1227.473) (-1237.558) (-1227.089) -- 0:00:10
829000 -- [-1226.693] (-1228.237) (-1233.021) (-1229.678) * (-1229.818) (-1228.883) (-1230.809) [-1226.973] -- 0:00:10
829500 -- (-1230.866) (-1229.986) (-1232.278) [-1233.100] * (-1231.335) (-1229.084) (-1229.651) [-1228.718] -- 0:00:10
830000 -- [-1227.356] (-1227.640) (-1227.768) (-1228.430) * [-1227.536] (-1227.322) (-1227.520) (-1233.110) -- 0:00:10
Average standard deviation of split frequencies: 0.007113
830500 -- [-1229.383] (-1229.124) (-1226.368) (-1227.527) * [-1228.844] (-1228.031) (-1226.564) (-1234.176) -- 0:00:10
831000 -- (-1232.007) (-1228.352) (-1230.432) [-1229.518] * (-1228.553) [-1229.487] (-1227.902) (-1231.422) -- 0:00:10
831500 -- [-1229.683] (-1228.567) (-1233.481) (-1227.744) * [-1229.367] (-1229.119) (-1226.625) (-1228.216) -- 0:00:10
832000 -- [-1227.349] (-1227.373) (-1229.376) (-1227.910) * (-1235.455) [-1227.999] (-1228.999) (-1229.230) -- 0:00:10
832500 -- (-1229.181) (-1230.975) [-1228.680] (-1229.241) * (-1236.413) [-1228.773] (-1228.456) (-1228.496) -- 0:00:10
833000 -- (-1228.627) (-1229.164) (-1228.839) [-1226.986] * (-1229.904) (-1232.371) [-1228.297] (-1228.085) -- 0:00:10
833500 -- (-1229.679) (-1232.793) [-1228.096] (-1227.033) * (-1230.183) (-1230.500) (-1228.833) [-1230.649] -- 0:00:10
834000 -- [-1227.861] (-1229.073) (-1226.639) (-1227.430) * [-1232.003] (-1230.516) (-1230.689) (-1227.875) -- 0:00:10
834500 -- [-1227.065] (-1230.682) (-1229.722) (-1228.172) * (-1232.351) (-1226.827) (-1227.864) [-1227.959] -- 0:00:10
835000 -- [-1229.190] (-1228.872) (-1227.764) (-1230.077) * (-1235.262) [-1227.461] (-1228.582) (-1228.197) -- 0:00:10
Average standard deviation of split frequencies: 0.007105
835500 -- (-1230.846) [-1230.260] (-1233.630) (-1231.952) * (-1229.480) (-1228.876) [-1229.832] (-1233.418) -- 0:00:10
836000 -- (-1228.582) (-1229.187) (-1234.696) [-1229.652] * (-1227.755) (-1227.237) [-1230.404] (-1232.582) -- 0:00:10
836500 -- (-1230.612) (-1229.538) (-1228.416) [-1229.136] * (-1227.167) (-1227.701) (-1227.814) [-1228.267] -- 0:00:10
837000 -- (-1228.632) (-1230.015) (-1229.488) [-1229.249] * (-1226.593) [-1230.805] (-1230.059) (-1227.967) -- 0:00:10
837500 -- [-1234.495] (-1230.593) (-1228.298) (-1229.518) * (-1226.719) (-1233.079) (-1231.506) [-1226.973] -- 0:00:10
838000 -- (-1232.283) (-1232.674) [-1229.913] (-1228.378) * (-1226.719) (-1231.346) (-1230.205) [-1228.697] -- 0:00:10
838500 -- (-1229.034) [-1234.055] (-1229.059) (-1228.318) * (-1229.551) [-1228.927] (-1227.717) (-1229.539) -- 0:00:10
839000 -- (-1229.325) (-1234.074) [-1230.999] (-1229.682) * (-1230.421) (-1229.925) [-1227.378] (-1229.793) -- 0:00:10
839500 -- (-1229.596) [-1226.827] (-1226.956) (-1226.965) * (-1229.307) (-1230.803) (-1227.272) [-1228.880] -- 0:00:10
840000 -- [-1230.280] (-1228.377) (-1226.832) (-1227.355) * (-1230.343) [-1228.762] (-1232.990) (-1229.020) -- 0:00:10
Average standard deviation of split frequencies: 0.006841
840500 -- (-1229.634) (-1227.889) (-1227.987) [-1226.995] * (-1232.668) (-1229.742) (-1230.572) [-1229.220] -- 0:00:10
841000 -- (-1230.841) [-1228.818] (-1227.227) (-1228.179) * (-1232.890) (-1232.517) (-1227.505) [-1229.364] -- 0:00:10
841500 -- [-1229.202] (-1229.634) (-1230.179) (-1228.362) * (-1227.889) [-1226.571] (-1227.084) (-1228.075) -- 0:00:09
842000 -- (-1228.859) [-1227.446] (-1227.293) (-1228.404) * [-1228.333] (-1232.890) (-1226.936) (-1227.377) -- 0:00:09
842500 -- (-1228.511) (-1228.511) (-1226.884) [-1229.768] * (-1231.093) (-1228.863) (-1230.301) [-1228.185] -- 0:00:09
843000 -- (-1227.722) (-1228.733) (-1227.584) [-1230.262] * (-1228.635) (-1226.735) [-1229.444] (-1228.499) -- 0:00:09
843500 -- [-1228.583] (-1233.346) (-1227.268) (-1230.540) * (-1228.863) [-1226.801] (-1229.399) (-1227.781) -- 0:00:09
844000 -- [-1228.688] (-1233.414) (-1228.033) (-1226.429) * (-1228.449) [-1227.688] (-1231.560) (-1226.666) -- 0:00:09
844500 -- (-1228.455) (-1233.543) [-1226.798] (-1227.342) * [-1228.196] (-1227.345) (-1228.361) (-1236.152) -- 0:00:09
845000 -- [-1231.429] (-1231.843) (-1229.415) (-1227.669) * [-1229.652] (-1229.933) (-1230.986) (-1229.909) -- 0:00:09
Average standard deviation of split frequencies: 0.006389
845500 -- (-1228.758) (-1231.666) [-1228.924] (-1226.870) * (-1226.914) (-1230.316) [-1228.560] (-1228.256) -- 0:00:09
846000 -- (-1234.528) (-1230.632) [-1226.515] (-1227.236) * [-1226.144] (-1227.320) (-1228.477) (-1229.450) -- 0:00:09
846500 -- (-1229.205) [-1228.863] (-1226.400) (-1234.107) * [-1227.429] (-1227.488) (-1227.652) (-1227.722) -- 0:00:09
847000 -- (-1227.465) [-1228.577] (-1230.309) (-1230.787) * (-1229.028) [-1226.869] (-1229.459) (-1226.736) -- 0:00:09
847500 -- (-1232.013) [-1226.717] (-1231.680) (-1229.740) * (-1231.368) [-1227.311] (-1226.827) (-1230.706) -- 0:00:09
848000 -- (-1228.993) [-1229.410] (-1233.382) (-1228.003) * (-1234.713) (-1227.357) [-1226.480] (-1228.107) -- 0:00:09
848500 -- (-1228.208) (-1230.762) [-1226.952] (-1229.954) * (-1229.873) (-1229.716) (-1226.793) [-1227.014] -- 0:00:09
849000 -- [-1232.795] (-1231.124) (-1227.230) (-1229.965) * [-1231.975] (-1233.605) (-1227.613) (-1231.463) -- 0:00:09
849500 -- (-1228.350) (-1233.088) [-1226.508] (-1230.523) * (-1228.865) (-1228.896) [-1226.754] (-1228.565) -- 0:00:09
850000 -- (-1227.964) (-1233.480) (-1228.930) [-1228.343] * (-1230.463) (-1230.135) [-1227.701] (-1227.139) -- 0:00:09
Average standard deviation of split frequencies: 0.006576
850500 -- [-1226.848] (-1229.240) (-1233.343) (-1227.735) * (-1228.418) (-1227.227) (-1227.147) [-1228.596] -- 0:00:09
851000 -- (-1227.178) [-1228.453] (-1229.921) (-1229.054) * (-1229.716) (-1229.624) [-1230.214] (-1234.080) -- 0:00:09
851500 -- [-1228.616] (-1228.774) (-1226.441) (-1228.567) * (-1232.215) [-1229.250] (-1229.035) (-1226.926) -- 0:00:09
852000 -- (-1227.840) (-1229.092) [-1226.035] (-1227.896) * (-1230.766) (-1228.124) [-1227.530] (-1227.153) -- 0:00:09
852500 -- (-1227.815) (-1228.113) [-1226.701] (-1226.759) * (-1228.067) [-1227.961] (-1227.729) (-1227.766) -- 0:00:09
853000 -- (-1226.507) [-1228.012] (-1228.481) (-1226.338) * [-1227.142] (-1228.869) (-1228.489) (-1230.922) -- 0:00:09
853500 -- (-1227.939) (-1226.587) [-1233.635] (-1228.460) * (-1230.379) (-1231.738) [-1229.657] (-1231.493) -- 0:00:09
854000 -- (-1227.435) (-1226.463) (-1227.760) [-1227.598] * (-1228.640) [-1227.881] (-1227.089) (-1229.810) -- 0:00:09
854500 -- (-1229.056) (-1231.590) [-1226.680] (-1228.229) * (-1227.882) [-1227.275] (-1228.178) (-1226.851) -- 0:00:09
855000 -- [-1228.866] (-1232.568) (-1229.724) (-1228.171) * (-1227.866) (-1227.257) [-1226.949] (-1227.715) -- 0:00:09
Average standard deviation of split frequencies: 0.007086
855500 -- [-1229.001] (-1234.536) (-1227.862) (-1227.293) * (-1228.693) (-1227.134) (-1227.518) [-1228.557] -- 0:00:09
856000 -- (-1228.767) [-1233.404] (-1227.963) (-1228.901) * [-1229.674] (-1227.134) (-1228.783) (-1228.980) -- 0:00:09
856500 -- (-1227.602) (-1228.960) [-1228.049] (-1227.389) * (-1230.919) (-1229.578) (-1228.847) [-1229.506] -- 0:00:09
857000 -- (-1228.562) [-1229.112] (-1233.613) (-1226.507) * [-1226.513] (-1229.906) (-1228.832) (-1228.821) -- 0:00:09
857500 -- (-1227.418) (-1227.336) (-1229.913) [-1231.435] * (-1226.442) (-1229.707) [-1226.493] (-1228.670) -- 0:00:08
858000 -- [-1227.722] (-1227.454) (-1228.885) (-1229.291) * [-1228.423] (-1229.997) (-1229.119) (-1230.198) -- 0:00:08
858500 -- (-1228.174) (-1228.489) (-1229.333) [-1228.523] * [-1229.108] (-1231.587) (-1227.783) (-1230.194) -- 0:00:08
859000 -- (-1228.965) (-1230.534) [-1227.847] (-1228.249) * (-1229.723) (-1232.142) [-1229.618] (-1230.170) -- 0:00:08
859500 -- (-1229.890) [-1229.331] (-1228.671) (-1230.855) * (-1227.307) [-1229.376] (-1229.782) (-1229.727) -- 0:00:08
860000 -- (-1228.780) (-1230.260) (-1233.912) [-1228.659] * (-1227.591) (-1227.340) [-1229.570] (-1226.948) -- 0:00:08
Average standard deviation of split frequencies: 0.006974
860500 -- (-1227.735) [-1231.430] (-1234.805) (-1227.336) * (-1228.626) (-1227.529) [-1228.248] (-1231.292) -- 0:00:08
861000 -- (-1229.335) (-1238.249) [-1229.293] (-1226.930) * (-1227.812) (-1228.728) (-1228.424) [-1227.978] -- 0:00:08
861500 -- (-1226.993) (-1229.446) (-1235.253) [-1229.913] * [-1229.984] (-1228.565) (-1229.293) (-1230.560) -- 0:00:08
862000 -- (-1227.302) (-1229.454) (-1229.165) [-1226.854] * (-1226.543) (-1231.000) [-1227.485] (-1227.315) -- 0:00:08
862500 -- (-1227.155) [-1228.609] (-1226.872) (-1226.913) * (-1227.362) (-1227.643) [-1227.909] (-1228.660) -- 0:00:08
863000 -- (-1227.424) (-1227.312) [-1228.797] (-1227.295) * (-1229.232) [-1227.169] (-1228.684) (-1229.412) -- 0:00:08
863500 -- (-1227.588) (-1226.394) (-1232.426) [-1227.226] * (-1227.271) (-1230.186) [-1229.081] (-1229.952) -- 0:00:08
864000 -- (-1234.524) [-1227.218] (-1232.391) (-1229.040) * (-1228.121) (-1230.314) [-1227.958] (-1227.516) -- 0:00:08
864500 -- (-1231.626) (-1226.139) [-1228.446] (-1228.076) * (-1226.936) [-1229.658] (-1227.652) (-1226.916) -- 0:00:08
865000 -- [-1231.624] (-1227.355) (-1229.590) (-1229.930) * [-1227.007] (-1228.328) (-1227.923) (-1226.935) -- 0:00:08
