>C1
LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
>C2
LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
>C3
LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
>C4
LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
>C5
MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDAYTPLAWW
GSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLPLTGAGAT
GLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFFSPRMAD
MYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGIKPFLALY
MGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEIIPNELVD
STMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLFooooooo
>C6
MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDAYTPLAWW
GSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLPLTGAGAT
GLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFFSPRMAD
MYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGIKPFLALY
MGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEIIPNELVD
STMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLFooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=357
C1 LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
C2 LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
C3 LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
C4 LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
C5 -------MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
C6 -------MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
*******************************************
C1 YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
C2 YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
C3 YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
C4 YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
C5 YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
C6 YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
**************************************************
C1 GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
C2 GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
C3 GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
C4 GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
C5 GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
C6 GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
**************************************************
C1 LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
C2 LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
C3 LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
C4 LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
C5 LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
C6 LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
**************************************************
C1 FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
C2 FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
C3 FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
C4 FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
C5 FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
C6 FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
**************************************************
C1 KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
C2 KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
C3 KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
C4 KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
C5 KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
C6 KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
**************************************************
C1 IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C2 IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C3 IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C4 IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C5 IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C6 IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
**************************************************
C1 -------
C2 -------
C3 -------
C4 -------
C5 ooooooo
C6 ooooooo
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 350 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 350 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10532]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [10532]--->[10500]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.522 Mb, Max= 30.922 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDAYTPLAWW
C2 MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDAYTPLAWW
C3 MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDAYTPLAWW
C4 MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDAYTPLAWW
C5 MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDAYTPLAWW
C6 MKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDAYTPLAWW
**************************************************
C1 GSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
C2 GSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
C3 GSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
C4 GSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
C5 GSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
C6 GSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
**************************************************
C1 VEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLPLTGAGAT
C2 VEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLPLTGAGAT
C3 VEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLPLTGAGAT
C4 VEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLPLTGAGAT
C5 VEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLPLTGAGAT
C6 VEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLPLTGAGAT
**************************************************
C1 GLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFFSPRMAD
C2 GLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFFSPRMAD
C3 GLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFFSPRMAD
C4 GLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFFSPRMAD
C5 GLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFFSPRMAD
C6 GLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIFFSPRMAD
**************************************************
C1 MYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGIKPFLALY
C2 MYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGIKPFLALY
C3 MYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGIKPFLALY
C4 MYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGIKPFLALY
C5 MYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGIKPFLALY
C6 MYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGIKPFLALY
**************************************************
C1 MGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEIIPNELVD
C2 MGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEIIPNELVD
C3 MGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEIIPNELVD
C4 MGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEIIPNELVD
C5 MGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEIIPNELVD
C6 MGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEIIPNELVD
**************************************************
C1 STMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C2 STMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C3 STMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C4 STMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C5 STMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
C6 STMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
*******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGGTGGAAAGGGCGAACGCCATGAAGCTTGGGCTGCAGTTGGGATATTG
C2 TTGGTGGAAAGGGCGAACGCCATGAAGCTTGGGCTGCAGTTGGGATATTG
C3 TTGGTGGAAAGGGCGAACGCCATGAAGCTTGGGCTGCAGTTGGGATATTG
C4 TTGGTGGAAAGGGCGAACGCCATGAAGCTTGGGCTGCAGTTGGGATATTG
C5 ---------------------ATGAAGCTTGGGCTGCAGTTGGGATATTG
C6 ---------------------ATGAAGCTTGGGCTGCAGTTGGGATATTG
*****************************
C1 GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
C2 GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
C3 GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
C4 GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
C5 GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
C6 GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
**************************************************
C1 GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
C2 GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
C3 GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
C4 GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
C5 GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
C6 GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
**************************************************
C1 TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
C2 TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
C3 TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
C4 TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
C5 TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
C6 TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
**************************************************
C1 CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
C2 CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
C3 CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
C4 CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
C5 CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
C6 CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
**************************************************
C1 CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
C2 CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
C3 CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
C4 CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
C5 CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
C6 CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
**************************************************
C1 GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
C2 GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
C3 GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
C4 GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
C5 GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
C6 GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
**************************************************
C1 AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
C2 AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
C3 AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
C4 AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
C5 AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
C6 AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
**************************************************
C1 GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
C2 GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
C3 GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
C4 GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
C5 GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
C6 GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
**************************************************
C1 CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
C2 CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
C3 CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
C4 CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
C5 CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
C6 CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
**************************************************
C1 CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
C2 CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
C3 CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
C4 CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
C5 CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
C6 CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
**************************************************
C1 AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
C2 AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
C3 AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
C4 AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
C5 AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
C6 AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
**************************************************
C1 TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
C2 TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
C3 TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
C4 TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
C5 TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
C6 TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
**************************************************
C1 CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
C2 CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
C3 CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
C4 CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
C5 CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
C6 CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
**************************************************
C1 CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
C2 CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
C3 CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
C4 CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
C5 CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
C6 CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
**************************************************
C1 AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
C2 AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
C3 AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
C4 AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
C5 AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
C6 AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
**************************************************
C1 CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
C2 CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
C3 CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
C4 CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
C5 CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
C6 CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
**************************************************
C1 AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
C2 AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
C3 AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
C4 AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
C5 AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
C6 AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
**************************************************
C1 ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
C2 ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
C3 ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
C4 ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
C5 ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
C6 ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
**************************************************
C1 TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
C2 TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
C3 TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
C4 TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
C5 TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
C6 TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
**************************************************
C1 TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
C2 TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
C3 TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
C4 TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
C5 TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
C6 TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
**************************************************
C1 ---------------------
C2 ---------------------
C3 ---------------------
C4 ---------------------
C5 ---------------------
C6 ---------------------
>C1
TTGGTGGAAAGGGCGAACGCCATGAAGCTTGGGCTGCAGTTGGGATATTG
GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
---------------------
>C2
TTGGTGGAAAGGGCGAACGCCATGAAGCTTGGGCTGCAGTTGGGATATTG
GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
---------------------
>C3
TTGGTGGAAAGGGCGAACGCCATGAAGCTTGGGCTGCAGTTGGGATATTG
GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
---------------------
>C4
TTGGTGGAAAGGGCGAACGCCATGAAGCTTGGGCTGCAGTTGGGATATTG
GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
---------------------
>C5
---------------------ATGAAGCTTGGGCTGCAGTTGGGATATTG
GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
---------------------
>C6
---------------------ATGAAGCTTGGGCTGCAGTTGGGATATTG
GGCTGCTCAACCGCCAGGAAACGCTGCCGAACTCGTGGCCGCGGCGGAGG
GCGCCGGATTCGACGCAGTATTCACCGGGGAAGCGTGGGGATCCGATGCT
TACACGCCGCTGGCGTGGTGGGGCTCGTCCACGCAGCGGGTGCGGCTGGG
CACGTCGGTGGTCCAACTGTCGGCGCGAACCCCGACGGCATGCGCGATGG
CTGCGCTGACGCTGGACCATCTGTCCGGTGGACGCCATATTCTCGGGCTT
GGTGTGTCCGGCCCACAGGTGGTCGAGGGTTGGTATGGCCAGCCGTTTCC
AAAGCCATTGTCCCGCACCCGTGAATACATTGACATTGTCCGCCAAGTGT
GGGCCAGGGAAGCGCCGGTGGTCAGCGACGGTCAGCACTACCCGTTGCCG
CTGACCGGTGCTGGTGCGACGGGTTTAGGCAAAGCGTTGAAACCCATCAC
CCATCCGCTGCGCGCAGACATTCCGATTATGCTGGGTGCCGAGGGGCCGA
AGAACGTGGCGCTGGCCGCCGAGATCTGCGACGGCTGGCTACCAATTTTC
TTTTCTCCCCGGATGGCTGACATGTACAACGAATGGCTCGACGAGGGGTT
CGCCCGGACGGGCGCGCGGCGCAGCCGTGAGGACTTCGAGATCTGTGCGT
CCGCTCAGATCGTTGTTACCGAAGACCGCGCGGCTGCGTTTGCCGGAATT
AAGCCGTTCCTGGCACTTTACATGGGCGGTATGGGTGCTGAGGGCACCAA
CTTTCACGCCGACGTCTATCGTCGGATGGGCTATGCTGAGGTGGTCGACG
AGGTGACTGCGCTGTTCCGGTCCAACCAGAAGGACAAGGCGGCCGAGATC
ATCCCCAACGAGCTCGTCGACAGCACTATGATCGTCGGTGACGTGGACTA
TGTGTGTAAGCAGATCGCGGCCTGGTCAGCCGCAGGGGTTACCATGATGA
TGGTGTCTGCTTCTAGCGTAGAGCAGGTTCGAGACCTGGCTGGGCTGTTC
---------------------
>C1
LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
>C2
LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
>C3
LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
>C4
LVERANAMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
>C5
oooooooMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
>C6
oooooooMKLGLQLGYWAAQPPGNAAELVAAAEGAGFDAVFTGEAWGSDA
YTPLAWWGSSTQRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGL
GVSGPQVVEGWYGQPFPKPLSRTREYIDIVRQVWAREAPVVSDGQHYPLP
LTGAGATGLGKALKPITHPLRADIPIMLGAEGPKNVALAAEICDGWLPIF
FSPRMADMYNEWLDEGFARTGARRSREDFEICASAQIVVTEDRAAAFAGI
KPFLALYMGGMGAEGTNFHADVYRRMGYAEVVDEVTALFRSNQKDKAAEI
IPNELVDSTMIVGDVDYVCKQIAAWSAAGVTMMMVSASSVEQVRDLAGLF
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 1071 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579799747
Setting output file names to "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2084305593
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0483817905
Seed = 1349931064
Swapseed = 1579799747
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 8 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 8 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2344.050758 -- -24.965149
Chain 2 -- -2345.858186 -- -24.965149
Chain 3 -- -2344.054073 -- -24.965149
Chain 4 -- -2345.935874 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2344.053940 -- -24.965149
Chain 2 -- -2345.932279 -- -24.965149
Chain 3 -- -2345.932279 -- -24.965149
Chain 4 -- -2345.929860 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2344.051] (-2345.858) (-2344.054) (-2345.936) * [-2344.054] (-2345.932) (-2345.932) (-2345.930)
500 -- (-1451.124) (-1439.514) (-1443.322) [-1441.886] * (-1429.798) [-1434.803] (-1438.532) (-1453.628) -- 0:00:00
1000 -- (-1428.287) (-1431.537) [-1431.566] (-1428.554) * (-1430.344) (-1425.653) [-1428.416] (-1438.091) -- 0:00:00
1500 -- (-1427.173) [-1431.528] (-1424.353) (-1431.659) * (-1424.792) [-1426.987] (-1431.837) (-1441.103) -- 0:00:00
2000 -- (-1440.204) (-1437.701) [-1428.380] (-1427.481) * [-1422.665] (-1431.779) (-1423.524) (-1432.534) -- 0:00:00
2500 -- (-1427.322) [-1426.019] (-1429.106) (-1436.273) * (-1430.318) [-1431.794] (-1433.417) (-1429.435) -- 0:00:00
3000 -- [-1428.021] (-1422.511) (-1429.766) (-1428.894) * [-1436.053] (-1426.564) (-1432.297) (-1427.667) -- 0:00:00
3500 -- (-1429.725) (-1427.982) [-1435.363] (-1431.933) * (-1424.624) (-1428.129) [-1436.453] (-1429.541) -- 0:00:00
4000 -- (-1421.173) [-1425.049] (-1429.165) (-1428.935) * (-1424.603) (-1436.044) (-1429.654) [-1426.272] -- 0:00:00
4500 -- (-1427.261) (-1425.938) [-1425.585] (-1425.551) * (-1428.442) (-1428.633) (-1427.710) [-1427.480] -- 0:00:00
5000 -- [-1433.718] (-1427.894) (-1424.417) (-1426.931) * [-1431.894] (-1426.747) (-1430.343) (-1430.835) -- 0:03:19
Average standard deviation of split frequencies: 0.102479
5500 -- [-1427.797] (-1438.122) (-1438.714) (-1430.797) * (-1423.290) [-1427.880] (-1431.869) (-1427.172) -- 0:03:00
6000 -- (-1444.146) (-1427.484) [-1427.918] (-1438.044) * (-1429.648) (-1429.680) (-1434.931) [-1429.739] -- 0:02:45
6500 -- (-1429.538) (-1431.669) [-1428.962] (-1426.565) * (-1427.549) (-1426.667) (-1430.684) [-1435.258] -- 0:02:32
7000 -- (-1431.356) (-1427.357) (-1433.222) [-1426.612] * (-1431.202) (-1430.655) [-1427.539] (-1435.346) -- 0:02:21
7500 -- (-1425.713) (-1433.787) (-1432.063) [-1433.206] * (-1429.093) (-1423.767) [-1427.263] (-1432.683) -- 0:02:12