Average standard deviation of split frequencies: 0.006968
865500 -- (-1227.872) (-1229.321) (-1230.519) [-1230.720] * (-1227.754) (-1230.735) [-1228.740] (-1228.197) -- 0:00:08
866000 -- (-1227.380) (-1228.546) (-1229.939) [-1228.700] * (-1231.496) (-1228.449) [-1226.710] (-1228.054) -- 0:00:08
866500 -- [-1227.526] (-1229.502) (-1233.421) (-1229.836) * (-1233.979) [-1228.743] (-1230.008) (-1230.073) -- 0:00:08
867000 -- (-1226.847) [-1227.399] (-1227.989) (-1228.620) * (-1227.284) (-1227.282) (-1228.160) [-1229.533] -- 0:00:08
867500 -- (-1229.175) [-1227.044] (-1227.632) (-1228.868) * [-1227.380] (-1228.123) (-1229.399) (-1227.538) -- 0:00:08
868000 -- [-1229.544] (-1228.752) (-1228.014) (-1227.210) * (-1230.822) (-1232.061) [-1228.334] (-1228.452) -- 0:00:08
868500 -- (-1228.108) (-1228.801) [-1227.074] (-1228.200) * [-1229.330] (-1228.714) (-1227.779) (-1228.158) -- 0:00:08
869000 -- [-1226.636] (-1229.925) (-1227.022) (-1229.955) * (-1227.554) [-1231.152] (-1227.886) (-1227.891) -- 0:00:08
869500 -- [-1228.907] (-1229.772) (-1231.236) (-1226.964) * (-1226.866) (-1228.896) (-1232.109) [-1227.030] -- 0:00:08
870000 -- (-1230.067) [-1229.671] (-1233.175) (-1227.230) * (-1227.912) (-1228.447) [-1226.168] (-1227.040) -- 0:00:08
Average standard deviation of split frequencies: 0.007147
870500 -- (-1226.379) [-1227.661] (-1231.383) (-1229.723) * [-1227.962] (-1230.588) (-1226.158) (-1226.778) -- 0:00:08
871000 -- [-1226.803] (-1228.647) (-1229.673) (-1230.950) * (-1228.220) (-1229.703) [-1226.566] (-1227.890) -- 0:00:08
871500 -- [-1227.186] (-1229.597) (-1231.368) (-1231.284) * (-1230.263) (-1226.913) [-1226.323] (-1230.217) -- 0:00:08
872000 -- (-1227.469) [-1228.778] (-1230.189) (-1228.191) * (-1229.071) (-1226.768) (-1227.788) [-1231.114] -- 0:00:08
872500 -- (-1234.720) [-1227.550] (-1230.003) (-1227.468) * (-1228.390) (-1230.210) (-1231.199) [-1228.806] -- 0:00:08
873000 -- (-1230.508) [-1229.982] (-1230.429) (-1230.598) * (-1230.877) [-1226.745] (-1229.307) (-1232.648) -- 0:00:08
873500 -- (-1227.228) (-1228.463) (-1229.319) [-1227.831] * (-1231.264) [-1226.535] (-1229.106) (-1229.796) -- 0:00:07
874000 -- [-1230.091] (-1228.336) (-1227.748) (-1228.155) * [-1227.316] (-1227.789) (-1227.765) (-1230.415) -- 0:00:07
874500 -- (-1231.060) [-1229.585] (-1227.408) (-1226.465) * (-1227.099) (-1227.664) [-1227.785] (-1227.906) -- 0:00:07
875000 -- [-1228.995] (-1230.734) (-1229.168) (-1228.631) * (-1231.503) (-1230.553) [-1227.124] (-1227.582) -- 0:00:07
Average standard deviation of split frequencies: 0.007354
875500 -- (-1233.791) (-1233.456) [-1227.311] (-1228.541) * (-1229.337) [-1227.466] (-1228.865) (-1227.987) -- 0:00:07
876000 -- (-1228.071) [-1227.942] (-1229.931) (-1230.653) * (-1230.659) (-1230.194) [-1227.721] (-1229.385) -- 0:00:07
876500 -- (-1227.059) (-1232.452) (-1230.990) [-1228.646] * (-1231.085) (-1230.515) (-1230.661) [-1226.546] -- 0:00:07
877000 -- (-1230.199) (-1229.402) (-1228.367) [-1230.697] * [-1227.008] (-1230.205) (-1231.075) (-1227.907) -- 0:00:07
877500 -- (-1228.999) (-1229.208) (-1228.041) [-1230.620] * [-1226.840] (-1228.126) (-1226.811) (-1227.974) -- 0:00:07
878000 -- (-1227.785) (-1233.051) (-1229.631) [-1231.819] * (-1228.074) (-1228.381) [-1232.862] (-1228.355) -- 0:00:07
878500 -- (-1227.577) (-1229.999) (-1227.239) [-1229.079] * (-1232.890) (-1230.470) (-1228.556) [-1230.491] -- 0:00:07
879000 -- (-1230.496) (-1231.433) [-1227.077] (-1230.775) * [-1227.768] (-1236.972) (-1227.165) (-1227.819) -- 0:00:07
879500 -- (-1230.748) (-1229.089) (-1229.392) [-1228.225] * (-1230.921) (-1236.402) (-1227.611) [-1226.162] -- 0:00:07
880000 -- (-1227.692) [-1227.886] (-1229.176) (-1228.624) * (-1229.909) [-1227.469] (-1230.932) (-1229.679) -- 0:00:07
Average standard deviation of split frequencies: 0.007494
880500 -- (-1229.197) (-1228.223) [-1227.440] (-1227.892) * (-1228.638) (-1227.433) [-1226.926] (-1229.894) -- 0:00:07
881000 -- (-1228.287) (-1229.430) (-1229.272) [-1228.153] * (-1228.778) (-1226.609) [-1229.619] (-1230.694) -- 0:00:07
881500 -- (-1232.301) [-1229.111] (-1229.371) (-1228.502) * [-1227.399] (-1229.596) (-1229.191) (-1228.241) -- 0:00:07
882000 -- (-1230.906) (-1232.466) [-1230.949] (-1228.753) * [-1227.112] (-1230.010) (-1229.350) (-1227.790) -- 0:00:07
882500 -- (-1232.484) (-1233.395) [-1227.468] (-1227.126) * (-1228.856) (-1230.926) [-1227.283] (-1228.480) -- 0:00:07
883000 -- (-1228.891) (-1230.967) [-1229.181] (-1227.069) * [-1229.555] (-1228.697) (-1226.172) (-1230.279) -- 0:00:07
883500 -- (-1227.237) [-1230.904] (-1227.454) (-1227.267) * [-1229.014] (-1229.460) (-1227.359) (-1227.935) -- 0:00:07
884000 -- (-1228.733) (-1231.164) [-1228.735] (-1227.584) * (-1228.422) [-1228.780] (-1228.706) (-1229.182) -- 0:00:07
884500 -- (-1231.409) (-1229.214) (-1230.491) [-1227.872] * (-1228.978) [-1229.143] (-1228.689) (-1229.852) -- 0:00:07
885000 -- (-1229.391) (-1229.131) [-1230.718] (-1229.311) * (-1228.008) [-1229.841] (-1234.680) (-1229.442) -- 0:00:07
Average standard deviation of split frequencies: 0.007874
885500 -- (-1226.927) (-1227.551) [-1230.169] (-1229.826) * (-1232.097) [-1228.407] (-1231.350) (-1232.127) -- 0:00:07
886000 -- [-1226.337] (-1227.587) (-1228.892) (-1227.026) * (-1228.654) [-1232.548] (-1229.621) (-1229.518) -- 0:00:07
886500 -- (-1227.875) (-1227.420) (-1227.185) [-1229.859] * (-1228.587) (-1233.427) (-1228.832) [-1228.220] -- 0:00:07
887000 -- (-1228.068) (-1226.268) (-1226.314) [-1227.793] * (-1227.438) (-1229.228) (-1231.210) [-1227.673] -- 0:00:07
887500 -- (-1227.966) (-1232.656) [-1227.339] (-1230.339) * [-1227.755] (-1226.421) (-1232.640) (-1226.831) -- 0:00:07
888000 -- (-1228.148) (-1232.599) (-1229.183) [-1227.574] * (-1227.770) [-1227.092] (-1230.762) (-1230.068) -- 0:00:07
888500 -- (-1230.301) (-1232.951) (-1227.887) [-1227.489] * (-1229.130) (-1228.165) (-1231.327) [-1227.198] -- 0:00:07
889000 -- [-1226.777] (-1228.437) (-1228.560) (-1228.194) * [-1229.207] (-1228.485) (-1230.862) (-1227.357) -- 0:00:06
889500 -- [-1227.302] (-1228.462) (-1228.532) (-1226.669) * (-1227.771) [-1227.067] (-1229.324) (-1227.600) -- 0:00:06
890000 -- [-1227.776] (-1226.278) (-1227.670) (-1229.721) * (-1227.508) [-1230.782] (-1229.328) (-1231.102) -- 0:00:06
Average standard deviation of split frequencies: 0.008045
890500 -- (-1228.832) [-1226.874] (-1227.818) (-1229.603) * (-1230.811) (-1229.318) [-1228.742] (-1228.817) -- 0:00:06
891000 -- (-1229.353) (-1230.610) [-1228.771] (-1229.547) * (-1230.527) [-1227.664] (-1228.937) (-1228.681) -- 0:00:06
891500 -- [-1227.843] (-1227.223) (-1227.475) (-1231.801) * [-1228.858] (-1228.374) (-1230.091) (-1227.543) -- 0:00:06
892000 -- [-1227.116] (-1229.113) (-1228.761) (-1227.543) * (-1228.523) [-1227.735] (-1228.036) (-1228.864) -- 0:00:06
892500 -- (-1227.499) (-1228.549) (-1229.677) [-1229.214] * (-1227.363) (-1228.007) (-1228.586) [-1226.713] -- 0:00:06
893000 -- [-1227.952] (-1228.364) (-1230.819) (-1233.516) * (-1229.794) [-1229.311] (-1228.003) (-1226.987) -- 0:00:06
893500 -- (-1229.217) [-1229.118] (-1227.591) (-1227.648) * (-1229.470) [-1228.588] (-1228.376) (-1226.745) -- 0:00:06
894000 -- (-1227.259) [-1226.960] (-1231.039) (-1226.586) * (-1230.468) (-1227.854) (-1228.211) [-1227.461] -- 0:00:06
894500 -- (-1227.964) (-1226.683) [-1227.303] (-1229.001) * (-1227.250) (-1230.611) [-1228.088] (-1230.224) -- 0:00:06
895000 -- (-1227.229) [-1227.837] (-1227.081) (-1227.266) * (-1230.426) (-1228.271) (-1229.475) [-1227.203] -- 0:00:06
Average standard deviation of split frequencies: 0.008348
895500 -- (-1229.264) (-1232.394) (-1227.651) [-1229.112] * (-1231.629) [-1228.618] (-1227.077) (-1233.026) -- 0:00:06
896000 -- (-1229.649) (-1229.214) (-1227.738) [-1228.522] * [-1229.293] (-1228.881) (-1227.137) (-1227.948) -- 0:00:06
896500 -- (-1229.557) [-1227.303] (-1226.297) (-1227.999) * (-1231.091) [-1228.409] (-1228.050) (-1229.975) -- 0:00:06
897000 -- (-1228.642) (-1230.133) (-1228.471) [-1227.914] * (-1228.613) [-1229.459] (-1228.108) (-1228.179) -- 0:00:06
897500 -- (-1227.089) [-1226.685] (-1226.577) (-1228.846) * [-1227.444] (-1229.113) (-1229.205) (-1230.718) -- 0:00:06
898000 -- (-1229.838) (-1227.496) (-1227.411) [-1227.230] * (-1228.476) [-1227.245] (-1236.312) (-1227.841) -- 0:00:06
898500 -- (-1227.437) [-1227.604] (-1226.613) (-1227.114) * (-1227.414) (-1228.288) [-1229.454] (-1227.433) -- 0:00:06
899000 -- [-1228.423] (-1228.198) (-1227.173) (-1227.442) * [-1226.348] (-1228.522) (-1229.532) (-1228.062) -- 0:00:06
899500 -- (-1228.480) (-1228.826) (-1228.796) [-1227.600] * (-1227.482) (-1235.207) [-1228.665] (-1229.003) -- 0:00:06
900000 -- (-1228.816) (-1226.665) [-1230.465] (-1228.097) * (-1229.011) (-1235.247) (-1227.167) [-1229.193] -- 0:00:06
Average standard deviation of split frequencies: 0.008060
900500 -- (-1227.586) (-1229.379) (-1226.869) [-1228.252] * (-1232.168) (-1230.007) (-1226.610) [-1227.916] -- 0:00:06
901000 -- [-1231.186] (-1226.237) (-1226.921) (-1227.576) * (-1227.610) (-1235.250) [-1226.465] (-1227.561) -- 0:00:06