8000 -- [-1436.193] (-1430.473) (-1428.290) (-1429.495) * (-1424.544) (-1432.881) (-1424.032) [-1427.435] -- 0:02:04
8500 -- (-1433.370) (-1428.984) [-1425.542] (-1432.242) * [-1429.481] (-1425.635) (-1429.443) (-1426.274) -- 0:01:56
9000 -- (-1424.232) (-1434.661) [-1422.823] (-1425.086) * (-1432.414) [-1426.890] (-1425.732) (-1428.849) -- 0:01:50
9500 -- (-1426.019) [-1423.832] (-1430.620) (-1428.997) * [-1430.803] (-1433.830) (-1425.464) (-1428.178) -- 0:01:44
10000 -- [-1428.012] (-1426.369) (-1426.003) (-1424.638) * (-1429.275) (-1427.463) (-1428.223) [-1429.299] -- 0:01:39
Average standard deviation of split frequencies: 0.080353
10500 -- (-1425.156) [-1430.103] (-1436.664) (-1432.001) * (-1425.959) [-1434.355] (-1427.170) (-1430.707) -- 0:01:34
11000 -- (-1430.369) (-1432.515) [-1426.529] (-1431.938) * (-1426.666) [-1427.666] (-1431.350) (-1424.500) -- 0:01:29
11500 -- (-1425.344) (-1432.043) (-1426.934) [-1426.746] * (-1428.139) (-1424.555) [-1427.427] (-1429.757) -- 0:01:25
12000 -- [-1425.970] (-1427.305) (-1430.849) (-1433.550) * (-1425.664) [-1428.775] (-1435.536) (-1424.123) -- 0:01:22
12500 -- (-1425.920) (-1427.602) [-1425.924] (-1429.184) * [-1434.168] (-1438.934) (-1430.089) (-1421.983) -- 0:01:19
13000 -- (-1431.906) (-1431.103) (-1423.785) [-1428.052] * (-1426.158) [-1425.742] (-1426.722) (-1425.481) -- 0:01:15
13500 -- [-1426.210] (-1434.498) (-1425.066) (-1423.198) * [-1428.374] (-1437.252) (-1426.362) (-1440.842) -- 0:01:13
14000 -- (-1424.183) [-1434.376] (-1426.246) (-1427.934) * (-1428.768) (-1437.136) (-1432.038) [-1424.657] -- 0:01:10
14500 -- (-1433.746) [-1437.168] (-1427.333) (-1429.022) * (-1427.143) (-1440.285) (-1429.937) [-1427.586] -- 0:01:07
15000 -- (-1425.588) (-1427.393) [-1425.532] (-1425.157) * (-1426.854) [-1425.068] (-1433.016) (-1427.620) -- 0:01:05
Average standard deviation of split frequencies: 0.056247
15500 -- (-1430.497) (-1433.461) (-1430.655) [-1426.288] * (-1427.011) (-1431.550) [-1429.646] (-1427.111) -- 0:01:03
16000 -- (-1426.844) [-1426.452] (-1428.092) (-1428.566) * (-1430.700) (-1426.930) [-1427.204] (-1433.751) -- 0:01:01
16500 -- (-1435.007) (-1432.902) [-1426.497] (-1428.969) * (-1430.687) (-1431.812) [-1431.793] (-1436.914) -- 0:00:59
17000 -- (-1433.167) (-1423.523) (-1428.347) [-1429.200] * (-1423.586) (-1433.486) (-1422.931) [-1427.638] -- 0:01:55
17500 -- [-1429.753] (-1428.503) (-1428.223) (-1430.658) * [-1425.558] (-1432.025) (-1432.181) (-1429.307) -- 0:01:52
18000 -- (-1442.142) (-1430.164) [-1433.215] (-1431.462) * (-1427.290) (-1432.279) [-1423.517] (-1434.165) -- 0:01:49
18500 -- [-1420.304] (-1425.417) (-1429.935) (-1430.439) * (-1431.906) (-1426.791) (-1430.618) [-1433.364] -- 0:01:46
19000 -- (-1420.548) [-1430.740] (-1434.898) (-1427.703) * (-1424.360) (-1435.646) [-1429.787] (-1428.536) -- 0:01:43
19500 -- (-1420.570) (-1430.820) (-1426.892) [-1427.889] * [-1430.856] (-1434.188) (-1427.854) (-1431.406) -- 0:01:40
20000 -- [-1419.120] (-1426.467) (-1426.029) (-1428.342) * (-1432.339) [-1424.413] (-1435.104) (-1431.040) -- 0:01:38
Average standard deviation of split frequencies: 0.045620
20500 -- (-1422.387) (-1428.565) [-1427.625] (-1428.123) * [-1430.904] (-1428.711) (-1431.571) (-1429.477) -- 0:01:35
21000 -- (-1421.284) [-1431.756] (-1431.819) (-1430.332) * (-1425.649) (-1427.847) (-1429.316) [-1431.608] -- 0:01:33
21500 -- (-1424.992) [-1425.662] (-1434.209) (-1441.917) * (-1426.897) [-1430.151] (-1436.164) (-1436.127) -- 0:01:31
22000 -- (-1421.241) [-1425.483] (-1435.485) (-1429.931) * [-1428.570] (-1422.904) (-1429.695) (-1421.271) -- 0:01:28
22500 -- (-1422.211) [-1427.397] (-1430.414) (-1436.456) * (-1427.835) (-1432.474) (-1448.489) [-1421.966] -- 0:01:26
23000 -- [-1420.634] (-1423.799) (-1432.903) (-1432.290) * [-1425.338] (-1428.178) (-1420.682) (-1421.064) -- 0:01:24
23500 -- [-1419.355] (-1420.712) (-1424.536) (-1432.871) * (-1426.109) (-1438.481) (-1424.235) [-1421.319] -- 0:01:23
24000 -- (-1418.825) (-1423.416) (-1433.394) [-1431.314] * (-1424.471) (-1437.409) [-1420.909] (-1423.371) -- 0:01:21
24500 -- [-1417.854] (-1427.101) (-1430.071) (-1427.232) * [-1428.268] (-1433.593) (-1419.813) (-1419.959) -- 0:01:19
25000 -- (-1420.054) [-1426.795] (-1424.035) (-1433.250) * (-1436.799) (-1425.255) (-1420.096) [-1422.483] -- 0:01:18
Average standard deviation of split frequencies: 0.035474
25500 -- (-1420.016) (-1427.462) (-1428.592) [-1427.619] * (-1431.647) [-1430.978] (-1420.120) (-1420.999) -- 0:01:16
26000 -- [-1421.058] (-1430.472) (-1427.641) (-1431.149) * (-1430.921) (-1427.123) [-1420.591] (-1421.255) -- 0:01:14
26500 -- (-1424.159) [-1426.882] (-1421.885) (-1431.228) * (-1435.418) (-1428.411) [-1421.914] (-1421.418) -- 0:01:13
27000 -- (-1418.011) [-1427.965] (-1420.878) (-1433.044) * (-1431.212) (-1426.374) [-1420.327] (-1421.621) -- 0:01:12
27500 -- (-1418.639) [-1431.832] (-1422.322) (-1429.135) * (-1427.497) (-1433.968) [-1419.100] (-1420.975) -- 0:01:10
28000 -- [-1419.686] (-1429.871) (-1421.525) (-1426.740) * (-1431.382) (-1430.482) [-1420.570] (-1421.093) -- 0:01:09
28500 -- (-1419.730) (-1432.280) [-1419.764] (-1431.166) * [-1428.062] (-1426.884) (-1422.848) (-1421.758) -- 0:01:08
29000 -- (-1420.457) [-1426.743] (-1418.748) (-1431.356) * (-1427.556) [-1424.934] (-1421.917) (-1423.464) -- 0:01:40
29500 -- (-1422.112) [-1426.184] (-1418.834) (-1424.925) * [-1428.389] (-1426.807) (-1426.224) (-1425.277) -- 0:01:38
30000 -- (-1422.564) [-1425.636] (-1419.666) (-1429.611) * [-1430.623] (-1429.225) (-1418.549) (-1422.092) -- 0:01:37
Average standard deviation of split frequencies: 0.033818
30500 -- (-1424.646) (-1423.108) (-1420.183) [-1430.723] * [-1429.628] (-1432.569) (-1418.550) (-1421.095) -- 0:01:35
31000 -- (-1424.539) (-1433.965) [-1417.675] (-1432.105) * (-1432.032) [-1422.986] (-1419.413) (-1421.720) -- 0:01:33
31500 -- (-1425.509) (-1424.008) (-1417.669) [-1425.670] * [-1424.368] (-1439.824) (-1421.761) (-1418.884) -- 0:01:32
32000 -- (-1419.745) (-1428.504) (-1418.207) [-1425.478] * (-1423.466) [-1430.548] (-1422.387) (-1423.099) -- 0:01:30
32500 -- (-1418.943) [-1424.218] (-1418.264) (-1427.649) * (-1427.031) (-1427.109) [-1422.153] (-1423.019) -- 0:01:29
33000 -- (-1420.091) (-1431.921) (-1418.512) [-1427.375] * (-1431.766) (-1431.410) (-1422.013) [-1422.983] -- 0:01:27
33500 -- [-1418.578] (-1433.025) (-1420.016) (-1428.502) * (-1423.692) (-1428.565) [-1421.612] (-1418.291) -- 0:01:26
34000 -- [-1418.494] (-1429.355) (-1420.734) (-1424.364) * [-1426.774] (-1427.480) (-1419.385) (-1419.550) -- 0:01:25
34500 -- (-1418.819) [-1430.726] (-1423.735) (-1425.337) * (-1431.582) [-1425.109] (-1418.682) (-1418.358) -- 0:01:23
35000 -- (-1418.771) (-1431.372) (-1419.819) [-1425.861] * (-1427.415) (-1425.275) [-1419.238] (-1420.810) -- 0:01:22
Average standard deviation of split frequencies: 0.031703
35500 -- (-1419.207) [-1431.890] (-1420.882) (-1430.642) * (-1423.232) [-1421.646] (-1418.403) (-1421.667) -- 0:01:21
36000 -- (-1420.642) (-1430.009) (-1419.181) [-1433.267] * (-1427.450) (-1427.606) [-1419.084] (-1420.052) -- 0:01:20
36500 -- (-1422.263) (-1425.628) (-1418.835) [-1423.633] * (-1434.674) (-1433.870) (-1420.137) [-1420.065] -- 0:01:19
37000 -- [-1420.624] (-1434.044) (-1419.135) (-1439.244) * (-1428.435) (-1437.632) (-1420.070) [-1419.130] -- 0:01:18
37500 -- (-1419.143) [-1433.202] (-1419.082) (-1436.655) * (-1434.982) (-1432.400) [-1418.834] (-1420.667) -- 0:01:17
38000 -- (-1420.394) [-1426.470] (-1423.697) (-1439.378) * (-1426.217) [-1427.951] (-1418.434) (-1422.061) -- 0:01:15
38500 -- (-1419.165) (-1424.059) [-1421.469] (-1427.087) * [-1426.404] (-1427.252) (-1419.852) (-1420.872) -- 0:01:14
39000 -- (-1422.507) (-1423.804) [-1417.831] (-1432.968) * (-1427.148) (-1437.317) [-1418.915] (-1423.681) -- 0:01:13
39500 -- (-1421.009) [-1427.150] (-1419.153) (-1425.874) * (-1426.784) (-1434.451) [-1420.063] (-1421.554) -- 0:01:12
40000 -- [-1420.970] (-1426.983) (-1419.349) (-1425.200) * (-1424.827) (-1430.795) [-1418.527] (-1421.554) -- 0:01:12
Average standard deviation of split frequencies: 0.032048
40500 -- (-1420.099) (-1429.512) (-1418.434) [-1427.487] * (-1428.641) [-1426.683] (-1418.325) (-1423.699) -- 0:01:11
41000 -- (-1420.152) [-1429.530] (-1421.027) (-1431.877) * (-1435.503) [-1430.611] (-1418.714) (-1421.122) -- 0:01:10
41500 -- [-1420.476] (-1424.307) (-1418.893) (-1435.491) * [-1429.116] (-1434.431) (-1420.226) (-1420.841) -- 0:01:32
42000 -- (-1421.449) (-1429.276) (-1418.893) [-1428.753] * [-1427.869] (-1429.234) (-1422.578) (-1425.531) -- 0:01:31
42500 -- (-1419.272) [-1431.289] (-1418.772) (-1427.673) * (-1452.123) (-1427.852) [-1418.591] (-1424.367) -- 0:01:30
43000 -- [-1419.348] (-1427.484) (-1418.095) (-1426.534) * (-1426.551) (-1423.971) [-1422.977] (-1421.912) -- 0:01:29
43500 -- (-1420.172) [-1424.097] (-1420.704) (-1422.262) * (-1420.211) (-1427.299) (-1421.913) [-1421.026] -- 0:01:27
44000 -- (-1419.644) (-1428.265) (-1422.790) [-1433.961] * (-1419.228) (-1440.397) (-1421.714) [-1421.213] -- 0:01:26
44500 -- (-1419.392) (-1430.842) (-1419.604) [-1425.981] * (-1419.334) (-1430.486) (-1418.709) [-1422.155] -- 0:01:25
45000 -- (-1421.737) [-1424.842] (-1420.642) (-1431.267) * (-1420.139) (-1438.721) [-1421.232] (-1421.179) -- 0:01:24
Average standard deviation of split frequencies: 0.025843
45500 -- (-1419.928) [-1425.927] (-1421.547) (-1424.554) * (-1421.168) (-1434.445) [-1420.050] (-1419.963) -- 0:01:23
46000 -- (-1422.252) (-1427.881) [-1420.960] (-1428.507) * (-1421.759) (-1436.147) [-1419.258] (-1420.412) -- 0:01:22
46500 -- [-1422.763] (-1428.144) (-1420.720) (-1432.184) * (-1420.597) (-1427.008) (-1418.157) [-1421.768] -- 0:01:22
47000 -- (-1420.447) (-1435.077) [-1421.359] (-1426.570) * (-1418.914) (-1429.924) [-1418.883] (-1419.213) -- 0:01:21
47500 -- [-1420.831] (-1431.885) (-1433.428) (-1430.506) * [-1418.577] (-1434.465) (-1418.404) (-1420.536) -- 0:01:20
48000 -- (-1421.894) (-1428.458) (-1421.345) [-1426.545] * (-1417.869) (-1424.601) [-1420.327] (-1419.646) -- 0:01:19
48500 -- (-1422.931) [-1428.863] (-1421.876) (-1425.058) * [-1418.073] (-1430.917) (-1419.543) (-1421.477) -- 0:01:18
49000 -- (-1420.584) (-1433.595) [-1420.682] (-1425.874) * (-1418.537) [-1429.091] (-1420.895) (-1421.343) -- 0:01:17
49500 -- [-1422.239] (-1428.981) (-1422.176) (-1439.197) * [-1420.164] (-1425.100) (-1418.937) (-1420.832) -- 0:01:16
50000 -- [-1419.863] (-1431.599) (-1427.691) (-1434.307) * [-1422.034] (-1432.939) (-1418.029) (-1420.954) -- 0:01:16
Average standard deviation of split frequencies: 0.022596
50500 -- (-1419.865) [-1428.639] (-1424.415) (-1430.830) * (-1422.219) (-1428.972) [-1417.685] (-1422.034) -- 0:01:15
51000 -- (-1419.575) (-1434.172) (-1421.475) [-1422.667] * [-1421.237] (-1429.831) (-1418.391) (-1419.166) -- 0:01:14
51500 -- (-1419.894) (-1426.405) (-1425.138) [-1427.618] * (-1419.020) (-1430.086) [-1419.404] (-1418.509) -- 0:01:13
52000 -- (-1418.429) (-1435.070) (-1423.278) [-1425.688] * (-1419.261) (-1428.800) [-1418.276] (-1417.950) -- 0:01:12
52500 -- [-1418.715] (-1435.386) (-1419.311) (-1426.547) * [-1419.026] (-1423.578) (-1418.093) (-1418.255) -- 0:01:12
53000 -- [-1418.616] (-1426.377) (-1421.073) (-1427.958) * (-1417.780) [-1430.358] (-1418.655) (-1418.519) -- 0:01:11
53500 -- (-1420.922) [-1430.914] (-1421.432) (-1432.676) * (-1417.779) [-1426.670] (-1421.245) (-1419.890) -- 0:01:28
54000 -- (-1420.728) (-1427.219) (-1420.207) [-1425.178] * (-1418.639) (-1442.572) [-1419.719] (-1419.571) -- 0:01:27
54500 -- (-1421.286) (-1430.005) [-1418.491] (-1424.293) * (-1420.519) (-1424.159) (-1422.821) [-1422.356] -- 0:01:26
55000 -- (-1418.815) (-1428.095) [-1418.785] (-1429.490) * [-1420.701] (-1423.795) (-1421.670) (-1422.878) -- 0:01:25
Average standard deviation of split frequencies: 0.029241
55500 -- (-1419.802) [-1425.316] (-1419.132) (-1441.669) * (-1425.219) [-1419.187] (-1420.424) (-1428.106) -- 0:01:25
56000 -- [-1420.751] (-1445.428) (-1421.874) (-1426.898) * (-1424.246) [-1418.958] (-1421.843) (-1427.807) -- 0:01:24
56500 -- (-1419.222) [-1424.763] (-1419.577) (-1426.089) * (-1420.039) [-1418.288] (-1420.282) (-1419.111) -- 0:01:23
57000 -- (-1420.020) (-1422.188) (-1421.100) [-1424.065] * (-1420.201) [-1420.542] (-1421.469) (-1420.839) -- 0:01:22
57500 -- (-1418.765) (-1419.572) [-1420.093] (-1436.439) * (-1419.462) [-1419.626] (-1422.731) (-1421.530) -- 0:01:21
58000 -- [-1421.390] (-1419.773) (-1420.233) (-1425.162) * (-1422.949) [-1420.826] (-1420.644) (-1419.895) -- 0:01:21
58500 -- (-1418.562) [-1420.891] (-1419.772) (-1432.847) * (-1422.861) [-1419.625] (-1420.885) (-1423.440) -- 0:01:20
59000 -- (-1420.055) [-1421.268] (-1419.377) (-1431.641) * (-1421.747) (-1423.996) [-1422.691] (-1418.663) -- 0:01:19
59500 -- (-1420.846) (-1418.824) (-1422.274) [-1427.223] * (-1420.926) (-1421.712) [-1423.484] (-1419.675) -- 0:01:19
60000 -- (-1419.785) (-1418.742) [-1420.902] (-1431.790) * (-1421.391) (-1420.170) (-1418.321) [-1421.693] -- 0:01:18
Average standard deviation of split frequencies: 0.026583
60500 -- (-1418.856) (-1418.808) (-1420.770) [-1431.426] * (-1419.951) (-1420.200) (-1418.965) [-1418.475] -- 0:01:17
61000 -- [-1422.241] (-1421.748) (-1420.688) (-1427.456) * [-1421.196] (-1420.215) (-1418.761) (-1418.194) -- 0:01:16
61500 -- (-1424.005) [-1419.235] (-1423.428) (-1437.364) * (-1420.563) [-1421.150] (-1417.955) (-1419.454) -- 0:01:16
62000 -- (-1421.939) (-1420.121) [-1423.124] (-1424.130) * [-1419.276] (-1421.205) (-1418.245) (-1419.451) -- 0:01:15
62500 -- (-1421.258) [-1419.371] (-1425.278) (-1435.673) * [-1419.736] (-1421.053) (-1419.613) (-1420.357) -- 0:01:15
63000 -- (-1420.372) (-1418.733) [-1420.845] (-1430.478) * [-1421.190] (-1421.340) (-1422.100) (-1424.572) -- 0:01:14
63500 -- [-1421.339] (-1418.765) (-1424.244) (-1422.602) * (-1421.172) (-1422.196) (-1422.058) [-1420.465] -- 0:01:13
64000 -- (-1423.011) (-1420.857) (-1419.483) [-1428.123] * (-1420.639) (-1421.298) [-1419.208] (-1419.122) -- 0:01:13
64500 -- (-1420.958) (-1421.081) (-1422.079) [-1425.654] * (-1423.372) (-1422.721) [-1420.051] (-1419.664) -- 0:01:12
65000 -- (-1419.455) [-1419.830] (-1421.844) (-1422.331) * (-1421.199) (-1420.507) (-1421.870) [-1420.571] -- 0:01:11
Average standard deviation of split frequencies: 0.026427
65500 -- (-1420.456) (-1420.286) [-1420.500] (-1422.773) * (-1419.955) (-1418.297) [-1420.085] (-1421.504) -- 0:01:11
66000 -- (-1417.850) (-1419.536) (-1420.561) [-1423.505] * (-1419.959) (-1418.200) [-1418.253] (-1420.547) -- 0:01:24
66500 -- [-1418.007] (-1422.567) (-1421.109) (-1422.312) * (-1420.033) [-1421.309] (-1418.649) (-1422.984) -- 0:01:24
67000 -- [-1418.007] (-1418.493) (-1420.820) (-1422.988) * [-1418.839] (-1417.674) (-1418.023) (-1422.164) -- 0:01:23
67500 -- (-1418.888) (-1417.902) [-1418.998] (-1426.320) * (-1417.949) (-1417.747) (-1418.713) [-1418.922] -- 0:01:22
68000 -- (-1418.448) [-1418.637] (-1421.134) (-1422.164) * (-1417.949) (-1417.794) [-1419.682] (-1418.833) -- 0:01:22
68500 -- (-1417.844) (-1418.094) [-1422.484] (-1418.220) * [-1417.709] (-1418.043) (-1418.624) (-1418.823) -- 0:01:21
69000 -- (-1418.611) (-1427.563) (-1418.972) [-1418.023] * (-1417.694) (-1419.317) [-1418.106] (-1419.101) -- 0:01:20
69500 -- (-1421.322) (-1424.953) [-1421.069] (-1418.806) * [-1417.796] (-1418.430) (-1418.247) (-1418.925) -- 0:01:20
70000 -- [-1422.458] (-1428.357) (-1419.260) (-1417.954) * (-1418.760) [-1418.630] (-1422.690) (-1418.925) -- 0:01:19
Average standard deviation of split frequencies: 0.021347
70500 -- (-1420.915) (-1422.370) (-1418.438) [-1418.782] * [-1418.773] (-1419.411) (-1418.579) (-1419.741) -- 0:01:19
71000 -- (-1418.146) [-1419.157] (-1419.860) (-1418.994) * [-1418.925] (-1419.952) (-1419.773) (-1418.743) -- 0:01:18
71500 -- [-1418.558] (-1419.293) (-1420.148) (-1418.785) * (-1420.221) (-1421.154) (-1418.832) [-1418.743] -- 0:01:17
72000 -- (-1417.901) (-1419.291) (-1418.945) [-1418.198] * (-1419.337) (-1418.666) (-1420.980) [-1418.365] -- 0:01:17
72500 -- (-1417.828) [-1417.906] (-1419.201) (-1419.929) * (-1421.807) (-1418.545) [-1418.443] (-1418.239) -- 0:01:16
73000 -- [-1418.849] (-1418.074) (-1419.228) (-1418.475) * (-1419.102) (-1418.360) [-1419.646] (-1418.333) -- 0:01:16
73500 -- (-1420.130) [-1418.524] (-1420.708) (-1418.112) * (-1424.114) (-1421.270) [-1418.163] (-1420.263) -- 0:01:15
74000 -- (-1418.615) [-1418.211] (-1419.826) (-1419.366) * (-1419.768) [-1419.655] (-1419.824) (-1421.385) -- 0:01:15
74500 -- (-1419.658) (-1418.211) [-1421.116] (-1422.774) * (-1419.873) (-1419.452) [-1419.170] (-1422.652) -- 0:01:14
75000 -- (-1421.584) [-1418.377] (-1419.164) (-1419.023) * (-1419.756) (-1419.438) [-1419.518] (-1420.543) -- 0:01:14
Average standard deviation of split frequencies: 0.016976
75500 -- (-1421.073) [-1419.897] (-1421.550) (-1418.865) * [-1418.679] (-1418.443) (-1418.406) (-1421.819) -- 0:01:13
76000 -- (-1420.816) (-1420.957) [-1419.383] (-1420.899) * [-1419.740] (-1420.377) (-1418.406) (-1426.575) -- 0:01:12
76500 -- [-1419.697] (-1420.963) (-1419.211) (-1419.730) * [-1420.117] (-1419.427) (-1418.406) (-1424.264) -- 0:01:12
77000 -- (-1417.900) [-1419.267] (-1419.999) (-1420.264) * (-1421.546) [-1418.864] (-1419.035) (-1424.511) -- 0:01:11
77500 -- (-1420.339) (-1420.050) (-1421.889) [-1421.223] * (-1422.117) [-1418.851] (-1419.523) (-1425.986) -- 0:01:11
78000 -- (-1421.135) (-1418.874) (-1419.417) [-1420.249] * (-1418.145) (-1419.799) [-1420.558] (-1421.875) -- 0:01:10
78500 -- [-1420.447] (-1419.601) (-1419.161) (-1418.240) * [-1417.946] (-1419.800) (-1422.000) (-1421.204) -- 0:01:22
79000 -- (-1422.886) [-1424.581] (-1419.467) (-1418.094) * (-1418.095) [-1419.857] (-1423.592) (-1427.933) -- 0:01:21
79500 -- (-1424.154) [-1423.851] (-1420.179) (-1418.540) * (-1419.977) (-1418.865) (-1419.432) [-1422.779] -- 0:01:21
80000 -- [-1420.016] (-1421.375) (-1419.782) (-1418.015) * [-1420.237] (-1418.583) (-1419.183) (-1421.042) -- 0:01:20
Average standard deviation of split frequencies: 0.019480
80500 -- (-1421.932) (-1420.266) (-1421.203) [-1419.553] * (-1418.492) [-1418.968] (-1420.524) (-1420.282) -- 0:01:19
81000 -- (-1422.447) [-1423.392] (-1420.818) (-1419.960) * [-1417.948] (-1418.515) (-1420.050) (-1419.816) -- 0:01:19
81500 -- (-1422.398) (-1423.778) [-1420.945] (-1419.306) * (-1424.265) [-1418.820] (-1422.076) (-1422.818) -- 0:01:18
82000 -- (-1419.718) (-1423.529) (-1419.686) [-1425.956] * (-1422.235) (-1420.415) [-1419.678] (-1420.222) -- 0:01:18
82500 -- (-1418.389) (-1420.252) [-1421.464] (-1419.823) * [-1420.819] (-1418.733) (-1419.149) (-1418.339) -- 0:01:17
83000 -- [-1418.911] (-1421.486) (-1421.328) (-1419.661) * (-1420.423) (-1425.602) [-1418.255] (-1419.019) -- 0:01:17
83500 -- (-1418.910) (-1418.796) (-1423.265) [-1418.908] * (-1420.431) (-1423.020) [-1418.294] (-1419.996) -- 0:01:16
84000 -- (-1418.784) (-1418.932) (-1421.510) [-1418.981] * (-1419.066) (-1422.681) (-1419.671) [-1419.948] -- 0:01:16
84500 -- (-1418.869) [-1423.547] (-1419.020) (-1420.279) * [-1419.514] (-1420.410) (-1420.967) (-1419.098) -- 0:01:15
85000 -- (-1420.104) (-1419.667) [-1420.074] (-1418.385) * [-1420.229] (-1419.604) (-1419.547) (-1421.129) -- 0:01:15
Average standard deviation of split frequencies: 0.019733
85500 -- [-1418.332] (-1421.248) (-1421.076) (-1422.147) * [-1421.027] (-1423.446) (-1419.927) (-1421.696) -- 0:01:14
86000 -- (-1419.010) (-1419.404) [-1419.673] (-1422.219) * [-1420.236] (-1422.282) (-1422.808) (-1419.353) -- 0:01:14
86500 -- (-1419.478) (-1417.892) (-1419.090) [-1420.078] * (-1419.297) [-1422.603] (-1418.760) (-1420.463) -- 0:01:13
87000 -- (-1422.908) (-1421.635) (-1420.497) [-1420.915] * (-1419.811) (-1426.936) (-1418.680) [-1418.485] -- 0:01:13
87500 -- (-1419.618) (-1418.855) (-1418.483) [-1423.064] * [-1418.862] (-1421.107) (-1420.254) (-1418.083) -- 0:01:13
88000 -- (-1418.137) (-1419.504) [-1418.887] (-1420.945) * (-1421.458) (-1423.989) (-1418.212) [-1419.256] -- 0:01:12
88500 -- [-1418.001] (-1418.954) (-1418.553) (-1420.739) * (-1418.233) (-1422.146) [-1418.672] (-1418.692) -- 0:01:12
89000 -- [-1420.109] (-1421.358) (-1418.277) (-1419.903) * (-1419.412) (-1421.661) [-1421.037] (-1420.463) -- 0:01:11
89500 -- (-1419.445) (-1422.024) (-1418.258) [-1419.035] * (-1423.093) (-1419.625) [-1422.601] (-1423.113) -- 0:01:11
90000 -- [-1419.525] (-1419.673) (-1418.282) (-1419.063) * [-1421.195] (-1422.068) (-1420.068) (-1421.586) -- 0:01:10
Average standard deviation of split frequencies: 0.019064
90500 -- (-1418.324) (-1419.673) (-1418.584) [-1419.267] * (-1424.110) (-1419.829) (-1421.667) [-1420.579] -- 0:01:20
91000 -- (-1419.297) (-1418.229) [-1419.896] (-1419.477) * (-1420.425) (-1419.636) (-1422.365) [-1420.156] -- 0:01:19
91500 -- [-1420.056] (-1418.129) (-1420.791) (-1418.886) * (-1420.474) (-1421.950) [-1419.604] (-1420.201) -- 0:01:19
92000 -- (-1418.960) (-1420.106) (-1419.755) [-1418.349] * (-1421.465) (-1419.790) (-1421.149) [-1420.218] -- 0:01:18
92500 -- (-1420.580) [-1419.503] (-1423.596) (-1420.388) * [-1420.929] (-1421.053) (-1427.107) (-1418.785) -- 0:01:18
93000 -- (-1420.032) [-1418.664] (-1424.707) (-1419.853) * (-1424.160) [-1420.805] (-1430.273) (-1419.460) -- 0:01:18