901500 -- [-1228.218] (-1229.848) (-1228.395) (-1228.087) * [-1227.326] (-1230.365) (-1231.187) (-1228.747) -- 0:00:06
902000 -- (-1229.667) [-1227.629] (-1231.769) (-1231.878) * (-1230.043) (-1229.037) (-1230.991) [-1226.638] -- 0:00:06
902500 -- [-1226.758] (-1230.372) (-1229.912) (-1229.219) * (-1229.779) [-1229.143] (-1226.773) (-1232.022) -- 0:00:06
903000 -- (-1226.887) [-1231.685] (-1232.372) (-1231.924) * (-1230.292) (-1226.943) [-1228.509] (-1230.146) -- 0:00:06
903500 -- (-1226.913) (-1231.706) [-1227.063] (-1228.543) * [-1226.984] (-1231.816) (-1228.422) (-1229.077) -- 0:00:06
904000 -- (-1237.255) [-1229.677] (-1226.907) (-1229.737) * [-1226.268] (-1227.545) (-1226.785) (-1232.109) -- 0:00:06
904500 -- [-1229.855] (-1228.276) (-1227.982) (-1228.913) * (-1237.455) (-1227.681) [-1230.636] (-1228.946) -- 0:00:06
905000 -- (-1229.738) (-1228.079) (-1229.599) [-1227.553] * (-1230.536) [-1227.339] (-1228.215) (-1227.623) -- 0:00:05
Average standard deviation of split frequencies: 0.008013
905500 -- (-1231.214) (-1229.012) [-1229.092] (-1227.113) * [-1230.774] (-1227.900) (-1228.018) (-1231.052) -- 0:00:05
906000 -- [-1228.782] (-1228.198) (-1230.341) (-1228.834) * (-1228.597) (-1229.523) [-1228.103] (-1227.753) -- 0:00:05
906500 -- [-1227.493] (-1232.770) (-1228.274) (-1228.778) * (-1227.435) [-1230.713] (-1227.929) (-1227.157) -- 0:00:05
907000 -- (-1227.158) (-1230.465) [-1227.360] (-1229.499) * (-1230.726) [-1229.648] (-1227.207) (-1230.313) -- 0:00:05
907500 -- [-1226.805] (-1226.953) (-1226.615) (-1230.888) * [-1228.656] (-1233.442) (-1227.153) (-1229.758) -- 0:00:05
908000 -- (-1231.657) (-1228.188) [-1226.602] (-1228.947) * (-1228.527) (-1230.946) [-1226.830] (-1227.940) -- 0:00:05
908500 -- (-1231.530) [-1227.488] (-1228.528) (-1229.312) * (-1229.461) (-1228.974) [-1226.973] (-1226.723) -- 0:00:05
909000 -- (-1229.611) (-1229.843) (-1228.366) [-1231.409] * (-1232.068) (-1231.975) [-1229.187] (-1227.304) -- 0:00:05
909500 -- (-1228.496) [-1235.174] (-1231.467) (-1229.460) * (-1228.116) (-1227.849) [-1226.977] (-1226.918) -- 0:00:05
910000 -- (-1227.200) (-1228.436) (-1229.850) [-1226.258] * (-1228.221) (-1228.768) (-1227.511) [-1227.224] -- 0:00:05
Average standard deviation of split frequencies: 0.008282
910500 -- [-1226.731] (-1228.684) (-1231.625) (-1229.046) * (-1226.866) (-1228.566) [-1228.090] (-1231.831) -- 0:00:05
911000 -- [-1227.801] (-1228.803) (-1229.713) (-1229.231) * (-1229.448) [-1229.538] (-1226.521) (-1229.416) -- 0:00:05
911500 -- (-1228.886) (-1228.934) (-1228.848) [-1227.381] * [-1230.561] (-1230.153) (-1227.085) (-1229.185) -- 0:00:05
912000 -- (-1227.590) (-1229.268) [-1227.654] (-1226.467) * (-1227.798) (-1228.709) (-1226.889) [-1226.578] -- 0:00:05
912500 -- [-1227.553] (-1226.976) (-1226.434) (-1230.365) * [-1230.296] (-1226.707) (-1229.628) (-1226.424) -- 0:00:05
913000 -- [-1227.285] (-1227.936) (-1227.068) (-1227.897) * (-1228.727) (-1232.027) [-1227.918] (-1230.056) -- 0:00:05
913500 -- (-1231.745) [-1226.916] (-1227.051) (-1230.938) * (-1236.865) (-1228.612) [-1228.381] (-1227.543) -- 0:00:05
914000 -- (-1229.574) (-1228.528) [-1228.506] (-1228.086) * [-1229.800] (-1227.413) (-1228.643) (-1227.029) -- 0:00:05
914500 -- (-1229.923) (-1230.355) [-1228.947] (-1228.405) * (-1227.595) (-1228.980) (-1231.428) [-1226.577] -- 0:00:05
915000 -- (-1228.988) (-1230.602) (-1231.893) [-1226.782] * (-1230.894) (-1227.753) (-1228.683) [-1227.580] -- 0:00:05
Average standard deviation of split frequencies: 0.008577
915500 -- (-1232.661) (-1229.829) (-1227.905) [-1229.362] * (-1233.025) [-1227.491] (-1228.567) (-1229.095) -- 0:00:05
916000 -- (-1227.068) (-1228.272) [-1228.035] (-1229.031) * (-1228.057) (-1227.602) (-1228.381) [-1229.024] -- 0:00:05
916500 -- [-1230.948] (-1226.922) (-1228.395) (-1227.650) * (-1228.015) (-1231.003) (-1227.010) [-1229.056] -- 0:00:05
917000 -- (-1227.217) [-1226.799] (-1231.193) (-1228.090) * (-1229.449) (-1227.742) (-1229.441) [-1228.846] -- 0:00:05
917500 -- (-1228.042) (-1226.634) (-1232.448) [-1232.846] * (-1228.523) [-1228.810] (-1228.169) (-1227.685) -- 0:00:05
918000 -- [-1230.565] (-1227.897) (-1231.649) (-1227.287) * (-1226.480) (-1227.701) [-1226.207] (-1226.841) -- 0:00:05
918500 -- (-1233.163) [-1227.115] (-1227.261) (-1232.328) * [-1228.972] (-1229.397) (-1226.292) (-1228.960) -- 0:00:05
919000 -- (-1229.706) [-1226.666] (-1226.625) (-1228.756) * [-1226.788] (-1229.425) (-1228.983) (-1228.501) -- 0:00:05
919500 -- (-1229.714) [-1227.190] (-1226.788) (-1232.068) * [-1227.870] (-1232.309) (-1227.209) (-1227.514) -- 0:00:05
920000 -- (-1227.900) [-1231.157] (-1226.395) (-1231.766) * (-1228.430) (-1228.252) (-1227.781) [-1229.096] -- 0:00:05
Average standard deviation of split frequencies: 0.008500
920500 -- (-1226.329) (-1226.102) [-1227.326] (-1229.292) * (-1226.831) (-1231.854) (-1226.690) [-1227.020] -- 0:00:05
921000 -- (-1228.068) (-1227.409) [-1227.662] (-1229.263) * (-1226.271) (-1230.201) (-1226.595) [-1227.172] -- 0:00:04
921500 -- (-1234.861) (-1228.212) (-1230.495) [-1230.975] * (-1226.252) [-1230.204] (-1226.609) (-1227.644) -- 0:00:04
922000 -- (-1230.564) [-1228.348] (-1228.164) (-1228.411) * [-1226.711] (-1229.095) (-1226.712) (-1230.659) -- 0:00:04
922500 -- [-1226.730] (-1228.060) (-1228.682) (-1228.179) * (-1228.046) (-1228.371) [-1228.888] (-1228.215) -- 0:00:04
923000 -- (-1228.642) (-1227.334) (-1227.165) [-1228.291] * (-1230.496) [-1232.540] (-1228.839) (-1226.404) -- 0:00:04
923500 -- [-1232.395] (-1226.982) (-1226.809) (-1228.731) * [-1229.485] (-1232.370) (-1227.129) (-1229.051) -- 0:00:04
924000 -- (-1234.260) (-1226.786) (-1226.524) [-1232.826] * (-1229.120) [-1231.188] (-1228.752) (-1228.181) -- 0:00:04
924500 -- (-1227.217) [-1227.949] (-1228.301) (-1228.019) * [-1226.741] (-1229.129) (-1227.309) (-1229.109) -- 0:00:04
925000 -- [-1226.614] (-1231.818) (-1228.877) (-1227.323) * (-1230.460) (-1228.920) [-1226.556] (-1230.901) -- 0:00:04
Average standard deviation of split frequencies: 0.008451
925500 -- (-1227.672) (-1227.306) (-1228.322) [-1228.955] * (-1229.842) (-1228.953) (-1228.704) [-1226.960] -- 0:00:04
926000 -- (-1228.192) (-1227.309) [-1227.219] (-1233.215) * (-1234.717) (-1227.530) (-1231.382) [-1227.382] -- 0:00:04
926500 -- [-1227.835] (-1227.636) (-1229.093) (-1230.786) * (-1226.481) (-1227.417) [-1231.774] (-1228.136) -- 0:00:04
927000 -- [-1228.457] (-1228.571) (-1229.630) (-1233.459) * (-1227.325) (-1228.004) (-1231.494) [-1226.538] -- 0:00:04
927500 -- (-1227.080) [-1227.152] (-1230.505) (-1229.681) * (-1227.486) (-1229.206) [-1229.765] (-1227.858) -- 0:00:04
928000 -- [-1226.671] (-1232.103) (-1230.822) (-1227.114) * (-1229.579) (-1231.680) (-1228.836) [-1226.913] -- 0:00:04
928500 -- (-1226.811) [-1228.864] (-1230.607) (-1228.380) * (-1228.259) (-1226.909) (-1227.707) [-1226.977] -- 0:00:04
929000 -- (-1228.054) [-1226.875] (-1230.062) (-1226.308) * (-1228.934) [-1228.500] (-1230.637) (-1232.620) -- 0:00:04
929500 -- (-1232.260) (-1229.711) (-1227.197) [-1228.722] * [-1229.203] (-1230.942) (-1229.012) (-1228.487) -- 0:00:04
930000 -- [-1228.050] (-1227.406) (-1226.480) (-1228.973) * [-1227.891] (-1229.709) (-1228.482) (-1228.274) -- 0:00:04
Average standard deviation of split frequencies: 0.008476
930500 -- [-1226.712] (-1228.234) (-1226.567) (-1228.612) * (-1230.229) (-1229.951) (-1229.499) [-1228.461] -- 0:00:04
931000 -- (-1226.907) (-1226.355) (-1228.910) [-1228.804] * (-1231.565) (-1230.064) [-1226.242] (-1228.339) -- 0:00:04
931500 -- [-1228.666] (-1230.222) (-1227.466) (-1229.851) * (-1227.371) [-1231.545] (-1229.644) (-1227.879) -- 0:00:04
932000 -- (-1230.392) (-1229.572) [-1228.364] (-1228.202) * (-1226.941) (-1227.123) [-1229.950] (-1229.670) -- 0:00:04
932500 -- [-1229.818] (-1229.936) (-1227.332) (-1226.936) * (-1227.622) (-1229.385) (-1227.577) [-1228.728] -- 0:00:04
933000 -- (-1230.068) (-1227.827) [-1227.588] (-1226.629) * (-1231.965) (-1232.482) (-1226.698) [-1228.190] -- 0:00:04
933500 -- (-1227.392) [-1231.240] (-1232.237) (-1226.556) * (-1231.448) (-1232.723) (-1228.906) [-1227.664] -- 0:00:04
934000 -- [-1228.675] (-1229.861) (-1234.597) (-1227.614) * (-1229.003) [-1231.996] (-1231.761) (-1227.751) -- 0:00:04
934500 -- [-1228.725] (-1228.793) (-1230.571) (-1227.711) * [-1228.428] (-1227.077) (-1229.984) (-1227.983) -- 0:00:04
935000 -- (-1227.301) (-1228.895) (-1230.117) [-1228.112] * (-1228.395) (-1229.274) (-1227.529) [-1228.625] -- 0:00:04
Average standard deviation of split frequencies: 0.008360
935500 -- [-1229.498] (-1227.135) (-1233.281) (-1229.330) * (-1227.083) [-1227.043] (-1227.011) (-1229.825) -- 0:00:04
936000 -- (-1230.661) (-1227.263) (-1229.265) [-1226.614] * (-1229.904) (-1229.071) (-1227.319) [-1226.466] -- 0:00:04
936500 -- [-1233.404] (-1227.844) (-1230.150) (-1226.452) * (-1231.307) (-1226.763) (-1227.182) [-1226.521] -- 0:00:04
937000 -- (-1230.625) [-1228.831] (-1228.543) (-1228.009) * (-1228.039) (-1231.632) (-1230.337) [-1228.662] -- 0:00:03
937500 -- (-1230.271) [-1229.704] (-1229.928) (-1228.640) * (-1227.076) (-1229.630) [-1227.945] (-1230.317) -- 0:00:03
938000 -- (-1228.979) (-1231.345) [-1229.383] (-1231.738) * (-1232.879) (-1229.518) [-1227.091] (-1227.737) -- 0:00:03