93500 -- (-1420.184) [-1420.705] (-1421.499) (-1420.650) * (-1423.729) [-1417.983] (-1422.577) (-1418.211) -- 0:01:17
94000 -- (-1422.492) (-1421.034) (-1419.241) [-1418.521] * (-1424.536) [-1418.337] (-1419.182) (-1418.325) -- 0:01:17
94500 -- (-1424.556) [-1421.682] (-1419.850) (-1418.808) * (-1421.424) [-1419.323] (-1421.025) (-1418.123) -- 0:01:16
95000 -- (-1427.118) (-1422.793) [-1418.924] (-1418.124) * (-1421.830) [-1417.831] (-1423.570) (-1419.863) -- 0:01:16
Average standard deviation of split frequencies: 0.022097
95500 -- (-1420.098) (-1421.729) [-1420.802] (-1418.798) * [-1421.614] (-1417.795) (-1421.632) (-1423.737) -- 0:01:15
96000 -- [-1419.348] (-1419.453) (-1423.672) (-1418.814) * [-1422.741] (-1422.378) (-1422.830) (-1426.042) -- 0:01:15
96500 -- (-1421.076) (-1419.736) [-1420.200] (-1418.519) * [-1422.164] (-1424.082) (-1423.494) (-1419.022) -- 0:01:14
97000 -- (-1419.614) (-1419.922) (-1418.362) [-1422.705] * (-1425.393) (-1420.361) (-1422.373) [-1420.742] -- 0:01:14
97500 -- (-1421.542) (-1420.338) (-1420.416) [-1421.072] * (-1423.869) (-1420.793) [-1419.683] (-1422.107) -- 0:01:14
98000 -- (-1420.083) [-1420.447] (-1420.368) (-1417.893) * [-1423.982] (-1419.625) (-1424.960) (-1419.380) -- 0:01:13
98500 -- (-1419.945) [-1423.049] (-1420.957) (-1418.359) * (-1420.072) (-1419.214) (-1420.099) [-1420.317] -- 0:01:13
99000 -- [-1419.899] (-1418.599) (-1422.516) (-1418.359) * [-1419.985] (-1419.109) (-1420.025) (-1421.976) -- 0:01:12
99500 -- (-1419.623) (-1419.291) [-1418.265] (-1421.511) * (-1419.489) (-1420.950) [-1419.359] (-1423.611) -- 0:01:12
100000 -- [-1419.239] (-1419.812) (-1419.593) (-1422.058) * (-1419.959) [-1419.437] (-1419.545) (-1420.932) -- 0:01:12
Average standard deviation of split frequencies: 0.021541
100500 -- (-1420.260) [-1418.544] (-1418.750) (-1420.348) * (-1419.289) (-1421.410) (-1420.240) [-1418.474] -- 0:01:11
101000 -- (-1418.857) [-1418.305] (-1419.973) (-1417.610) * (-1421.548) [-1422.965] (-1423.179) (-1419.679) -- 0:01:20
101500 -- (-1420.876) (-1419.444) (-1423.868) [-1419.055] * (-1420.285) (-1421.240) [-1418.340] (-1420.253) -- 0:01:19
102000 -- (-1418.997) [-1418.539] (-1420.557) (-1418.302) * (-1418.189) (-1420.711) (-1418.686) [-1421.484] -- 0:01:19
102500 -- (-1417.878) (-1418.143) [-1419.485] (-1421.764) * (-1419.332) (-1423.192) [-1418.817] (-1420.951) -- 0:01:18
103000 -- (-1419.414) (-1418.058) [-1420.590] (-1424.158) * [-1421.073] (-1423.176) (-1418.751) (-1424.334) -- 0:01:18
103500 -- (-1422.705) (-1418.025) [-1421.436] (-1422.277) * (-1418.309) (-1418.897) (-1419.099) [-1421.175] -- 0:01:17
104000 -- (-1421.730) [-1419.450] (-1421.566) (-1421.642) * (-1419.378) (-1418.895) (-1421.005) [-1421.182] -- 0:01:17
104500 -- (-1421.563) (-1418.535) (-1422.283) [-1419.154] * (-1421.337) (-1419.905) [-1423.841] (-1421.147) -- 0:01:17
105000 -- (-1421.122) [-1420.734] (-1423.247) (-1423.891) * (-1419.314) (-1421.017) (-1421.673) [-1421.129] -- 0:01:16
Average standard deviation of split frequencies: 0.017344
105500 -- (-1420.865) (-1420.385) (-1421.363) [-1419.451] * (-1419.361) (-1420.568) (-1419.377) [-1419.282] -- 0:01:16
106000 -- [-1420.169] (-1419.601) (-1419.305) (-1419.989) * (-1421.788) (-1420.750) [-1419.224] (-1420.630) -- 0:01:15
106500 -- [-1419.562] (-1419.829) (-1420.046) (-1422.809) * (-1421.102) (-1423.599) (-1418.561) [-1419.085] -- 0:01:15
107000 -- (-1419.729) [-1420.598] (-1423.430) (-1422.904) * (-1421.293) (-1422.546) (-1420.118) [-1421.847] -- 0:01:15
107500 -- (-1422.067) [-1420.579] (-1419.595) (-1420.764) * [-1420.389] (-1421.554) (-1421.588) (-1419.132) -- 0:01:14
108000 -- [-1419.542] (-1423.047) (-1418.566) (-1417.892) * (-1422.313) (-1422.989) (-1420.228) [-1419.430] -- 0:01:14
108500 -- (-1419.449) [-1420.993] (-1418.609) (-1427.115) * (-1422.954) [-1421.945] (-1419.378) (-1419.535) -- 0:01:13
109000 -- (-1419.122) (-1422.252) (-1418.906) [-1420.193] * (-1421.939) (-1421.458) (-1418.373) [-1419.679] -- 0:01:13
109500 -- (-1419.987) (-1422.587) [-1417.987] (-1420.284) * [-1421.712] (-1419.067) (-1419.380) (-1422.005) -- 0:01:13
110000 -- (-1419.274) (-1420.458) [-1418.056] (-1421.763) * (-1419.736) (-1422.265) [-1421.213] (-1420.322) -- 0:01:12
Average standard deviation of split frequencies: 0.018317
110500 -- [-1418.823] (-1418.718) (-1418.194) (-1420.660) * (-1421.681) (-1420.439) (-1418.114) [-1418.793] -- 0:01:12
111000 -- [-1418.987] (-1418.015) (-1419.895) (-1425.056) * (-1420.547) (-1421.802) [-1418.884] (-1419.556) -- 0:01:12
111500 -- (-1418.942) (-1421.217) (-1420.800) [-1422.710] * (-1418.730) [-1419.183] (-1419.321) (-1421.299) -- 0:01:11
112000 -- [-1420.562] (-1419.341) (-1423.549) (-1423.284) * (-1418.630) (-1420.593) [-1419.246] (-1426.576) -- 0:01:11
112500 -- [-1420.191] (-1419.365) (-1417.927) (-1418.164) * (-1419.796) [-1418.855] (-1420.200) (-1426.137) -- 0:01:11
113000 -- (-1418.409) [-1419.701] (-1418.299) (-1418.936) * (-1418.716) [-1420.004] (-1423.739) (-1422.505) -- 0:01:10
113500 -- [-1419.820] (-1421.188) (-1418.298) (-1418.578) * [-1419.179] (-1419.975) (-1421.348) (-1420.387) -- 0:01:18
114000 -- (-1420.280) (-1422.013) [-1418.330] (-1418.198) * [-1419.718] (-1419.868) (-1419.804) (-1418.826) -- 0:01:17
114500 -- (-1418.296) (-1419.983) (-1418.368) [-1418.303] * (-1419.912) (-1420.336) [-1421.879] (-1418.933) -- 0:01:17
115000 -- (-1419.312) (-1418.815) [-1418.296] (-1420.032) * (-1428.096) [-1420.824] (-1424.746) (-1420.639) -- 0:01:16
Average standard deviation of split frequencies: 0.017474
115500 -- (-1418.293) [-1419.600] (-1422.966) (-1419.722) * (-1418.590) (-1422.226) (-1422.409) [-1419.041] -- 0:01:16
116000 -- [-1423.857] (-1420.261) (-1420.234) (-1420.234) * (-1420.357) (-1422.229) [-1418.447] (-1421.349) -- 0:01:16
116500 -- (-1420.507) (-1421.545) (-1419.837) [-1420.752] * [-1418.574] (-1422.921) (-1419.489) (-1421.593) -- 0:01:15
117000 -- (-1419.803) [-1420.052] (-1420.958) (-1421.576) * (-1420.401) [-1419.653] (-1423.397) (-1422.268) -- 0:01:15
117500 -- (-1421.464) (-1421.225) (-1425.128) [-1420.094] * (-1420.200) (-1420.628) (-1424.788) [-1425.837] -- 0:01:15
118000 -- (-1419.989) (-1419.074) [-1421.765] (-1420.681) * [-1420.199] (-1420.274) (-1419.729) (-1421.272) -- 0:01:14
118500 -- [-1419.691] (-1418.478) (-1419.319) (-1422.715) * [-1420.201] (-1421.714) (-1422.727) (-1421.086) -- 0:01:14
119000 -- (-1419.633) [-1418.853] (-1419.209) (-1420.763) * (-1419.138) [-1418.689] (-1421.588) (-1423.278) -- 0:01:14
119500 -- [-1422.419] (-1420.007) (-1418.791) (-1422.762) * (-1419.805) (-1419.274) [-1420.244] (-1418.501) -- 0:01:13
120000 -- [-1418.298] (-1423.114) (-1418.412) (-1422.667) * (-1420.552) [-1420.093] (-1425.196) (-1423.368) -- 0:01:13
Average standard deviation of split frequencies: 0.018947
120500 -- (-1419.666) (-1422.207) [-1421.618] (-1420.195) * (-1420.834) [-1424.005] (-1421.245) (-1424.672) -- 0:01:12
121000 -- [-1418.580] (-1420.834) (-1420.485) (-1419.071) * [-1420.240] (-1425.583) (-1421.995) (-1428.700) -- 0:01:12
121500 -- [-1421.021] (-1420.866) (-1420.043) (-1419.164) * (-1420.662) [-1419.181] (-1420.734) (-1421.389) -- 0:01:12
122000 -- (-1422.503) (-1422.865) (-1421.189) [-1418.296] * [-1420.351] (-1417.862) (-1420.588) (-1422.251) -- 0:01:11
122500 -- [-1420.672] (-1421.025) (-1419.620) (-1418.106) * (-1421.435) [-1418.868] (-1421.304) (-1421.261) -- 0:01:11
123000 -- (-1418.746) (-1419.860) (-1420.056) [-1419.298] * [-1423.155] (-1417.774) (-1419.767) (-1420.219) -- 0:01:11
123500 -- [-1420.450] (-1419.426) (-1420.262) (-1417.906) * (-1421.786) (-1418.654) [-1418.733] (-1419.432) -- 0:01:10
124000 -- (-1421.431) (-1427.491) [-1419.955] (-1418.095) * (-1419.810) (-1418.786) [-1418.832] (-1419.268) -- 0:01:10
124500 -- (-1418.813) (-1419.935) (-1418.359) [-1419.418] * (-1421.400) (-1418.372) (-1420.186) [-1418.793] -- 0:01:10
125000 -- [-1421.972] (-1420.422) (-1418.516) (-1418.788) * (-1423.838) (-1419.779) (-1420.274) [-1419.923] -- 0:01:10
Average standard deviation of split frequencies: 0.017584
125500 -- (-1420.335) (-1421.301) [-1417.931] (-1420.154) * (-1420.328) (-1419.665) (-1422.360) [-1421.848] -- 0:01:09
126000 -- (-1420.393) (-1421.713) [-1418.061] (-1425.257) * (-1422.577) (-1419.540) (-1420.863) [-1419.178] -- 0:01:16
126500 -- [-1420.599] (-1421.751) (-1418.062) (-1423.352) * [-1419.263] (-1418.640) (-1422.499) (-1423.067) -- 0:01:15
127000 -- (-1419.703) (-1421.097) (-1418.542) [-1418.081] * (-1419.215) (-1419.030) [-1421.332] (-1419.713) -- 0:01:15
127500 -- [-1418.746] (-1420.149) (-1419.515) (-1420.381) * (-1420.322) [-1420.201] (-1421.330) (-1424.250) -- 0:01:15
128000 -- [-1418.686] (-1421.893) (-1418.089) (-1419.096) * [-1419.228] (-1420.513) (-1421.561) (-1422.179) -- 0:01:14
128500 -- (-1418.125) [-1420.384] (-1418.832) (-1419.819) * (-1418.887) (-1423.395) [-1420.301] (-1423.237) -- 0:01:14
129000 -- [-1418.156] (-1419.537) (-1420.255) (-1419.880) * [-1420.048] (-1423.590) (-1421.703) (-1425.539) -- 0:01:14
129500 -- (-1419.341) (-1420.286) (-1419.285) [-1420.528] * (-1419.538) [-1424.671] (-1418.301) (-1422.365) -- 0:01:13
130000 -- (-1424.755) (-1421.819) [-1420.619] (-1419.881) * (-1420.272) (-1421.155) (-1418.673) [-1422.360] -- 0:01:13
Average standard deviation of split frequencies: 0.021456
130500 -- [-1423.220] (-1420.040) (-1419.136) (-1424.708) * (-1420.666) (-1425.534) [-1419.615] (-1421.484) -- 0:01:13
131000 -- (-1419.036) (-1420.999) [-1419.671] (-1423.071) * (-1418.792) (-1421.052) (-1420.637) [-1420.310] -- 0:01:12
131500 -- (-1423.286) (-1420.130) [-1419.070] (-1420.244) * (-1422.941) (-1421.693) [-1419.655] (-1422.413) -- 0:01:12
132000 -- [-1421.813] (-1419.551) (-1420.374) (-1418.795) * (-1423.169) (-1420.634) (-1420.046) [-1418.576] -- 0:01:12
132500 -- (-1423.197) [-1420.726] (-1418.706) (-1419.114) * (-1421.140) (-1419.696) (-1419.149) [-1419.059] -- 0:01:12
133000 -- (-1423.836) [-1420.411] (-1420.115) (-1422.427) * (-1422.013) [-1420.451] (-1419.046) (-1419.494) -- 0:01:11
133500 -- [-1419.315] (-1420.820) (-1419.214) (-1419.922) * (-1418.857) [-1419.986] (-1418.718) (-1418.927) -- 0:01:11
134000 -- (-1421.797) (-1418.059) [-1419.910] (-1419.609) * (-1419.869) [-1421.954] (-1421.627) (-1418.014) -- 0:01:11
134500 -- [-1419.327] (-1417.964) (-1418.865) (-1420.572) * (-1423.257) [-1422.297] (-1427.475) (-1417.942) -- 0:01:10
135000 -- [-1419.911] (-1420.184) (-1418.122) (-1426.393) * (-1419.347) (-1419.979) (-1423.137) [-1421.987] -- 0:01:10
Average standard deviation of split frequencies: 0.021709