938500 -- (-1227.462) [-1228.601] (-1231.178) (-1228.278) * (-1226.714) [-1229.812] (-1227.900) (-1227.726) -- 0:00:03
939000 -- (-1227.105) (-1228.600) [-1229.422] (-1226.938) * (-1231.360) (-1229.334) (-1230.988) [-1227.247] -- 0:00:03
939500 -- (-1226.440) (-1227.504) (-1228.755) [-1227.461] * (-1227.566) (-1229.599) (-1229.641) [-1227.702] -- 0:00:03
940000 -- (-1227.589) [-1226.890] (-1226.679) (-1227.591) * (-1228.798) (-1229.338) [-1227.769] (-1228.540) -- 0:00:03
Average standard deviation of split frequencies: 0.007885
940500 -- (-1229.390) (-1228.327) [-1231.870] (-1228.215) * (-1230.050) (-1230.620) (-1227.335) [-1228.289] -- 0:00:03
941000 -- (-1230.499) (-1228.883) [-1227.439] (-1231.807) * (-1228.609) [-1231.755] (-1228.389) (-1228.074) -- 0:00:03
941500 -- (-1233.069) (-1232.418) (-1226.624) [-1227.469] * (-1227.155) (-1226.806) [-1227.724] (-1226.417) -- 0:00:03
942000 -- (-1233.603) (-1226.143) (-1226.455) [-1227.334] * (-1229.593) [-1226.350] (-1227.014) (-1227.890) -- 0:00:03
942500 -- (-1231.709) (-1227.093) (-1227.571) [-1227.663] * (-1229.718) (-1226.833) (-1229.041) [-1227.779] -- 0:00:03
943000 -- (-1228.420) [-1227.416] (-1227.838) (-1226.935) * [-1230.647] (-1227.780) (-1229.019) (-1229.055) -- 0:00:03
943500 -- (-1230.507) (-1227.779) (-1232.798) [-1230.456] * (-1231.362) [-1231.718] (-1228.713) (-1228.414) -- 0:00:03
944000 -- (-1231.725) (-1227.780) [-1226.786] (-1227.803) * (-1229.046) [-1227.463] (-1229.221) (-1227.295) -- 0:00:03
944500 -- (-1232.623) [-1228.615] (-1226.931) (-1227.673) * (-1228.746) [-1230.119] (-1226.940) (-1226.721) -- 0:00:03
945000 -- [-1229.712] (-1227.343) (-1226.838) (-1227.487) * (-1228.161) (-1229.342) [-1227.707] (-1226.597) -- 0:00:03
Average standard deviation of split frequencies: 0.007541
945500 -- (-1227.569) (-1229.131) [-1227.066] (-1233.657) * [-1230.250] (-1230.589) (-1229.657) (-1228.508) -- 0:00:03
946000 -- (-1229.104) (-1226.976) (-1229.527) [-1228.373] * (-1228.903) (-1230.735) [-1228.803] (-1228.051) -- 0:00:03
946500 -- (-1228.069) (-1227.085) (-1230.993) [-1229.443] * (-1233.454) (-1236.320) (-1227.853) [-1226.783] -- 0:00:03
947000 -- [-1227.061] (-1228.977) (-1230.549) (-1227.166) * (-1226.761) (-1228.559) [-1230.270] (-1228.475) -- 0:00:03
947500 -- (-1228.505) (-1231.263) [-1228.202] (-1229.125) * [-1229.777] (-1232.179) (-1227.763) (-1228.742) -- 0:00:03
948000 -- [-1227.905] (-1227.467) (-1227.181) (-1228.227) * (-1234.890) [-1227.631] (-1230.429) (-1231.818) -- 0:00:03
948500 -- (-1232.763) [-1227.327] (-1228.139) (-1232.365) * [-1229.126] (-1229.153) (-1226.950) (-1229.036) -- 0:00:03
949000 -- [-1226.577] (-1228.416) (-1228.493) (-1230.373) * (-1230.266) [-1226.862] (-1227.389) (-1228.089) -- 0:00:03
949500 -- [-1230.282] (-1232.288) (-1230.594) (-1231.164) * [-1228.200] (-1228.003) (-1229.430) (-1228.340) -- 0:00:03
950000 -- [-1228.556] (-1230.002) (-1229.730) (-1227.906) * (-1227.287) (-1227.563) (-1227.230) [-1229.164] -- 0:00:03
Average standard deviation of split frequencies: 0.007074
950500 -- (-1227.271) [-1230.296] (-1226.925) (-1228.288) * [-1229.945] (-1226.772) (-1229.623) (-1226.441) -- 0:00:03
951000 -- (-1227.716) (-1227.358) (-1231.851) [-1229.003] * (-1228.923) (-1230.307) (-1230.431) [-1227.188] -- 0:00:03
951500 -- (-1228.024) (-1229.888) (-1229.376) [-1229.079] * (-1230.650) (-1228.224) [-1231.857] (-1226.637) -- 0:00:03
952000 -- [-1229.377] (-1229.883) (-1229.265) (-1228.330) * [-1228.583] (-1229.733) (-1229.533) (-1230.459) -- 0:00:03
952500 -- (-1228.405) (-1231.075) (-1233.388) [-1229.038] * (-1228.225) (-1234.047) (-1227.738) [-1228.459] -- 0:00:02
953000 -- (-1231.001) (-1230.227) [-1231.361] (-1230.540) * [-1228.418] (-1228.901) (-1227.651) (-1227.393) -- 0:00:02
953500 -- (-1233.071) (-1228.525) (-1232.227) [-1227.930] * [-1228.471] (-1228.161) (-1229.812) (-1227.161) -- 0:00:02
954000 -- (-1228.118) (-1228.249) (-1228.771) [-1227.427] * (-1230.457) (-1227.313) (-1227.748) [-1228.066] -- 0:00:02
954500 -- (-1228.927) [-1228.082] (-1228.593) (-1227.913) * (-1229.287) (-1226.751) (-1226.933) [-1228.970] -- 0:00:02
955000 -- [-1227.159] (-1229.165) (-1229.039) (-1227.135) * [-1230.126] (-1227.232) (-1227.409) (-1231.548) -- 0:00:02
Average standard deviation of split frequencies: 0.007429
955500 -- (-1229.799) (-1227.477) [-1227.515] (-1231.099) * [-1229.636] (-1227.315) (-1229.785) (-1228.160) -- 0:00:02
956000 -- (-1230.304) (-1226.417) [-1229.358] (-1228.524) * (-1230.298) (-1229.207) [-1227.018] (-1230.352) -- 0:00:02
956500 -- (-1226.253) (-1226.701) [-1229.546] (-1231.639) * [-1227.990] (-1230.203) (-1230.635) (-1228.295) -- 0:00:02
957000 -- (-1227.996) [-1227.155] (-1227.665) (-1230.566) * (-1230.421) (-1231.182) [-1226.723] (-1229.422) -- 0:00:02
957500 -- (-1227.401) (-1232.319) [-1228.192] (-1226.890) * (-1229.343) (-1229.317) [-1228.336] (-1232.437) -- 0:00:02
958000 -- [-1227.198] (-1235.465) (-1227.985) (-1226.305) * (-1231.478) (-1228.358) [-1229.228] (-1226.461) -- 0:00:02
958500 -- [-1226.909] (-1226.829) (-1228.090) (-1229.491) * (-1226.662) [-1226.815] (-1227.510) (-1226.662) -- 0:00:02
959000 -- (-1226.728) (-1227.388) (-1228.762) [-1229.124] * (-1228.597) [-1226.154] (-1227.019) (-1226.579) -- 0:00:02
959500 -- (-1227.587) (-1228.703) [-1229.661] (-1228.836) * (-1230.290) (-1228.976) (-1226.875) [-1226.981] -- 0:00:02
960000 -- [-1228.802] (-1229.375) (-1227.456) (-1228.323) * (-1227.539) [-1230.635] (-1227.150) (-1227.233) -- 0:00:02
Average standard deviation of split frequencies: 0.007295
960500 -- [-1227.716] (-1231.848) (-1229.586) (-1230.013) * [-1229.439] (-1227.566) (-1229.772) (-1231.302) -- 0:00:02
961000 -- (-1227.466) (-1227.405) [-1227.714] (-1229.899) * [-1226.889] (-1229.234) (-1228.734) (-1227.256) -- 0:00:02
961500 -- (-1228.130) (-1228.689) (-1226.909) [-1227.870] * (-1227.346) [-1226.428] (-1229.768) (-1229.733) -- 0:00:02
962000 -- (-1229.891) (-1229.124) [-1229.216] (-1226.532) * (-1227.022) [-1227.971] (-1229.531) (-1230.967) -- 0:00:02
962500 -- (-1232.031) (-1227.883) (-1229.908) [-1228.434] * (-1231.617) (-1229.602) [-1227.420] (-1232.531) -- 0:00:02
963000 -- [-1227.382] (-1228.890) (-1230.788) (-1230.461) * [-1230.074] (-1226.513) (-1228.370) (-1229.928) -- 0:00:02
963500 -- [-1228.113] (-1228.878) (-1230.933) (-1230.297) * (-1227.502) [-1227.604] (-1227.345) (-1228.140) -- 0:00:02
964000 -- [-1229.584] (-1228.193) (-1227.301) (-1227.201) * (-1227.570) [-1226.919] (-1227.428) (-1228.681) -- 0:00:02
964500 -- [-1228.060] (-1226.533) (-1227.428) (-1228.885) * (-1226.785) [-1227.260] (-1228.340) (-1226.816) -- 0:00:02
965000 -- [-1227.045] (-1230.045) (-1227.225) (-1233.334) * (-1229.595) [-1228.059] (-1227.014) (-1226.707) -- 0:00:02
Average standard deviation of split frequencies: 0.007418
965500 -- [-1228.012] (-1228.486) (-1229.867) (-1230.679) * (-1227.384) (-1228.056) (-1228.700) [-1226.340] -- 0:00:02
966000 -- [-1228.238] (-1226.519) (-1228.944) (-1229.474) * (-1228.213) (-1232.661) [-1229.246] (-1226.841) -- 0:00:02
966500 -- (-1230.963) [-1227.246] (-1228.752) (-1229.364) * [-1229.084] (-1230.948) (-1226.864) (-1229.729) -- 0:00:02
967000 -- (-1233.809) [-1229.711] (-1226.267) (-1227.382) * [-1230.568] (-1231.207) (-1229.744) (-1227.142) -- 0:00:02
967500 -- (-1230.360) (-1230.007) (-1228.941) [-1228.115] * (-1230.726) (-1230.275) [-1227.585] (-1227.038) -- 0:00:02
968000 -- (-1227.214) (-1233.649) [-1227.975] (-1229.563) * (-1234.105) (-1230.067) (-1232.660) [-1227.509] -- 0:00:02
968500 -- [-1228.758] (-1230.908) (-1228.024) (-1227.352) * [-1228.287] (-1227.737) (-1229.520) (-1228.287) -- 0:00:01
969000 -- [-1227.154] (-1228.542) (-1229.981) (-1228.689) * (-1230.722) (-1227.330) (-1227.497) [-1229.213] -- 0:00:01
969500 -- [-1227.017] (-1230.052) (-1228.881) (-1229.819) * (-1228.302) (-1226.855) [-1227.606] (-1229.841) -- 0:00:01
970000 -- (-1228.157) (-1229.184) (-1229.629) [-1229.875] * [-1227.801] (-1226.807) (-1228.058) (-1231.183) -- 0:00:01
Average standard deviation of split frequencies: 0.007220
970500 -- (-1228.618) (-1228.529) [-1227.471] (-1231.917) * (-1227.029) (-1228.247) (-1231.430) [-1232.895] -- 0:00:01
971000 -- (-1228.212) [-1227.714] (-1229.917) (-1228.977) * [-1227.877] (-1226.862) (-1228.506) (-1229.589) -- 0:00:01
971500 -- (-1227.501) (-1228.588) (-1227.986) [-1228.363] * [-1232.714] (-1228.856) (-1229.999) (-1230.301) -- 0:00:01
972000 -- (-1227.425) (-1228.771) [-1226.989] (-1227.843) * (-1227.637) [-1227.305] (-1227.546) (-1229.117) -- 0:00:01
972500 -- (-1231.820) (-1229.955) [-1228.542] (-1230.085) * (-1229.156) (-1228.083) (-1226.408) [-1228.658] -- 0:00:01
973000 -- (-1227.925) [-1229.043] (-1228.968) (-1229.533) * (-1229.552) (-1229.340) (-1227.083) [-1227.221] -- 0:00:01
973500 -- (-1233.562) (-1232.830) (-1227.729) [-1234.098] * (-1228.550) (-1233.580) [-1226.203] (-1232.095) -- 0:00:01
974000 -- (-1227.495) (-1232.043) [-1233.974] (-1227.815) * (-1230.249) (-1233.142) (-1227.811) [-1227.330] -- 0:00:01
974500 -- [-1229.484] (-1228.779) (-1228.777) (-1227.783) * (-1230.247) [-1231.708] (-1227.942) (-1230.951) -- 0:00:01