135500 -- (-1424.266) [-1419.620] (-1419.726) (-1419.078) * [-1419.326] (-1420.292) (-1420.168) (-1424.162) -- 0:01:10
136000 -- (-1418.870) [-1421.455] (-1420.270) (-1421.310) * (-1420.067) (-1420.759) (-1420.597) [-1422.852] -- 0:01:09
136500 -- (-1421.632) [-1420.685] (-1419.464) (-1420.959) * [-1421.900] (-1420.807) (-1418.062) (-1421.098) -- 0:01:09
137000 -- (-1420.829) (-1419.802) [-1420.912] (-1420.955) * (-1420.381) [-1420.909] (-1421.049) (-1422.858) -- 0:01:09
137500 -- (-1420.525) (-1420.874) [-1418.731] (-1418.648) * (-1419.723) (-1420.793) (-1420.614) [-1424.825] -- 0:01:09
138000 -- (-1421.767) (-1418.361) (-1419.300) [-1418.173] * (-1423.082) [-1422.513] (-1419.217) (-1418.617) -- 0:01:08
138500 -- (-1419.594) [-1418.373] (-1418.835) (-1418.790) * (-1422.555) (-1420.357) (-1420.220) [-1419.721] -- 0:01:14
139000 -- (-1419.642) (-1420.043) [-1418.764] (-1419.270) * (-1422.796) [-1420.422] (-1419.300) (-1421.122) -- 0:01:14
139500 -- (-1420.092) [-1418.823] (-1419.260) (-1418.491) * [-1422.831] (-1420.197) (-1419.534) (-1418.985) -- 0:01:14
140000 -- (-1419.427) (-1419.864) [-1419.551] (-1418.690) * (-1422.326) [-1419.536] (-1421.122) (-1423.714) -- 0:01:13
Average standard deviation of split frequencies: 0.021695
140500 -- (-1418.237) [-1417.778] (-1418.526) (-1419.271) * (-1420.971) [-1418.601] (-1420.476) (-1421.117) -- 0:01:13
141000 -- (-1419.971) (-1418.262) [-1421.992] (-1422.765) * (-1420.855) (-1420.325) [-1419.543] (-1419.324) -- 0:01:13
141500 -- (-1419.365) (-1421.136) [-1422.389] (-1423.243) * (-1422.465) [-1418.739] (-1418.635) (-1419.037) -- 0:01:12
142000 -- [-1423.079] (-1420.340) (-1424.485) (-1420.627) * [-1422.455] (-1418.606) (-1419.922) (-1421.215) -- 0:01:12
142500 -- [-1419.084] (-1423.322) (-1423.376) (-1419.344) * (-1420.038) (-1418.094) (-1419.490) [-1420.359] -- 0:01:12
143000 -- (-1423.189) [-1419.980] (-1419.802) (-1419.635) * (-1422.906) [-1420.578] (-1420.811) (-1419.281) -- 0:01:11
143500 -- (-1419.926) (-1417.922) [-1421.094] (-1420.313) * (-1419.857) (-1422.961) [-1418.573] (-1419.481) -- 0:01:11
144000 -- [-1418.445] (-1425.438) (-1424.468) (-1422.474) * (-1418.333) [-1419.145] (-1418.643) (-1418.897) -- 0:01:11
144500 -- (-1418.225) [-1420.417] (-1419.248) (-1418.092) * (-1419.917) [-1418.908] (-1419.001) (-1418.280) -- 0:01:11
145000 -- (-1419.356) [-1418.527] (-1419.046) (-1418.298) * (-1420.453) (-1420.503) (-1421.493) [-1420.905] -- 0:01:10
Average standard deviation of split frequencies: 0.018523
145500 -- (-1418.597) [-1419.654] (-1418.859) (-1419.364) * (-1419.100) [-1422.020] (-1421.057) (-1422.234) -- 0:01:10
146000 -- (-1417.599) [-1419.163] (-1418.548) (-1418.432) * [-1418.811] (-1419.698) (-1424.607) (-1424.330) -- 0:01:10
146500 -- [-1419.987] (-1431.220) (-1418.808) (-1420.383) * (-1418.796) [-1418.860] (-1421.706) (-1422.080) -- 0:01:09
147000 -- (-1421.796) (-1422.637) (-1420.242) [-1420.324] * (-1419.541) (-1419.561) [-1420.591] (-1420.121) -- 0:01:09
147500 -- (-1422.503) [-1418.953] (-1419.992) (-1420.340) * (-1422.077) [-1419.787] (-1420.780) (-1422.027) -- 0:01:09
148000 -- [-1421.962] (-1418.957) (-1418.043) (-1427.439) * (-1420.629) [-1419.775] (-1422.710) (-1419.824) -- 0:01:09
148500 -- (-1420.348) (-1421.930) [-1418.299] (-1423.459) * [-1419.667] (-1421.153) (-1420.423) (-1423.405) -- 0:01:08
149000 -- (-1420.638) [-1419.195] (-1420.300) (-1420.425) * (-1418.886) (-1427.101) (-1421.314) [-1418.236] -- 0:01:08
149500 -- [-1419.586] (-1420.391) (-1420.317) (-1419.872) * (-1421.521) (-1419.154) [-1421.199] (-1418.606) -- 0:01:08
150000 -- (-1418.382) (-1418.510) [-1418.437] (-1418.908) * [-1422.525] (-1419.970) (-1419.763) (-1420.492) -- 0:01:08
Average standard deviation of split frequencies: 0.017949
150500 -- (-1419.346) (-1418.612) (-1419.426) [-1420.240] * (-1426.500) [-1419.883] (-1421.223) (-1424.186) -- 0:01:13
151000 -- (-1418.710) (-1418.784) [-1420.863] (-1420.058) * [-1420.564] (-1419.928) (-1419.948) (-1422.243) -- 0:01:13
151500 -- (-1418.924) (-1418.749) (-1420.120) [-1419.908] * [-1418.831] (-1420.038) (-1419.600) (-1420.070) -- 0:01:12
152000 -- [-1418.947] (-1421.025) (-1424.604) (-1421.326) * (-1418.900) (-1418.993) [-1419.968] (-1419.078) -- 0:01:12
152500 -- (-1418.317) [-1419.898] (-1419.147) (-1419.786) * [-1417.782] (-1421.854) (-1419.436) (-1419.893) -- 0:01:12
153000 -- (-1420.012) (-1420.167) (-1419.993) [-1420.089] * (-1422.274) (-1420.504) [-1420.222] (-1418.339) -- 0:01:11
153500 -- [-1420.572] (-1418.586) (-1418.832) (-1421.525) * [-1418.943] (-1419.992) (-1419.234) (-1418.254) -- 0:01:11
154000 -- [-1419.596] (-1419.823) (-1419.080) (-1420.556) * (-1420.948) (-1418.494) (-1420.729) [-1417.981] -- 0:01:11
154500 -- (-1421.570) (-1418.569) [-1418.994] (-1420.247) * (-1420.503) (-1421.676) [-1418.313] (-1421.384) -- 0:01:11
155000 -- (-1424.124) (-1419.088) (-1420.232) [-1421.632] * (-1419.861) (-1420.310) (-1418.260) [-1419.495] -- 0:01:10
Average standard deviation of split frequencies: 0.016859
155500 -- (-1421.906) (-1418.552) (-1420.021) [-1419.725] * (-1419.114) (-1418.843) [-1418.442] (-1419.169) -- 0:01:10
156000 -- (-1421.585) (-1422.177) [-1419.185] (-1421.877) * (-1418.905) [-1418.790] (-1418.751) (-1420.406) -- 0:01:10
156500 -- [-1419.094] (-1420.610) (-1420.465) (-1420.105) * [-1419.235] (-1420.258) (-1419.324) (-1421.310) -- 0:01:10
157000 -- [-1418.201] (-1423.014) (-1422.982) (-1421.679) * [-1419.839] (-1421.086) (-1420.599) (-1418.833) -- 0:01:09
157500 -- (-1418.196) (-1419.942) [-1422.832] (-1424.689) * (-1419.955) (-1418.522) [-1420.612] (-1420.669) -- 0:01:09
158000 -- (-1419.102) (-1419.716) (-1421.368) [-1419.932] * (-1420.463) [-1420.391] (-1420.332) (-1418.599) -- 0:01:09
158500 -- (-1418.814) [-1420.640] (-1420.360) (-1422.481) * (-1424.221) (-1421.568) (-1424.980) [-1419.552] -- 0:01:09
159000 -- (-1419.234) [-1419.868] (-1420.121) (-1427.703) * [-1422.912] (-1420.099) (-1421.262) (-1420.976) -- 0:01:08
159500 -- (-1418.905) (-1420.583) (-1420.884) [-1423.405] * (-1422.297) (-1420.057) [-1419.221] (-1418.915) -- 0:01:08
160000 -- [-1418.330] (-1419.495) (-1419.931) (-1426.432) * (-1419.636) [-1419.416] (-1420.298) (-1418.985) -- 0:01:08
Average standard deviation of split frequencies: 0.018994
160500 -- (-1418.965) [-1422.441] (-1418.580) (-1424.726) * (-1419.980) [-1420.198] (-1419.343) (-1423.822) -- 0:01:07
161000 -- (-1419.030) (-1419.592) [-1421.335] (-1418.690) * [-1419.063] (-1421.970) (-1419.264) (-1418.485) -- 0:01:07
161500 -- (-1421.235) (-1421.013) (-1420.848) [-1422.615] * [-1420.092] (-1421.417) (-1418.927) (-1420.458) -- 0:01:07
162000 -- (-1419.822) (-1421.363) [-1419.375] (-1422.653) * (-1418.354) [-1419.855] (-1418.423) (-1420.884) -- 0:01:07
162500 -- (-1423.511) (-1421.115) [-1419.438] (-1419.024) * (-1418.355) (-1419.830) [-1418.481] (-1417.904) -- 0:01:07
163000 -- (-1420.786) (-1418.192) (-1420.143) [-1418.625] * [-1418.207] (-1421.544) (-1419.366) (-1422.059) -- 0:01:11
163500 -- [-1420.869] (-1420.668) (-1419.940) (-1418.559) * (-1418.644) (-1417.715) (-1419.702) [-1419.930] -- 0:01:11
164000 -- (-1418.891) [-1419.727] (-1420.247) (-1420.060) * (-1420.660) (-1420.751) (-1419.751) [-1420.602] -- 0:01:11
164500 -- (-1421.461) (-1417.713) [-1423.691] (-1420.871) * (-1418.593) (-1418.971) [-1420.918] (-1420.493) -- 0:01:11
165000 -- (-1421.296) (-1417.748) [-1423.257] (-1418.655) * (-1419.840) (-1419.501) (-1420.814) [-1420.020] -- 0:01:10
Average standard deviation of split frequencies: 0.020177
165500 -- (-1421.229) [-1419.868] (-1421.020) (-1419.344) * (-1422.621) [-1417.601] (-1420.282) (-1420.388) -- 0:01:10
166000 -- (-1422.579) (-1420.565) (-1420.451) [-1418.950] * [-1419.546] (-1418.834) (-1422.804) (-1420.486) -- 0:01:10
166500 -- (-1419.362) (-1418.712) [-1425.129] (-1419.995) * [-1418.981] (-1419.372) (-1423.768) (-1420.898) -- 0:01:10
167000 -- (-1420.118) [-1418.791] (-1426.985) (-1418.411) * (-1420.936) [-1419.636] (-1419.020) (-1421.623) -- 0:01:09
167500 -- (-1418.623) (-1418.090) (-1418.146) [-1418.621] * (-1420.337) (-1419.267) (-1418.659) [-1419.551] -- 0:01:09
168000 -- [-1421.107] (-1418.899) (-1418.104) (-1418.591) * (-1422.228) (-1418.516) (-1420.614) [-1418.640] -- 0:01:09
168500 -- (-1418.273) (-1417.960) (-1418.104) [-1419.085] * (-1419.399) (-1418.440) (-1420.372) [-1418.694] -- 0:01:09
169000 -- (-1418.193) (-1417.959) [-1418.728] (-1417.965) * (-1419.413) [-1417.999] (-1423.825) (-1417.792) -- 0:01:08
169500 -- (-1419.746) (-1418.458) (-1418.691) [-1420.438] * (-1421.446) [-1421.493] (-1422.503) (-1418.955) -- 0:01:08
170000 -- (-1419.421) [-1422.211] (-1418.584) (-1419.383) * (-1422.183) (-1418.974) (-1420.968) [-1419.310] -- 0:01:08
Average standard deviation of split frequencies: 0.019626
170500 -- (-1421.301) (-1419.203) (-1419.734) [-1419.157] * [-1418.155] (-1421.897) (-1417.672) (-1420.549) -- 0:01:08
171000 -- (-1419.091) (-1417.784) (-1419.019) [-1421.384] * (-1422.586) [-1420.368] (-1417.932) (-1421.005) -- 0:01:07
171500 -- (-1420.381) [-1417.769] (-1419.614) (-1418.711) * (-1418.344) (-1420.383) [-1419.377] (-1420.187) -- 0:01:07
172000 -- (-1420.328) [-1417.723] (-1420.594) (-1420.249) * [-1419.135] (-1417.675) (-1419.202) (-1420.537) -- 0:01:07
172500 -- (-1421.661) [-1418.509] (-1421.401) (-1421.982) * [-1419.042] (-1419.762) (-1419.645) (-1421.145) -- 0:01:07
173000 -- (-1420.749) (-1421.480) (-1420.289) [-1419.712] * (-1418.652) (-1420.017) (-1420.414) [-1423.761] -- 0:01:06
173500 -- [-1419.792] (-1418.336) (-1420.409) (-1419.237) * (-1419.408) (-1420.006) (-1418.471) [-1422.220] -- 0:01:06
174000 -- (-1423.127) (-1418.603) (-1422.229) [-1418.514] * [-1419.023] (-1420.402) (-1421.031) (-1423.228) -- 0:01:06
174500 -- (-1420.868) (-1418.426) (-1419.121) [-1418.686] * (-1418.325) [-1420.532] (-1426.910) (-1420.008) -- 0:01:06
175000 -- (-1421.965) (-1420.859) [-1420.684] (-1419.270) * [-1418.302] (-1418.558) (-1419.926) (-1420.873) -- 0:01:06
Average standard deviation of split frequencies: 0.020237
175500 -- [-1420.039] (-1420.035) (-1417.934) (-1420.583) * (-1421.721) [-1420.436] (-1419.112) (-1419.475) -- 0:01:10
176000 -- (-1418.910) [-1418.889] (-1420.067) (-1421.194) * (-1420.081) (-1422.010) [-1419.420] (-1418.387) -- 0:01:10
176500 -- (-1418.763) [-1418.331] (-1419.921) (-1421.108) * [-1420.154] (-1419.202) (-1419.432) (-1418.536) -- 0:01:09
177000 -- [-1419.129] (-1418.849) (-1425.086) (-1420.421) * [-1423.524] (-1420.714) (-1418.068) (-1423.222) -- 0:01:09
177500 -- (-1418.443) (-1418.547) [-1421.384] (-1419.220) * [-1418.639] (-1418.384) (-1421.325) (-1424.321) -- 0:01:09