975000 -- (-1228.196) (-1230.896) [-1229.505] (-1228.066) * (-1227.597) (-1231.017) (-1228.974) [-1230.566] -- 0:00:01
Average standard deviation of split frequencies: 0.007309
975500 -- [-1227.822] (-1227.852) (-1229.012) (-1229.091) * [-1226.306] (-1232.820) (-1227.821) (-1229.916) -- 0:00:01
976000 -- (-1233.077) [-1229.891] (-1228.037) (-1228.736) * (-1227.893) (-1232.615) [-1228.602] (-1232.878) -- 0:00:01
976500 -- [-1230.060] (-1228.193) (-1227.579) (-1228.365) * (-1226.694) (-1228.407) (-1226.540) [-1233.705] -- 0:00:01
977000 -- (-1228.780) (-1228.705) [-1227.679] (-1228.057) * (-1228.447) (-1232.655) [-1227.488] (-1228.015) -- 0:00:01
977500 -- (-1230.481) (-1227.961) (-1233.592) [-1227.485] * (-1228.022) (-1227.670) [-1228.057] (-1227.368) -- 0:00:01
978000 -- [-1228.817] (-1228.435) (-1229.931) (-1228.875) * (-1227.446) (-1226.805) (-1228.456) [-1227.093] -- 0:00:01
978500 -- (-1226.378) (-1232.137) (-1227.768) [-1231.714] * [-1227.545] (-1231.006) (-1228.070) (-1232.266) -- 0:00:01
979000 -- (-1231.085) [-1228.659] (-1226.498) (-1227.515) * (-1227.086) [-1229.741] (-1227.878) (-1226.711) -- 0:00:01
979500 -- (-1230.158) (-1227.738) (-1231.023) [-1229.229] * [-1227.986] (-1227.973) (-1226.410) (-1227.308) -- 0:00:01
980000 -- (-1227.909) (-1229.162) [-1232.419] (-1227.678) * (-1228.401) (-1229.865) (-1227.818) [-1226.838] -- 0:00:01
Average standard deviation of split frequencies: 0.006986
980500 -- (-1232.122) (-1227.520) [-1228.117] (-1229.134) * (-1227.132) [-1230.470] (-1228.283) (-1228.135) -- 0:00:01
981000 -- (-1229.251) (-1230.511) (-1229.356) [-1227.274] * (-1232.159) (-1232.038) [-1228.685] (-1227.504) -- 0:00:01
981500 -- (-1230.015) (-1228.081) [-1228.480] (-1228.015) * (-1229.313) (-1228.848) [-1230.040] (-1233.877) -- 0:00:01
982000 -- (-1228.128) (-1231.065) (-1226.819) [-1227.703] * [-1227.016] (-1229.047) (-1227.700) (-1226.562) -- 0:00:01
982500 -- (-1230.788) (-1235.649) (-1227.670) [-1226.625] * (-1226.855) (-1227.225) [-1229.555] (-1231.409) -- 0:00:01
983000 -- (-1231.212) (-1227.432) (-1228.762) [-1228.019] * [-1227.213] (-1227.988) (-1228.571) (-1227.066) -- 0:00:01
983500 -- (-1229.097) (-1227.550) [-1226.331] (-1229.333) * (-1228.301) [-1228.056] (-1229.192) (-1227.495) -- 0:00:01
984000 -- (-1230.286) (-1229.587) [-1229.438] (-1227.034) * (-1227.033) [-1227.896] (-1232.444) (-1228.131) -- 0:00:01
984500 -- (-1232.619) (-1227.688) (-1229.478) [-1227.461] * [-1229.091] (-1228.494) (-1229.408) (-1227.188) -- 0:00:00
985000 -- (-1235.547) (-1227.652) (-1227.440) [-1228.655] * (-1228.536) (-1231.586) [-1229.363] (-1228.744) -- 0:00:00
Average standard deviation of split frequencies: 0.007044
985500 -- [-1228.521] (-1228.342) (-1227.408) (-1227.712) * (-1230.322) [-1230.445] (-1228.337) (-1231.821) -- 0:00:00
986000 -- (-1228.698) [-1226.426] (-1228.726) (-1226.471) * [-1227.012] (-1227.291) (-1226.802) (-1232.363) -- 0:00:00
986500 -- (-1227.888) (-1230.164) [-1229.322] (-1227.289) * (-1226.931) [-1227.741] (-1228.431) (-1228.950) -- 0:00:00
987000 -- (-1228.088) [-1227.201] (-1228.041) (-1227.563) * [-1228.608] (-1227.810) (-1231.267) (-1228.275) -- 0:00:00
987500 -- (-1229.288) (-1230.292) [-1229.958] (-1227.132) * (-1231.342) [-1227.352] (-1229.220) (-1227.296) -- 0:00:00
988000 -- [-1229.808] (-1226.918) (-1229.177) (-1229.350) * (-1229.032) (-1227.282) [-1229.911] (-1229.122) -- 0:00:00
988500 -- (-1231.273) [-1228.142] (-1229.115) (-1229.582) * (-1228.042) (-1229.200) (-1230.063) [-1227.913] -- 0:00:00
989000 -- (-1228.473) [-1228.074] (-1231.435) (-1229.448) * (-1228.566) (-1229.170) (-1234.185) [-1228.989] -- 0:00:00
989500 -- [-1233.107] (-1231.081) (-1227.421) (-1227.934) * (-1227.668) (-1227.188) (-1228.852) [-1229.027] -- 0:00:00
990000 -- [-1232.322] (-1229.670) (-1227.403) (-1226.837) * [-1227.446] (-1226.763) (-1227.264) (-1230.436) -- 0:00:00
Average standard deviation of split frequencies: 0.006979
990500 -- (-1227.678) (-1231.241) (-1228.326) [-1226.585] * (-1227.541) [-1226.937] (-1227.685) (-1236.518) -- 0:00:00
991000 -- (-1232.350) (-1228.007) (-1229.824) [-1226.085] * (-1226.782) [-1228.059] (-1228.334) (-1229.157) -- 0:00:00
991500 -- (-1230.872) (-1226.512) [-1227.382] (-1226.242) * (-1227.730) (-1227.759) [-1229.119] (-1230.048) -- 0:00:00
992000 -- (-1229.153) (-1230.204) [-1228.020] (-1226.806) * [-1226.676] (-1228.868) (-1226.445) (-1231.067) -- 0:00:00
992500 -- (-1231.051) (-1227.612) [-1229.278] (-1228.103) * (-1227.480) (-1229.464) (-1228.501) [-1227.272] -- 0:00:00
993000 -- (-1229.283) (-1230.274) [-1228.643] (-1229.204) * (-1228.137) (-1227.237) [-1227.272] (-1232.901) -- 0:00:00
993500 -- [-1226.613] (-1227.224) (-1228.803) (-1228.783) * (-1230.789) (-1228.597) [-1226.954] (-1228.466) -- 0:00:00
994000 -- (-1228.135) (-1229.486) (-1230.975) [-1229.132] * (-1240.676) (-1232.154) [-1229.737] (-1230.829) -- 0:00:00
994500 -- (-1230.108) [-1227.045] (-1230.514) (-1230.141) * [-1228.654] (-1228.992) (-1235.568) (-1230.029) -- 0:00:00
995000 -- (-1230.707) [-1227.376] (-1230.203) (-1228.012) * (-1228.255) (-1227.499) (-1232.153) [-1227.890] -- 0:00:00
Average standard deviation of split frequencies: 0.006910
995500 -- [-1230.936] (-1228.540) (-1232.220) (-1228.600) * [-1232.959] (-1229.556) (-1232.964) (-1228.309) -- 0:00:00
996000 -- (-1226.796) [-1230.285] (-1228.937) (-1226.597) * (-1228.974) (-1228.842) (-1226.345) [-1228.509] -- 0:00:00
996500 -- (-1228.325) [-1227.137] (-1228.766) (-1229.164) * (-1227.441) (-1228.707) [-1226.569] (-1229.346) -- 0:00:00
997000 -- [-1227.086] (-1226.546) (-1228.697) (-1226.616) * (-1227.449) (-1230.285) [-1227.662] (-1231.890) -- 0:00:00
997500 -- (-1228.383) [-1229.135] (-1233.564) (-1226.773) * [-1227.930] (-1227.869) (-1226.945) (-1226.208) -- 0:00:00
998000 -- (-1226.944) (-1234.055) (-1231.815) [-1226.601] * [-1232.918] (-1229.324) (-1228.140) (-1228.731) -- 0:00:00
998500 -- [-1226.526] (-1232.810) (-1232.966) (-1228.887) * [-1230.328] (-1230.772) (-1228.324) (-1232.667) -- 0:00:00
999000 -- (-1230.356) [-1231.802] (-1230.435) (-1229.345) * (-1228.068) [-1228.711] (-1228.232) (-1230.468) -- 0:00:00
999500 -- [-1227.770] (-1228.636) (-1230.964) (-1231.046) * [-1231.157] (-1229.374) (-1226.500) (-1231.772) -- 0:00:00
1000000 -- (-1226.677) (-1227.424) [-1227.433] (-1232.394) * [-1229.453] (-1228.586) (-1227.574) (-1227.482) -- 0:00:00
Average standard deviation of split frequencies: 0.006689
Analysis completed in 1 mins 3 seconds
Analysis used 61.38 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1226.00
Likelihood of best state for "cold" chain of run 2 was -1226.00
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.5 % ( 18 %) Dirichlet(Pi{all})
28.4 % ( 26 %) Slider(Pi{all})
78.5 % ( 60 %) Multiplier(Alpha{1,2})
77.5 % ( 61 %) Multiplier(Alpha{3})
19.0 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.5 % ( 34 %) Dirichlet(Pi{all})
28.2 % ( 29 %) Slider(Pi{all})
79.2 % ( 53 %) Multiplier(Alpha{1,2})
77.6 % ( 50 %) Multiplier(Alpha{3})
19.2 % ( 23 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 97 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.5 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166183 0.83 0.67
3 | 167425 166369 0.84
4 | 166880 166812 166331
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166533 0.82 0.67
3 | 166824 167046 0.84
4 | 166122 166826 166649
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1227.61
| 2 |
| 1 2 1 1 |
| |
| 1 1 2 2 2 2 2 |
| 1* 1 2 2 2 2 |
| 1 2 * 1 1 2 1 1 2 2 2 |
| 2 12 1 1 121 1 1 1 12 112 |
| 1 22 1 2 1 2 1 2 12 2 2 2 121 |
|1 1 2 2 2 2 11 1 2 121|
|2 1 2 2 112 2 1 2 22 1 1 2|
| 22 1 12 1 11 * 1 |
| 1 1 2 2 1 2 1 1 2 1 |
| 2 2 1 |
| 2 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1229.36
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1227.76 -1230.54
2 -1227.71 -1230.86
--------------------------------------
TOTAL -1227.74 -1230.72
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893479 0.088927 0.379299 1.524733 0.858934 1501.00 1501.00 1.000
r(A<->C){all} 0.162483 0.019690 0.000006 0.444087 0.125746 262.25 326.39 1.008
r(A<->G){all} 0.175159 0.021060 0.000020 0.466391 0.143688 232.61 336.64 1.010
r(A<->T){all} 0.164906 0.018616 0.000081 0.438346 0.133048 157.98 202.21 1.000
r(C<->G){all} 0.169670 0.020694 0.000047 0.452468 0.134770 259.01 300.31 1.001
r(C<->T){all} 0.165811 0.019053 0.000101 0.444865 0.129261 107.97 169.47 1.000
r(G<->T){all} 0.161971 0.019096 0.000035 0.443224 0.124935 268.78 339.63 1.001
pi(A){all} 0.204718 0.000168 0.178770 0.229262 0.204642 1341.15 1376.13 1.001
pi(C){all} 0.341260 0.000247 0.311677 0.372310 0.341288 1274.26 1290.14 1.000
pi(G){all} 0.277089 0.000221 0.247390 0.304375 0.277059 1190.33 1226.98 1.000
pi(T){all} 0.176933 0.000169 0.151066 0.201900 0.176525 1325.45 1346.86 1.000
alpha{1,2} 0.419441 0.230395 0.000102 1.374563 0.255367 1252.91 1376.96 1.000
alpha{3} 0.455807 0.244402 0.000204 1.452762 0.281064 1342.33 1421.67 1.000
pinvar{all} 0.998324 0.000004 0.994670 0.999999 0.998952 1248.97 1320.60 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .***.*
9 -- .*.*..
10 -- .*...*
11 -- ...**.
12 -- .*.***
13 -- ..****
14 -- .**.**
15 -- .**...
16 -- .*..*.
17 -- ..**..
18 -- ...*.*
19 -- ....**
20 -- .****.
21 -- ..*.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 475 0.158228 0.006124 0.153897 0.162558 2
8 459 0.152898 0.000471 0.152565 0.153231 2
9 445 0.148235 0.004240 0.145237 0.151233 2
10 439 0.146236 0.010835 0.138574 0.153897 2
11 433 0.144237 0.002355 0.142572 0.145903 2
12 431 0.143571 0.014604 0.133245 0.153897 2
13 426 0.141905 0.005653 0.137908 0.145903 2
14 422 0.140573 0.003769 0.137908 0.143238 2
15 421 0.140240 0.000471 0.139907 0.140573 2
16 420 0.139907 0.013191 0.130580 0.149234 2
17 420 0.139907 0.006595 0.135243 0.144570 2
18 418 0.139241 0.002827 0.137242 0.141239 2
19 414 0.137908 0.009422 0.131246 0.144570 2
20 412 0.137242 0.016959 0.125250 0.149234 2
21 402 0.133911 0.002827 0.131912 0.135909 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100987 0.010634 0.000065 0.304349 0.070801 1.000 2
length{all}[2] 0.099646 0.009622 0.000071 0.300438 0.069856 1.000 2
length{all}[3] 0.100023 0.010147 0.000017 0.297554 0.068187 1.001 2
length{all}[4] 0.097863 0.009282 0.000058 0.295504 0.066907 1.000 2
length{all}[5] 0.096452 0.009929 0.000005 0.281679 0.066067 1.000 2
length{all}[6] 0.100286 0.010017 0.000011 0.299439 0.070229 1.001 2
length{all}[7] 0.098772 0.009953 0.000169 0.303822 0.064400 0.999 2
length{all}[8] 0.100121 0.011204 0.000289 0.293457 0.068692 0.999 2
length{all}[9] 0.094256 0.010028 0.000367 0.278272 0.064624 1.005 2
length{all}[10] 0.097268 0.009254 0.000019 0.270853 0.067260 0.998 2
length{all}[11] 0.086814 0.008485 0.000107 0.284982 0.055919 0.999 2
length{all}[12] 0.098755 0.007926 0.000395 0.263526 0.073456 1.001 2
length{all}[13] 0.095019 0.010100 0.000508 0.296353 0.066627 1.011 2
length{all}[14] 0.097584 0.009154 0.000297 0.290743 0.069895 0.998 2
length{all}[15] 0.103544 0.009985 0.000386 0.306177 0.077129 1.010 2
length{all}[16] 0.104206 0.009773 0.000026 0.311209 0.074125 0.999 2
length{all}[17] 0.110189 0.011445 0.000138 0.316143 0.078022 0.999 2
length{all}[18] 0.099352 0.010782 0.000046 0.315731 0.065728 0.998 2
length{all}[19] 0.104086 0.012001 0.000188 0.326634 0.074361 1.007 2
length{all}[20] 0.105964 0.010423 0.000267 0.301701 0.073693 1.004 2
length{all}[21] 0.096949 0.007618 0.000195 0.251896 0.072967 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006689
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 906
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 302 / 302 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 302 / 302 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044927 0.015287 0.106762 0.095376 0.011920 0.013423 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1259.608752
Iterating by ming2
Initial: fx= 1259.608752
x= 0.04493 0.01529 0.10676 0.09538 0.01192 0.01342 0.30000 1.30000
1 h-m-p 0.0000 0.0000 723.8856 ++ 1238.606795 m 0.0000 13 | 1/8
2 h-m-p 0.0001 0.0005 88.6593 ++ 1238.366632 m 0.0005 24 | 2/8
3 h-m-p 0.0000 0.0000 487.8715 ++ 1236.917614 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0000 18885.1336 ++ 1219.048197 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0002 7928.8395 --------.. | 4/8
6 h-m-p 0.0000 0.0000 509.3218 ++ 1208.756414 m 0.0000 74 | 5/8
7 h-m-p 0.0160 8.0000 9.9550 -------------.. | 5/8
8 h-m-p 0.0000 0.0002 415.0393 +++ 1177.987777 m 0.0002 108 | 6/8
9 h-m-p 0.0160 8.0000 6.5228 -------------.. | 6/8
10 h-m-p 0.0000 0.0000 296.9201 ++ 1174.461784 m 0.0000 141 | 7/8
11 h-m-p 1.6000 8.0000 0.0000 Y 1174.461784 0 2.6667 152 | 7/8
12 h-m-p 0.0444 8.0000 0.0000 -----------Y 1174.461784 0 0.0000 175
Out..
lnL = -1174.461784
176 lfun, 176 eigenQcodon, 1056 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021664 0.018364 0.071047 0.071847 0.042445 0.029382 0.000100 0.774277 0.108961
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 17.826489
np = 9
lnL0 = -1245.718043
Iterating by ming2
Initial: fx= 1245.718043
x= 0.02166 0.01836 0.07105 0.07185 0.04244 0.02938 0.00011 0.77428 0.10896
1 h-m-p 0.0000 0.0000 645.8085 ++ 1244.763702 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 401.0022 +++ 1214.970948 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0000 533.3712 ++ 1211.408846 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 521.3465 ++ 1207.886701 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0003 246.3802 ++ 1191.439704 m 0.0003 63 | 5/9
6 h-m-p 0.0001 0.0005 118.2567 ++ 1183.309640 m 0.0005 75 | 6/9
7 h-m-p 0.0000 0.0001 771.4280 ++ 1178.173664 m 0.0001 87 | 7/9
8 h-m-p 0.0054 0.0269 1.9026 ++ 1174.461832 m 0.0269 99 | 8/9
9 h-m-p 1.6000 8.0000 0.0002 ++ 1174.461832 m 8.0000 111 | 8/9
10 h-m-p 0.0128 6.3887 0.1180 +++++ 1174.461791 m 6.3887 127 | 9/9
11 h-m-p 0.0160 8.0000 0.0000 N 1174.461791 0 0.0160 140 | 9/9
12 h-m-p 0.0160 8.0000 0.0000 N 1174.461791 0 0.0160 152
Out..
lnL = -1174.461791
153 lfun, 459 eigenQcodon, 1836 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090035 0.014890 0.046420 0.027010 0.079145 0.066960 0.000100 1.580285 0.363135 0.459904 1.517884
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.543307
np = 11
lnL0 = -1267.789071
Iterating by ming2
Initial: fx= 1267.789071
x= 0.09003 0.01489 0.04642 0.02701 0.07914 0.06696 0.00011 1.58029 0.36313 0.45990 1.51788
1 h-m-p 0.0000 0.0000 683.0982 ++ 1266.541982 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 332.7376 +++ 1240.992302 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0001 233.2576 ++ 1226.561946 m 0.0001 45 | 3/11
4 h-m-p 0.0003 0.0020 99.2427 ++ 1194.915182 m 0.0020 59 | 4/11
5 h-m-p 0.0000 0.0000 174326.6901 ++ 1180.200305 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0001 648.3607 ++ 1177.054626 m 0.0001 87 | 6/11
7 h-m-p 0.0002 0.0008 6.4371 ----------.. | 6/11
8 h-m-p 0.0000 0.0000 418.8099 ++ 1175.887815 m 0.0000 123 | 7/11
9 h-m-p 0.0160 8.0000 1.2827 -------------.. | 7/11
10 h-m-p 0.0000 0.0000 297.1226 ++ 1174.461818 m 0.0000 162 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 1174.461818 m 8.0000 179 | 7/11
12 h-m-p 0.0160 8.0000 0.0113 +++++ 1174.461817 m 8.0000 199 | 7/11
13 h-m-p 0.0390 0.3575 2.3235 ++ 1174.461807 m 0.3575 217 | 7/11
14 h-m-p -0.0000 -0.0000 1.6772
h-m-p: -0.00000000e+00 -0.00000000e+00 1.67716476e+00 1174.461807
.. | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 1174.461807 m 8.0000 245 | 7/11
16 h-m-p 0.0073 0.0364 0.0066 -----Y 1174.461807 0 0.0000 268 | 7/11
17 h-m-p 0.0160 8.0000 0.0007 +++++ 1174.461806 m 8.0000 289 | 7/11
18 h-m-p 0.0108 2.3531 0.5218 ++++ 1174.461790 m 2.3531 309 | 8/11
19 h-m-p 1.6000 8.0000 0.0446 ++ 1174.461790 m 8.0000 327 | 8/11
20 h-m-p 0.3952 8.0000 0.9023 +C 1174.461789 0 1.5810 345 | 8/11
21 h-m-p 1.6000 8.0000 0.2913 C 1174.461789 0 1.6000 362 | 8/11
22 h-m-p 1.6000 8.0000 0.0263 Y 1174.461789 0 1.0796 379 | 8/11
23 h-m-p 1.6000 8.0000 0.0056 -N 1174.461789 0 0.1000 397 | 8/11
24 h-m-p 1.6000 8.0000 0.0003 ++ 1174.461789 m 8.0000 414 | 8/11
25 h-m-p 0.0490 8.0000 0.0502 ++Y 1174.461789 0 0.5184 433 | 8/11
26 h-m-p 1.6000 8.0000 0.0042 +C 1174.461789 0 5.9040 451 | 8/11
27 h-m-p 1.6000 8.0000 0.0018 ++ 1174.461789 m 8.0000 468 | 8/11
28 h-m-p 0.0404 8.0000 0.3528 ++Y 1174.461789 0 1.4412 487 | 8/11
29 h-m-p 1.6000 8.0000 0.0661 ++ 1174.461789 m 8.0000 504 | 8/11
30 h-m-p 0.2495 1.9230 2.1209 ----------Y 1174.461789 0 0.0000 531 | 8/11
31 h-m-p 0.0160 8.0000 3.3238 ++++Y 1174.461770 0 4.0960 549 | 8/11
32 h-m-p 1.6000 8.0000 0.2079 ------C 1174.461770 0 0.0001 569 | 8/11
33 h-m-p 0.9706 8.0000 0.0000 ++ 1174.461770 m 8.0000 586 | 8/11
34 h-m-p 0.0160 8.0000 0.0876 -----N 1174.461770 0 0.0000 608 | 8/11
35 h-m-p 0.0160 8.0000 0.0001 --C 1174.461770 0 0.0003 627 | 8/11
36 h-m-p 0.0160 8.0000 0.0000 +++++ 1174.461770 m 8.0000 647 | 8/11
37 h-m-p 0.0160 8.0000 0.2270 ------------Y 1174.461770 0 0.0000 676 | 8/11
38 h-m-p 0.0160 8.0000 0.0000 ---------Y 1174.461770 0 0.0000 702 | 8/11
39 h-m-p 0.0160 8.0000 0.0000 ----Y 1174.461770 0 0.0000 723
Out..