178000 -- (-1420.099) (-1420.335) (-1419.221) [-1419.141] * [-1419.352] (-1420.547) (-1422.218) (-1421.035) -- 0:01:09
178500 -- (-1420.568) (-1419.083) [-1418.966] (-1423.014) * (-1418.534) (-1418.126) [-1417.750] (-1420.864) -- 0:01:09
179000 -- [-1419.273] (-1419.391) (-1418.124) (-1424.489) * (-1420.173) (-1420.130) (-1417.982) [-1419.212] -- 0:01:08
179500 -- [-1419.774] (-1419.279) (-1421.082) (-1419.159) * (-1419.038) (-1421.066) (-1418.865) [-1419.205] -- 0:01:08
180000 -- (-1419.783) (-1421.039) [-1419.232] (-1419.716) * [-1419.635] (-1419.124) (-1419.915) (-1419.126) -- 0:01:08
Average standard deviation of split frequencies: 0.018845
180500 -- (-1420.556) [-1418.641] (-1418.260) (-1417.977) * (-1421.763) [-1420.004] (-1420.239) (-1419.677) -- 0:01:08
181000 -- (-1418.802) [-1421.499] (-1419.569) (-1422.172) * (-1421.704) (-1419.711) (-1421.221) [-1420.333] -- 0:01:07
181500 -- (-1419.212) (-1425.619) (-1422.473) [-1420.091] * (-1420.757) (-1420.518) [-1418.967] (-1420.995) -- 0:01:07
182000 -- (-1418.960) (-1427.895) (-1421.169) [-1420.830] * (-1418.853) (-1422.388) (-1418.930) [-1420.921] -- 0:01:07
182500 -- (-1418.645) (-1420.064) [-1419.024] (-1421.285) * (-1423.712) [-1421.650] (-1418.799) (-1418.472) -- 0:01:07
183000 -- (-1419.622) (-1418.754) (-1419.112) [-1422.207] * (-1421.735) (-1420.766) [-1420.077] (-1420.337) -- 0:01:06
183500 -- (-1425.240) (-1419.203) [-1418.925] (-1421.437) * (-1420.255) (-1418.796) [-1419.406] (-1420.772) -- 0:01:06
184000 -- [-1419.324] (-1418.796) (-1418.503) (-1421.592) * (-1420.849) (-1425.916) (-1420.687) [-1418.432] -- 0:01:06
184500 -- (-1420.909) [-1419.521] (-1418.520) (-1422.831) * [-1420.925] (-1428.666) (-1419.248) (-1418.315) -- 0:01:06
185000 -- [-1420.466] (-1420.094) (-1420.037) (-1418.355) * (-1421.292) (-1417.971) [-1421.598] (-1421.873) -- 0:01:06
Average standard deviation of split frequencies: 0.017459
185500 -- (-1419.952) (-1421.932) [-1418.348] (-1420.607) * (-1419.756) (-1420.632) (-1422.633) [-1420.245] -- 0:01:05
186000 -- (-1419.629) [-1419.483] (-1418.891) (-1420.926) * (-1419.766) (-1418.786) (-1424.056) [-1423.000] -- 0:01:05
186500 -- (-1419.024) [-1419.441] (-1418.783) (-1421.357) * (-1418.709) [-1421.123] (-1420.649) (-1426.458) -- 0:01:05
187000 -- (-1418.807) [-1420.810] (-1419.735) (-1423.168) * (-1423.179) [-1418.794] (-1421.120) (-1418.526) -- 0:01:05
187500 -- [-1418.779] (-1418.968) (-1419.726) (-1420.362) * (-1420.379) [-1420.965] (-1423.928) (-1421.466) -- 0:01:05
188000 -- [-1418.768] (-1420.235) (-1419.726) (-1420.510) * (-1419.767) (-1423.095) (-1422.807) [-1418.634] -- 0:01:09
188500 -- (-1420.524) (-1419.421) (-1421.409) [-1419.636] * [-1418.421] (-1421.758) (-1423.033) (-1418.290) -- 0:01:08
189000 -- (-1426.351) [-1418.870] (-1420.746) (-1420.609) * (-1418.428) (-1419.621) (-1421.569) [-1419.182] -- 0:01:08
189500 -- (-1419.331) (-1419.229) [-1420.764] (-1418.657) * (-1420.931) (-1418.985) [-1420.879] (-1419.025) -- 0:01:08
190000 -- (-1420.842) (-1419.515) (-1418.798) [-1418.401] * [-1418.065] (-1418.040) (-1419.353) (-1419.631) -- 0:01:08
Average standard deviation of split frequencies: 0.014285
190500 -- (-1422.362) [-1417.858] (-1419.474) (-1419.016) * (-1418.980) (-1420.268) (-1419.559) [-1418.188] -- 0:01:07
191000 -- (-1418.304) (-1420.550) (-1418.514) [-1420.554] * [-1419.015] (-1419.747) (-1419.543) (-1422.821) -- 0:01:07
191500 -- (-1420.220) [-1423.662] (-1418.168) (-1420.874) * (-1419.511) [-1418.232] (-1419.068) (-1422.556) -- 0:01:07
192000 -- (-1419.617) [-1421.161] (-1418.169) (-1419.771) * [-1419.729] (-1423.777) (-1422.340) (-1420.913) -- 0:01:07
192500 -- (-1420.797) (-1420.605) [-1418.245] (-1419.299) * (-1419.898) (-1418.353) (-1419.137) [-1422.166] -- 0:01:07
193000 -- (-1420.004) (-1420.598) [-1419.493] (-1419.165) * [-1418.938] (-1419.183) (-1420.525) (-1421.132) -- 0:01:06
193500 -- [-1418.170] (-1421.353) (-1420.173) (-1418.805) * (-1419.852) [-1418.124] (-1422.184) (-1422.352) -- 0:01:06
194000 -- (-1417.937) (-1421.982) (-1423.700) [-1418.713] * (-1419.394) (-1419.530) [-1418.549] (-1420.983) -- 0:01:06
194500 -- (-1419.589) (-1424.343) (-1421.487) [-1426.111] * (-1419.592) (-1418.982) [-1418.739] (-1418.294) -- 0:01:06
195000 -- (-1419.852) (-1422.513) (-1421.922) [-1418.321] * [-1420.977] (-1421.285) (-1419.844) (-1418.325) -- 0:01:06
Average standard deviation of split frequencies: 0.014698
195500 -- (-1421.656) [-1420.927] (-1419.833) (-1419.701) * (-1420.983) (-1420.321) [-1420.113] (-1426.676) -- 0:01:05
196000 -- (-1424.121) [-1420.781] (-1420.372) (-1421.320) * (-1421.908) (-1420.345) (-1419.494) [-1421.752] -- 0:01:05
196500 -- (-1422.447) [-1420.083] (-1420.227) (-1422.105) * (-1423.055) (-1420.692) [-1419.668] (-1420.125) -- 0:01:05
197000 -- [-1418.424] (-1420.333) (-1420.673) (-1424.600) * (-1421.793) (-1422.021) [-1420.782] (-1419.762) -- 0:01:05
197500 -- (-1418.666) (-1421.998) [-1419.568] (-1425.645) * (-1423.228) [-1419.754] (-1420.519) (-1419.520) -- 0:01:05
198000 -- (-1422.193) (-1421.319) [-1419.911] (-1422.844) * (-1421.783) (-1418.092) (-1419.662) [-1420.574] -- 0:01:04
198500 -- (-1420.059) [-1420.574] (-1420.396) (-1418.853) * [-1418.222] (-1419.043) (-1421.194) (-1419.142) -- 0:01:04
199000 -- (-1420.480) (-1424.739) [-1423.143] (-1418.315) * [-1418.301] (-1418.079) (-1422.598) (-1421.961) -- 0:01:04
199500 -- [-1418.658] (-1419.599) (-1421.818) (-1418.279) * (-1419.261) (-1420.797) [-1424.261] (-1425.612) -- 0:01:04
200000 -- (-1419.478) [-1419.195] (-1419.597) (-1417.626) * (-1420.003) [-1418.160] (-1423.060) (-1419.708) -- 0:01:04
Average standard deviation of split frequencies: 0.014356
200500 -- [-1420.520] (-1419.660) (-1420.527) (-1419.701) * [-1420.445] (-1418.211) (-1421.069) (-1419.307) -- 0:01:07
201000 -- (-1420.510) [-1420.781] (-1420.565) (-1418.386) * (-1420.728) [-1418.606] (-1420.275) (-1418.798) -- 0:01:07
201500 -- (-1420.104) (-1424.635) (-1422.790) [-1419.734] * (-1423.537) [-1419.511] (-1421.109) (-1418.660) -- 0:01:07
202000 -- [-1419.226] (-1423.910) (-1419.877) (-1418.162) * (-1422.121) (-1418.020) [-1419.179] (-1418.168) -- 0:01:07
202500 -- (-1421.322) (-1419.982) (-1422.463) [-1417.575] * (-1420.610) (-1417.917) (-1419.424) [-1417.991] -- 0:01:06
203000 -- (-1421.095) (-1420.331) [-1425.076] (-1420.150) * (-1421.890) [-1417.917] (-1418.485) (-1419.927) -- 0:01:06
203500 -- [-1425.499] (-1417.873) (-1422.319) (-1418.962) * (-1420.630) [-1417.907] (-1420.164) (-1417.778) -- 0:01:06
204000 -- (-1422.982) (-1417.873) [-1421.729] (-1419.650) * [-1420.849] (-1424.883) (-1421.664) (-1417.724) -- 0:01:06
204500 -- (-1419.422) (-1419.718) [-1421.183] (-1420.622) * (-1419.424) [-1421.248] (-1421.237) (-1420.283) -- 0:01:06
205000 -- [-1420.221] (-1418.007) (-1419.471) (-1420.753) * [-1419.093] (-1420.114) (-1419.149) (-1420.215) -- 0:01:05
Average standard deviation of split frequencies: 0.014694
205500 -- (-1420.948) [-1419.480] (-1421.932) (-1421.027) * [-1421.074] (-1418.969) (-1418.655) (-1421.261) -- 0:01:05
206000 -- (-1419.253) (-1419.929) [-1420.707] (-1420.596) * [-1418.978] (-1418.890) (-1421.413) (-1418.883) -- 0:01:05
206500 -- (-1419.936) (-1420.613) (-1421.644) [-1420.455] * (-1420.323) [-1419.274] (-1418.566) (-1419.065) -- 0:01:05
207000 -- [-1419.793] (-1424.899) (-1421.243) (-1419.823) * [-1420.022] (-1423.446) (-1422.130) (-1419.417) -- 0:01:05
207500 -- (-1419.674) (-1419.721) [-1420.906] (-1419.389) * [-1420.626] (-1421.127) (-1424.140) (-1420.462) -- 0:01:04
208000 -- (-1418.578) (-1420.896) [-1420.747] (-1418.327) * (-1424.918) (-1419.234) [-1420.338] (-1418.285) -- 0:01:04
208500 -- (-1423.563) (-1421.491) [-1419.613] (-1419.801) * [-1418.683] (-1419.226) (-1419.803) (-1422.148) -- 0:01:04
209000 -- (-1421.691) [-1420.318] (-1421.495) (-1417.683) * (-1423.777) (-1418.683) (-1418.388) [-1418.716] -- 0:01:04
209500 -- [-1419.494] (-1421.282) (-1421.220) (-1420.518) * (-1426.024) (-1419.045) (-1418.402) [-1418.266] -- 0:01:04
210000 -- (-1418.963) (-1425.074) [-1418.918] (-1420.943) * [-1420.863] (-1420.478) (-1422.343) (-1422.741) -- 0:01:03
Average standard deviation of split frequencies: 0.014604
210500 -- (-1418.235) (-1419.445) [-1418.910] (-1422.678) * (-1420.847) (-1420.840) (-1419.827) [-1418.265] -- 0:01:03
211000 -- (-1418.637) (-1419.385) (-1421.046) [-1419.013] * (-1420.784) (-1423.191) [-1419.877] (-1419.844) -- 0:01:03
211500 -- (-1420.431) [-1418.805] (-1419.400) (-1418.017) * (-1419.473) (-1418.841) (-1419.466) [-1422.088] -- 0:01:03
212000 -- (-1428.799) (-1422.848) (-1418.252) [-1419.660] * (-1421.310) (-1419.307) [-1420.308] (-1422.364) -- 0:01:03
212500 -- (-1421.384) [-1421.226] (-1423.440) (-1418.159) * (-1420.055) (-1420.399) [-1420.755] (-1421.416) -- 0:01:03
213000 -- (-1421.438) (-1418.481) [-1420.848] (-1423.073) * [-1418.887] (-1418.041) (-1421.980) (-1417.899) -- 0:01:02
213500 -- (-1423.612) (-1419.262) [-1418.374] (-1425.735) * [-1419.751] (-1418.074) (-1423.971) (-1419.351) -- 0:01:06
214000 -- [-1419.287] (-1419.533) (-1419.681) (-1427.716) * (-1419.210) [-1418.078] (-1419.380) (-1419.351) -- 0:01:06
214500 -- (-1419.730) (-1419.929) (-1419.569) [-1421.396] * [-1420.034] (-1417.856) (-1417.947) (-1419.080) -- 0:01:05
215000 -- (-1419.397) (-1421.389) (-1419.061) [-1421.468] * [-1421.640] (-1419.713) (-1422.870) (-1418.076) -- 0:01:05
Average standard deviation of split frequencies: 0.014307
215500 -- (-1420.260) [-1418.667] (-1420.930) (-1424.439) * [-1420.617] (-1419.756) (-1421.549) (-1419.103) -- 0:01:05
216000 -- (-1423.510) [-1418.499] (-1422.026) (-1423.211) * (-1420.899) (-1419.308) (-1421.878) [-1421.533] -- 0:01:05
216500 -- (-1418.667) (-1418.429) (-1421.308) [-1421.922] * [-1420.825] (-1421.391) (-1421.656) (-1420.095) -- 0:01:05
217000 -- (-1421.609) [-1422.781] (-1421.542) (-1418.808) * (-1421.557) (-1418.873) [-1420.623] (-1422.322) -- 0:01:04
217500 -- (-1420.232) (-1420.611) [-1419.696] (-1419.320) * (-1421.180) (-1418.870) [-1419.744] (-1421.943) -- 0:01:04
218000 -- (-1420.041) (-1418.491) [-1418.718] (-1418.246) * (-1419.134) (-1419.587) (-1422.257) [-1419.975] -- 0:01:04
218500 -- (-1421.824) (-1418.588) [-1418.535] (-1420.081) * (-1418.171) (-1420.049) (-1420.607) [-1418.361] -- 0:01:04
219000 -- (-1419.101) (-1418.065) [-1420.928] (-1421.172) * (-1422.106) [-1420.937] (-1421.358) (-1418.179) -- 0:01:04
219500 -- (-1419.413) [-1418.309] (-1420.531) (-1421.376) * [-1421.510] (-1421.595) (-1419.825) (-1425.401) -- 0:01:04