lnL = -1174.461770
724 lfun, 2896 eigenQcodon, 13032 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1174.458629 S = -1174.455106 -0.001346
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:04
did 20 / 57 patterns 0:04
did 30 / 57 patterns 0:05
did 40 / 57 patterns 0:05
did 50 / 57 patterns 0:05
did 57 / 57 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.096458 0.095458 0.075219 0.018366 0.059566 0.076724 0.000100 0.945360 1.303969
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.999553
np = 9
lnL0 = -1294.344458
Iterating by ming2
Initial: fx= 1294.344458
x= 0.09646 0.09546 0.07522 0.01837 0.05957 0.07672 0.00011 0.94536 1.30397
1 h-m-p 0.0000 0.0000 663.8899 ++ 1293.689064 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0081 82.4465 +++++ 1249.190921 m 0.0081 29 | 2/9
3 h-m-p 0.0001 0.0005 158.9602 ++ 1210.419542 m 0.0005 41 | 3/9
4 h-m-p 0.0006 0.0031 37.2997 ++ 1207.668525 m 0.0031 53 | 4/9
5 h-m-p 0.0000 0.0000 217.0895 ++ 1205.763275 m 0.0000 65 | 5/9
6 h-m-p 0.0003 0.0241 16.1638 ++++ 1205.004102 m 0.0241 79 | 6/9
7 h-m-p 0.0000 0.0002 1830.6551 ++ 1174.461850 m 0.0002 91 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 1174.461850 m 8.0000 103 | 7/9
9 h-m-p 0.0051 2.0951 0.1058 -------Y 1174.461850 0 0.0000 124 | 7/9
10 h-m-p 0.0160 8.0000 0.0005 -------------.. | 7/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 1174.461850 m 8.0000 166 | 7/9
12 h-m-p 0.0160 8.0000 0.2452 +++++ 1174.461800 m 8.0000 183 | 7/9
13 h-m-p 1.6000 8.0000 0.0847 ++ 1174.461797 m 8.0000 197 | 7/9
14 h-m-p 0.6298 4.6348 1.0760 +
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
+ 1174.461791 m 4.6348 211
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
15 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
N 1174.461791 0 1.6000 223
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73257, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73210, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
16 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
N 1174.461791 0 0.0160 236
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1174.461791
237 lfun, 2607 eigenQcodon, 14220 P(t)
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73234, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.091854 0.073115 0.023710 0.040480 0.037712 0.017121 0.000100 0.900000 0.506485 1.594169 1.387957
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.581036
np = 11
lnL0 = -1253.076983
Iterating by ming2
Initial: fx= 1253.076983
x= 0.09185 0.07312 0.02371 0.04048 0.03771 0.01712 0.00011 0.90000 0.50648 1.59417 1.38796
1 h-m-p 0.0000 0.0000 634.4463 ++ 1252.275450 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 251.2949 +++ 1224.444274 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 555.4807 ++ 1215.203422 m 0.0000 45 | 3/11
4 h-m-p 0.0003 0.0022 98.9492 ++ 1201.439812 m 0.0022 59 | 4/11
5 h-m-p 0.0000 0.0000 3634.2474 ++ 1199.479030 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 17350.5116 ++ 1187.316491 m 0.0000 87 | 6/11
7 h-m-p 0.0004 0.0019 28.0771 ++ 1186.327537 m 0.0019 101 | 7/11
8 h-m-p 0.0180 0.7221 2.3542 -------------.. | 7/11
9 h-m-p 0.0000 0.0001 279.4174 ++ 1174.461804 m 0.0001 140 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 1174.461804 m 8.0000 154 | 8/11
11 h-m-p 0.0160 8.0000 0.0235 +++++ 1174.461799 m 8.0000 174 | 8/11
12 h-m-p 0.1950 3.6851 0.9642 +++ 1174.461769 m 3.6851 192 | 9/11
13 h-m-p 1.6000 8.0000 0.3088 ++ 1174.461767 m 8.0000 209 | 9/11
14 h-m-p 1.0398 8.0000 2.3763 ++ 1174.461764 m 8.0000 225 | 9/11
15 h-m-p 1.2765 6.3826 4.0627 --------------Y 1174.461764 0 0.0000 253 | 9/11
16 h-m-p 1.6000 8.0000 0.0000 ---C 1174.461764 0 0.0063 270 | 9/11
17 h-m-p 0.1614 8.0000 0.0000 ------Y 1174.461764 0 0.0000 292
Out..
lnL = -1174.461764
293 lfun, 3516 eigenQcodon, 19338 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1174.455560 S = -1174.454722 -0.000367
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:13
did 20 / 57 patterns 0:13
did 30 / 57 patterns 0:14
did 40 / 57 patterns 0:14
did 50 / 57 patterns 0:14
did 57 / 57 patterns 0:14
Time used: 0:14
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0337/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 302
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 6 6 6 6 6 6 | TAC 8 8 8 8 8 8 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 5 5 5 5
CTC 3 3 3 3 3 3 | CCC 3 3 3 3 3 3 | CAC 8 8 8 8 8 8 | CGC 4 4 4 4 4 4
CTA 1 1 1 1 1 1 | CCA 3 3 3 3 3 3 | Gln CAA 3 3 3 3 3 3 | CGA 3 3 3 3 3 3
CTG 14 14 14 14 14 14 | CCG 10 10 10 10 10 10 | CAG 6 6 6 6 6 6 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 4 4 4 4 4 4 | Asn AAT 4 4 4 4 4 4 | Ser AGT 3 3 3 3 3 3
ATC 11 11 11 11 11 11 | ACC 17 17 17 17 17 17 | AAC 12 12 12 12 12 12 | AGC 4 4 4 4 4 4
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 4 4 4 4 4 4 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 7 7 7 7 7 7 | Asp GAT 7 7 7 7 7 7 | Gly GGT 4 4 4 4 4 4
GTC 8 8 8 8 8 8 | GCC 26 26 26 26 26 26 | GAC 13 13 13 13 13 13 | GGC 10 10 10 10 10 10
GTA 3 3 3 3 3 3 | GCA 6 6 6 6 6 6 | Glu GAA 6 6 6 6 6 6 | GGA 1 1 1 1 1 1
GTG 15 15 15 15 15 15 | GCG 7 7 7 7 7 7 | GAG 4 4 4 4 4 4 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907680_1_349_MLBR_RS01685
position 1: T:0.12914 C:0.22517 A:0.24834 G:0.39735
position 2: T:0.24834 C:0.34437 A:0.25497 G:0.15232
position 3: T:0.15232 C:0.45695 A:0.10927 G:0.28146
Average T:0.17660 C:0.34216 A:0.20419 G:0.27704
#2: NC_002677_1_NP_301356_1_228_ML0337
position 1: T:0.12914 C:0.22517 A:0.24834 G:0.39735
position 2: T:0.24834 C:0.34437 A:0.25497 G:0.15232
position 3: T:0.15232 C:0.45695 A:0.10927 G:0.28146
Average T:0.17660 C:0.34216 A:0.20419 G:0.27704
#3: NZ_LVXE01000069_1_WP_010907680_1_2502_A3216_RS12975
position 1: T:0.12914 C:0.22517 A:0.24834 G:0.39735
position 2: T:0.24834 C:0.34437 A:0.25497 G:0.15232
position 3: T:0.15232 C:0.45695 A:0.10927 G:0.28146
Average T:0.17660 C:0.34216 A:0.20419 G:0.27704
#4: NZ_LYPH01000014_1_WP_010907680_1_452_A8144_RS02145
position 1: T:0.12914 C:0.22517 A:0.24834 G:0.39735
position 2: T:0.24834 C:0.34437 A:0.25497 G:0.15232
position 3: T:0.15232 C:0.45695 A:0.10927 G:0.28146
Average T:0.17660 C:0.34216 A:0.20419 G:0.27704
#5: NZ_CP029543_1_WP_010907680_1_352_DIJ64_RS01810
position 1: T:0.12914 C:0.22517 A:0.24834 G:0.39735
position 2: T:0.24834 C:0.34437 A:0.25497 G:0.15232
position 3: T:0.15232 C:0.45695 A:0.10927 G:0.28146
Average T:0.17660 C:0.34216 A:0.20419 G:0.27704
#6: NZ_AP014567_1_WP_010907680_1_367_JK2ML_RS01885
position 1: T:0.12914 C:0.22517 A:0.24834 G:0.39735
position 2: T:0.24834 C:0.34437 A:0.25497 G:0.15232
position 3: T:0.15232 C:0.45695 A:0.10927 G:0.28146
Average T:0.17660 C:0.34216 A:0.20419 G:0.27704
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 12 | TCC 36 | TAC 48 | TGC 18
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 48 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 30
CTC 18 | CCC 18 | CAC 48 | CGC 24
CTA 6 | CCA 18 | Gln Q CAA 18 | CGA 18
CTG 84 | CCG 60 | CAG 36 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 30 | Thr T ACT 24 | Asn N AAT 24 | Ser S AGT 18
ATC 66 | ACC 102 | AAC 72 | AGC 24
ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 18 | ACG 24 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 42 | Asp D GAT 42 | Gly G GGT 24
GTC 48 | GCC 156 | GAC 78 | GGC 60
GTA 18 | GCA 36 | Glu E GAA 36 | GGA 6
GTG 90 | GCG 42 | GAG 24 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12914 C:0.22517 A:0.24834 G:0.39735
position 2: T:0.24834 C:0.34437 A:0.25497 G:0.15232
position 3: T:0.15232 C:0.45695 A:0.10927 G:0.28146
Average T:0.17660 C:0.34216 A:0.20419 G:0.27704
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1174.461784 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.387957
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907680_1_349_MLBR_RS01685: 0.000004, NC_002677_1_NP_301356_1_228_ML0337: 0.000004, NZ_LVXE01000069_1_WP_010907680_1_2502_A3216_RS12975: 0.000004, NZ_LYPH01000014_1_WP_010907680_1_452_A8144_RS02145: 0.000004, NZ_CP029543_1_WP_010907680_1_352_DIJ64_RS01810: 0.000004, NZ_AP014567_1_WP_010907680_1_367_JK2ML_RS01885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.38796
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 712.9 193.1 1.3880 0.0000 0.0000 0.0 0.0
7..2 0.000 712.9 193.1 1.3880 0.0000 0.0000 0.0 0.0
7..3 0.000 712.9 193.1 1.3880 0.0000 0.0000 0.0 0.0
7..4 0.000 712.9 193.1 1.3880 0.0000 0.0000 0.0 0.0
7..5 0.000 712.9 193.1 1.3880 0.0000 0.0000 0.0 0.0
7..6 0.000 712.9 193.1 1.3880 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1174.461791 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907680_1_349_MLBR_RS01685: 0.000004, NC_002677_1_NP_301356_1_228_ML0337: 0.000004, NZ_LVXE01000069_1_WP_010907680_1_2502_A3216_RS12975: 0.000004, NZ_LYPH01000014_1_WP_010907680_1_452_A8144_RS02145: 0.000004, NZ_CP029543_1_WP_010907680_1_352_DIJ64_RS01810: 0.000004, NZ_AP014567_1_WP_010907680_1_367_JK2ML_RS01885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1174.461770 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.715891 0.008359 1.000000 14.346934
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907680_1_349_MLBR_RS01685: 0.000004, NC_002677_1_NP_301356_1_228_ML0337: 0.000004, NZ_LVXE01000069_1_WP_010907680_1_2502_A3216_RS12975: 0.000004, NZ_LYPH01000014_1_WP_010907680_1_452_A8144_RS02145: 0.000004, NZ_CP029543_1_WP_010907680_1_352_DIJ64_RS01810: 0.000004, NZ_AP014567_1_WP_010907680_1_367_JK2ML_RS01885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.71589 0.00836 0.27575
w: 1.00000 1.00000 14.34693
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 712.9 193.1 4.6804 0.0000 0.0000 0.0 0.0
7..2 0.000 712.9 193.1 4.6804 0.0000 0.0000 0.0 0.0
7..3 0.000 712.9 193.1 4.6804 0.0000 0.0000 0.0 0.0
7..4 0.000 712.9 193.1 4.6804 0.0000 0.0000 0.0 0.0
7..5 0.000 712.9 193.1 4.6804 0.0000 0.0000 0.0 0.0
7..6 0.000 712.9 193.1 4.6804 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907680_1_349_MLBR_RS01685)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907680_1_349_MLBR_RS01685)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1174.461791 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 7.732336 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907680_1_349_MLBR_RS01685: 0.000004, NC_002677_1_NP_301356_1_228_ML0337: 0.000004, NZ_LVXE01000069_1_WP_010907680_1_2502_A3216_RS12975: 0.000004, NZ_LYPH01000014_1_WP_010907680_1_452_A8144_RS02145: 0.000004, NZ_CP029543_1_WP_010907680_1_352_DIJ64_RS01810: 0.000004, NZ_AP014567_1_WP_010907680_1_367_JK2ML_RS01885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 7.73234 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 712.9 193.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1174.461764 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.843199 26.930428
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907680_1_349_MLBR_RS01685: 0.000004, NC_002677_1_NP_301356_1_228_ML0337: 0.000004, NZ_LVXE01000069_1_WP_010907680_1_2502_A3216_RS12975: 0.000004, NZ_LYPH01000014_1_WP_010907680_1_452_A8144_RS02145: 0.000004, NZ_CP029543_1_WP_010907680_1_352_DIJ64_RS01810: 0.000004, NZ_AP014567_1_WP_010907680_1_367_JK2ML_RS01885: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.84320
(p1 = 0.99999) w = 26.93043
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 26.93043
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 712.9 193.1 26.9302 0.0000 0.0000 0.0 0.0
7..2 0.000 712.9 193.1 26.9302 0.0000 0.0000 0.0 0.0
7..3 0.000 712.9 193.1 26.9302 0.0000 0.0000 0.0 0.0
7..4 0.000 712.9 193.1 26.9302 0.0000 0.0000 0.0 0.0
7..5 0.000 712.9 193.1 26.9302 0.0000 0.0000 0.0 0.0
7..6 0.000 712.9 193.1 26.9302 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907680_1_349_MLBR_RS01685)
Pr(w>1) post mean +- SE for w
1 M 1.000** 26.930
2 R 1.000** 26.930
3 W 1.000** 26.930
4 L 1.000** 26.930
5 T 1.000** 26.930
6 T 1.000** 26.930
7 I 1.000** 26.930
8 I 1.000** 26.930
9 L 1.000** 26.930
10 C 1.000** 26.930
11 L 1.000** 26.930
12 I 1.000** 26.930
13 S 1.000** 26.930
14 S 1.000** 26.930
15 T 1.000** 26.930
16 V 1.000** 26.930
17 A 1.000** 26.930
18 G 1.000** 26.930
19 G 1.000** 26.930
20 C 1.000** 26.930
21 G 1.000** 26.930
22 S 1.000** 26.930
23 L 1.000** 26.930
24 S 1.000** 26.930
25 S 1.000** 26.930
26 G 1.000** 26.930
27 H 1.000** 26.930
28 L 1.000** 26.930
29 R 1.000** 26.930
30 P 1.000** 26.930
31 T 1.000** 26.930
32 A 1.000** 26.930
33 V 1.000** 26.930
34 V 1.000** 26.930
35 A 1.000** 26.930
36 S 1.000** 26.930
37 T 1.000** 26.930
38 D 1.000** 26.930
39 V 1.000** 26.930
40 W 1.000** 26.930
41 G 1.000** 26.930
42 S 1.000** 26.930
43 V 1.000** 26.930
44 A 1.000** 26.930
45 R 1.000** 26.930
46 I 1.000** 26.930
47 I 1.000** 26.930
48 A 1.000** 26.930
49 G 1.000** 26.930
50 R 1.000** 26.930
51 H 1.000** 26.930
52 V 1.000** 26.930
53 A 1.000** 26.930
54 V 1.000** 26.930
55 T 1.000** 26.930
56 S 1.000** 26.930
57 I 1.000** 26.930
58 V 1.000** 26.930
59 T 1.000** 26.930
60 G 1.000** 26.930
61 A 1.000** 26.930
62 H 1.000** 26.930
63 T 1.000** 26.930
64 D 1.000** 26.930
65 P 1.000** 26.930
66 H 1.000** 26.930
67 T 1.000** 26.930
68 Y 1.000** 26.930
69 R 1.000** 26.930
70 V 1.000** 26.930
71 N 1.000** 26.930
72 P 1.000** 26.930
73 A 1.000** 26.930
74 E 1.000** 26.930
75 T 1.000** 26.930
76 A 1.000** 26.930
77 A 1.000** 26.930
78 I 1.000** 26.930
79 T 1.000** 26.930
80 D 1.000** 26.930
81 A 1.000** 26.930
82 A 1.000** 26.930
83 L 1.000** 26.930
84 V 1.000** 26.930
85 V 1.000** 26.930
86 Y 1.000** 26.930
87 N 1.000** 26.930
88 G 1.000** 26.930
89 G 1.000** 26.930
90 G 1.000** 26.930
91 Y 1.000** 26.930
92 D 1.000** 26.930
93 P 1.000** 26.930
94 W 1.000** 26.930
95 V 1.000** 26.930
96 D 1.000** 26.930
97 K 1.000** 26.930
98 V 1.000** 26.930
99 L 1.000** 26.930
100 A 1.000** 26.930
101 G 1.000** 26.930
102 R 1.000** 26.930
103 P 1.000** 26.930
104 D 1.000** 26.930
105 I 1.000** 26.930
106 K 1.000** 26.930
107 S 1.000** 26.930
108 V 1.000** 26.930
109 D 1.000** 26.930
110 A 1.000** 26.930
111 Y 1.000** 26.930
112 S 1.000** 26.930
113 L 1.000** 26.930
114 L 1.000** 26.930
115 A 1.000** 26.930
116 S 1.000** 26.930
117 R 1.000** 26.930
118 G 1.000** 26.930
119 A 1.000** 26.930
120 T 1.000** 26.930
121 T 1.000** 26.930
122 E 1.000** 26.930
123 G 1.000** 26.930
124 P 1.000** 26.930
125 A 1.000** 26.930
126 D 1.000** 26.930
127 E 1.000** 26.930
128 H 1.000** 26.930
129 V 1.000** 26.930
130 F 1.000** 26.930
131 Y 1.000** 26.930
132 D 1.000** 26.930
133 L 1.000** 26.930
134 N 1.000** 26.930
135 I 1.000** 26.930
136 A 1.000** 26.930
137 K 1.000** 26.930
138 S 1.000** 26.930
139 V 1.000** 26.930
140 A 1.000** 26.930
141 S 1.000** 26.930
142 L 1.000** 26.930
143 I 1.000** 26.930
144 A 1.000** 26.930
145 D 1.000** 26.930
146 Q 1.000** 26.930
147 L 1.000** 26.930
148 V 1.000** 26.930
149 T 1.000** 26.930
150 I 1.000** 26.930
151 D 1.000** 26.930
152 P 1.000** 26.930
153 D 1.000** 26.930
154 N 1.000** 26.930
155 A 1.000** 26.930
156 A 1.000** 26.930
157 D 1.000** 26.930
158 Y 1.000** 26.930
159 Q 1.000** 26.930
160 A 1.000** 26.930
161 N 1.000** 26.930
162 A 1.000** 26.930
163 T 1.000** 26.930
164 E 1.000** 26.930
165 F 1.000** 26.930
166 C 1.000** 26.930
167 R 1.000** 26.930
168 S 1.000** 26.930
169 A 1.000** 26.930
170 D 1.000** 26.930
171 A 1.000** 26.930
172 I 1.000** 26.930
173 A 1.000** 26.930
174 I 1.000** 26.930
175 S 1.000** 26.930
176 E 1.000** 26.930
177 H 1.000** 26.930
178 A 1.000** 26.930
179 I 1.000** 26.930
180 A 1.000** 26.930
181 S 1.000** 26.930
182 D 1.000** 26.930
183 Y 1.000** 26.930
184 P 1.000** 26.930
185 A 1.000** 26.930
186 A 1.000** 26.930
187 G 1.000** 26.930
188 V 1.000** 26.930
189 I 1.000** 26.930
190 V 1.000** 26.930
191 T 1.000** 26.930
192 E 1.000** 26.930
193 P 1.000** 26.930
194 V 1.000** 26.930
195 V 1.000** 26.930
196 H 1.000** 26.930
197 Y 1.000** 26.930
198 L 1.000** 26.930
199 L 1.000** 26.930
200 Q 1.000** 26.930
201 A 1.000** 26.930
202 S 1.000** 26.930
203 G 1.000** 26.930
204 L 1.000** 26.930
205 V 1.000** 26.930
206 N 1.000** 26.930
207 R 1.000** 26.930
208 T 1.000** 26.930
209 P 1.000** 26.930
210 P 1.000** 26.930
211 A 1.000** 26.930
212 F 1.000** 26.930
213 T 1.000** 26.930
214 A 1.000** 26.930
215 T 1.000** 26.930
216 H 1.000** 26.930
217 E 1.000** 26.930
218 N 1.000** 26.930
219 E 1.000** 26.930
220 N 1.000** 26.930
221 D 1.000** 26.930
222 P 1.000** 26.930
223 S 1.000** 26.930
224 A 1.000** 26.930
225 A 1.000** 26.930
226 D 1.000** 26.930
227 M 1.000** 26.930
228 A 1.000** 26.930
229 A 1.000** 26.930
230 A 1.000** 26.930
231 L 1.000** 26.930
232 N 1.000** 26.930
233 L 1.000** 26.930
234 I 1.000** 26.930
235 N 1.000** 26.930
236 H 1.000** 26.930
237 R 1.000** 26.930
238 Q 1.000** 26.930
239 V 1.000** 26.930
240 S 1.000** 26.930
241 A 1.000** 26.930
242 L 1.000** 26.930
243 L 1.000** 26.930
244 V 1.000** 26.930
245 N 1.000** 26.930
246 P 1.000** 26.930
247 Q 1.000** 26.930
248 K 1.000** 26.930
249 S 1.000** 26.930
250 N 1.000** 26.930
251 A 1.000** 26.930
252 A 1.000** 26.930
253 T 1.000** 26.930
254 N 1.000** 26.930
255 G 1.000** 26.930
256 L 1.000** 26.930
257 Q 1.000** 26.930
258 A 1.000** 26.930
259 A 1.000** 26.930
260 A 1.000** 26.930
261 R 1.000** 26.930
262 R 1.000** 26.930
263 S 1.000** 26.930
264 G 1.000** 26.930
265 V 1.000** 26.930
266 P 1.000** 26.930
267 V 1.000** 26.930
268 T 1.000** 26.930
269 E 1.000** 26.930
270 V 1.000** 26.930
271 T 1.000** 26.930
272 E 1.000** 26.930
273 M 1.000** 26.930
274 L 1.000** 26.930
275 P 1.000** 26.930
276 N 1.000** 26.930
277 D 1.000** 26.930
278 T 1.000** 26.930
279 D 1.000** 26.930
280 Y 1.000** 26.930
281 L 1.000** 26.930
282 T 1.000** 26.930
283 W 1.000** 26.930
284 Q 1.000** 26.930
285 R 1.000** 26.930
286 N 1.000** 26.930
287 T 1.000** 26.930
288 I 1.000** 26.930
289 D 1.000** 26.930
290 Q 1.000** 26.930
291 L 1.000** 26.930
292 L 1.000** 26.930
293 T 1.000** 26.930
294 A 1.000** 26.930
295 L 1.000** 26.930
296 Q 1.000** 26.930
297 S 1.000** 26.930
298 N 1.000** 26.930
299 R 1.000** 26.930
300 S 1.000** 26.930
301 P 1.000** 26.930
302 R 1.000** 26.930
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907680_1_349_MLBR_RS01685)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:14