220000 -- (-1420.209) (-1418.313) (-1424.176) [-1421.033] * [-1423.823] (-1419.848) (-1420.083) (-1428.524) -- 0:01:03
Average standard deviation of split frequencies: 0.013155
220500 -- [-1419.426] (-1419.083) (-1421.663) (-1418.530) * (-1419.343) [-1419.235] (-1419.851) (-1420.447) -- 0:01:03
221000 -- [-1419.565] (-1418.983) (-1422.735) (-1420.621) * (-1421.899) [-1419.268] (-1419.975) (-1421.280) -- 0:01:03
221500 -- [-1423.609] (-1420.980) (-1419.949) (-1421.427) * [-1419.297] (-1419.377) (-1421.118) (-1423.642) -- 0:01:03
222000 -- (-1421.949) (-1419.589) [-1423.973] (-1425.410) * (-1423.457) [-1419.488] (-1420.017) (-1422.794) -- 0:01:03
222500 -- (-1422.300) (-1421.365) (-1423.703) [-1421.951] * (-1418.724) (-1420.210) [-1419.174] (-1419.667) -- 0:01:02
223000 -- (-1421.699) (-1421.846) (-1419.617) [-1417.649] * [-1418.628] (-1419.123) (-1420.410) (-1420.695) -- 0:01:02
223500 -- (-1422.021) (-1419.077) (-1419.100) [-1418.678] * (-1418.780) [-1419.216] (-1420.878) (-1417.862) -- 0:01:02
224000 -- (-1420.395) (-1421.631) (-1419.198) [-1418.417] * (-1419.633) (-1418.241) [-1420.239] (-1423.576) -- 0:01:02
224500 -- [-1419.114] (-1420.072) (-1419.963) (-1417.996) * (-1420.094) (-1419.529) [-1421.887] (-1421.741) -- 0:01:02
225000 -- (-1419.248) [-1419.355] (-1419.828) (-1418.042) * [-1419.220] (-1417.597) (-1421.987) (-1420.135) -- 0:01:02
Average standard deviation of split frequencies: 0.013174
225500 -- (-1420.131) [-1419.899] (-1421.241) (-1419.137) * (-1418.872) (-1417.979) (-1419.479) [-1418.137] -- 0:01:01
226000 -- (-1419.839) (-1420.585) (-1421.091) [-1422.291] * [-1419.400] (-1417.701) (-1419.734) (-1418.722) -- 0:01:05
226500 -- (-1424.414) (-1419.131) [-1420.258] (-1419.005) * (-1418.778) (-1417.693) (-1419.275) [-1418.787] -- 0:01:04
227000 -- [-1419.802] (-1421.079) (-1419.473) (-1421.310) * (-1421.312) (-1418.795) [-1419.577] (-1418.689) -- 0:01:04
227500 -- (-1418.080) (-1420.845) (-1419.317) [-1426.999] * (-1418.351) (-1419.944) (-1419.848) [-1418.994] -- 0:01:04
228000 -- (-1418.184) (-1420.258) [-1419.185] (-1427.573) * (-1421.676) (-1418.312) (-1418.602) [-1418.046] -- 0:01:04
228500 -- (-1420.967) [-1421.022] (-1420.012) (-1419.993) * (-1424.959) [-1418.312] (-1419.400) (-1419.965) -- 0:01:04
229000 -- [-1424.760] (-1423.394) (-1420.185) (-1424.507) * [-1421.055] (-1420.182) (-1420.924) (-1423.412) -- 0:01:03
229500 -- [-1420.353] (-1422.645) (-1420.603) (-1422.938) * [-1421.075] (-1421.296) (-1422.059) (-1424.170) -- 0:01:03
230000 -- (-1419.302) (-1420.361) (-1418.748) [-1425.164] * (-1418.926) (-1423.916) [-1418.352] (-1418.681) -- 0:01:03
Average standard deviation of split frequencies: 0.013768
230500 -- (-1419.855) [-1421.698] (-1422.444) (-1426.511) * (-1420.215) (-1423.929) [-1418.388] (-1419.662) -- 0:01:03
231000 -- [-1421.852] (-1422.352) (-1419.593) (-1419.326) * [-1418.338] (-1424.467) (-1418.387) (-1419.100) -- 0:01:03
231500 -- (-1419.795) [-1420.843] (-1418.930) (-1419.440) * (-1418.258) [-1420.336] (-1418.964) (-1419.739) -- 0:01:03
232000 -- (-1419.794) (-1419.456) [-1419.662] (-1417.878) * [-1418.574] (-1421.028) (-1418.291) (-1419.744) -- 0:01:02
232500 -- [-1419.761] (-1418.941) (-1419.294) (-1418.303) * (-1418.740) (-1418.893) [-1418.926] (-1419.367) -- 0:01:02
233000 -- (-1420.047) [-1419.960] (-1421.447) (-1420.828) * (-1421.059) [-1420.450] (-1418.743) (-1419.466) -- 0:01:02
233500 -- [-1419.769] (-1422.367) (-1420.533) (-1422.919) * (-1418.208) (-1418.129) (-1417.625) [-1419.653] -- 0:01:02
234000 -- [-1418.260] (-1421.971) (-1421.456) (-1420.422) * (-1418.444) (-1418.163) [-1417.619] (-1420.559) -- 0:01:02
234500 -- (-1418.498) [-1421.355] (-1423.571) (-1420.126) * (-1418.036) (-1418.160) (-1418.216) [-1419.340] -- 0:01:02
235000 -- (-1418.978) [-1422.207] (-1420.344) (-1418.648) * (-1417.996) [-1419.714] (-1419.016) (-1419.975) -- 0:01:01
Average standard deviation of split frequencies: 0.014315
235500 -- (-1418.841) (-1423.193) (-1421.998) [-1418.956] * (-1417.716) (-1420.619) [-1418.848] (-1419.114) -- 0:01:01
236000 -- (-1419.826) (-1420.408) [-1421.772] (-1419.376) * (-1418.550) (-1420.410) [-1422.905] (-1418.532) -- 0:01:01
236500 -- (-1420.386) [-1418.649] (-1421.788) (-1418.485) * (-1418.259) [-1423.630] (-1421.076) (-1418.642) -- 0:01:01
237000 -- (-1422.333) (-1418.454) [-1422.748] (-1419.720) * (-1418.109) [-1420.279] (-1420.275) (-1420.879) -- 0:01:01
237500 -- (-1423.082) [-1418.525] (-1424.194) (-1419.361) * [-1418.338] (-1419.723) (-1418.189) (-1422.179) -- 0:01:01
238000 -- (-1422.497) (-1418.631) (-1424.734) [-1417.814] * (-1417.952) [-1419.723] (-1421.204) (-1424.201) -- 0:01:00
238500 -- (-1420.150) (-1418.163) (-1420.321) [-1417.925] * (-1424.514) (-1421.734) [-1419.913] (-1422.721) -- 0:01:03
239000 -- [-1419.847] (-1418.584) (-1422.082) (-1418.731) * (-1426.583) [-1418.339] (-1421.559) (-1420.041) -- 0:01:03
239500 -- [-1420.293] (-1420.409) (-1421.758) (-1418.687) * (-1419.023) [-1417.671] (-1418.700) (-1419.928) -- 0:01:03
240000 -- (-1419.613) (-1421.853) (-1424.027) [-1418.037] * [-1419.145] (-1418.454) (-1418.928) (-1419.138) -- 0:01:03
Average standard deviation of split frequencies: 0.013602
240500 -- [-1418.670] (-1420.000) (-1420.610) (-1417.990) * [-1419.145] (-1419.514) (-1420.268) (-1419.170) -- 0:01:03
241000 -- (-1419.693) (-1422.147) (-1420.325) [-1417.689] * (-1418.624) (-1419.695) [-1419.273] (-1419.307) -- 0:01:02
241500 -- [-1418.045] (-1420.454) (-1418.295) (-1419.449) * [-1419.662] (-1420.631) (-1423.467) (-1418.282) -- 0:01:02
242000 -- (-1418.129) (-1419.840) [-1418.290] (-1424.202) * [-1422.196] (-1417.874) (-1418.625) (-1418.361) -- 0:01:02
242500 -- [-1419.751] (-1418.870) (-1419.544) (-1421.524) * (-1418.790) (-1419.516) (-1418.625) [-1418.047] -- 0:01:02
243000 -- [-1418.750] (-1418.252) (-1425.639) (-1419.826) * (-1417.911) (-1418.787) [-1418.528] (-1420.641) -- 0:01:02
243500 -- [-1417.679] (-1421.334) (-1424.125) (-1420.837) * (-1417.917) (-1418.646) (-1424.808) [-1423.833] -- 0:01:02
244000 -- (-1423.001) (-1419.559) [-1419.005] (-1420.312) * (-1421.223) (-1418.501) (-1422.890) [-1420.470] -- 0:01:01
244500 -- (-1419.356) (-1421.357) [-1421.492] (-1418.671) * (-1420.924) [-1419.603] (-1419.750) (-1419.829) -- 0:01:01
245000 -- (-1418.428) [-1421.786] (-1422.551) (-1420.430) * (-1420.824) (-1421.108) [-1421.041] (-1419.615) -- 0:01:01
Average standard deviation of split frequencies: 0.013627
245500 -- (-1423.375) (-1418.298) (-1421.023) [-1417.753] * (-1420.452) (-1420.803) [-1418.263] (-1420.313) -- 0:01:01
246000 -- (-1418.478) (-1419.302) (-1419.292) [-1417.782] * (-1419.510) (-1423.451) [-1418.572] (-1422.668) -- 0:01:01
246500 -- [-1419.558] (-1420.285) (-1420.823) (-1421.307) * [-1418.930] (-1421.354) (-1418.645) (-1421.223) -- 0:01:01
247000 -- [-1419.027] (-1419.406) (-1419.696) (-1419.035) * (-1418.900) (-1420.293) (-1420.027) [-1420.895] -- 0:01:00
247500 -- [-1420.311] (-1419.398) (-1421.620) (-1417.824) * [-1418.420] (-1422.120) (-1420.027) (-1419.773) -- 0:01:00
248000 -- (-1420.120) (-1422.397) [-1418.564] (-1418.639) * (-1419.081) [-1419.202] (-1419.723) (-1420.725) -- 0:01:00
248500 -- (-1418.948) (-1420.601) (-1418.653) [-1420.099] * (-1420.478) (-1420.945) [-1419.514] (-1421.185) -- 0:01:00
249000 -- (-1418.929) (-1422.945) [-1418.512] (-1422.995) * (-1420.810) (-1418.957) (-1418.452) [-1420.492] -- 0:01:00
249500 -- [-1419.275] (-1425.646) (-1418.998) (-1423.163) * [-1418.014] (-1420.748) (-1418.438) (-1418.582) -- 0:01:00
250000 -- (-1420.834) (-1419.680) [-1418.295] (-1422.947) * (-1418.016) (-1420.974) (-1418.784) [-1421.536] -- 0:01:00
Average standard deviation of split frequencies: 0.016090
250500 -- (-1420.078) (-1427.779) [-1421.471] (-1422.115) * (-1420.005) (-1421.426) [-1419.989] (-1422.232) -- 0:00:59
251000 -- (-1419.220) (-1421.872) (-1421.294) [-1418.660] * (-1420.627) (-1421.192) (-1419.951) [-1421.971] -- 0:01:02
251500 -- (-1417.701) (-1425.078) [-1419.086] (-1418.525) * [-1418.922] (-1420.555) (-1418.618) (-1420.123) -- 0:01:02
252000 -- (-1417.891) (-1418.230) (-1419.069) [-1422.027] * (-1420.239) (-1419.195) [-1419.168] (-1419.122) -- 0:01:02
252500 -- [-1418.043] (-1419.207) (-1424.472) (-1420.597) * (-1420.200) (-1418.257) (-1420.530) [-1419.308] -- 0:01:02
253000 -- [-1422.100] (-1422.309) (-1420.098) (-1422.205) * (-1422.274) [-1420.490] (-1420.577) (-1421.257) -- 0:01:02
253500 -- (-1421.065) (-1421.660) (-1418.322) [-1420.001] * (-1418.613) (-1421.845) [-1421.280] (-1421.465) -- 0:01:01
254000 -- (-1425.659) (-1421.126) [-1421.728] (-1418.682) * (-1419.526) (-1418.807) [-1421.551] (-1421.235) -- 0:01:01
254500 -- (-1425.216) (-1421.606) (-1420.252) [-1418.852] * (-1418.700) [-1419.472] (-1420.595) (-1419.918) -- 0:01:01
255000 -- (-1424.231) (-1421.291) (-1420.053) [-1419.976] * (-1418.979) (-1419.418) (-1421.654) [-1418.487] -- 0:01:01
Average standard deviation of split frequencies: 0.017289
255500 -- (-1421.886) (-1419.890) [-1420.322] (-1422.555) * (-1420.214) (-1418.916) [-1423.059] (-1421.532) -- 0:01:01
256000 -- (-1419.463) (-1422.558) [-1420.130] (-1428.425) * (-1420.654) [-1418.941] (-1420.544) (-1423.074) -- 0:01:01
256500 -- [-1418.218] (-1418.306) (-1419.473) (-1420.656) * [-1420.228] (-1420.765) (-1421.180) (-1417.788) -- 0:01:00
257000 -- [-1420.923] (-1418.299) (-1420.290) (-1423.298) * [-1422.353] (-1420.570) (-1421.756) (-1419.764) -- 0:01:00
257500 -- (-1419.289) (-1418.320) [-1418.303] (-1426.319) * (-1418.885) (-1422.452) [-1421.425] (-1419.821) -- 0:01:00
258000 -- [-1418.569] (-1420.544) (-1418.118) (-1427.267) * (-1418.175) (-1422.415) (-1425.870) [-1418.307] -- 0:01:00
258500 -- (-1419.072) (-1421.290) (-1419.537) [-1417.839] * (-1423.691) [-1420.422] (-1421.109) (-1418.307) -- 0:01:00
259000 -- (-1419.239) (-1422.569) (-1420.777) [-1418.842] * (-1418.315) (-1421.360) [-1420.603] (-1419.115) -- 0:01:00
259500 -- (-1426.621) [-1419.644] (-1421.453) (-1417.984) * [-1419.959] (-1420.624) (-1422.154) (-1420.565) -- 0:00:59
260000 -- (-1425.503) [-1421.342] (-1422.822) (-1417.984) * (-1422.417) (-1421.535) [-1420.350] (-1420.343) -- 0:00:59
Average standard deviation of split frequencies: 0.017080
260500 -- (-1424.747) (-1422.305) (-1419.195) [-1421.771] * (-1423.266) (-1420.393) (-1418.513) [-1421.063] -- 0:00:59
261000 -- [-1421.541] (-1421.398) (-1423.113) (-1420.955) * (-1420.118) (-1420.956) [-1419.651] (-1419.969) -- 0:00:59
261500 -- [-1418.551] (-1421.763) (-1420.096) (-1420.173) * (-1418.717) [-1421.036] (-1421.502) (-1424.596) -- 0:00:59
262000 -- (-1419.933) (-1421.380) [-1418.364] (-1420.090) * (-1418.487) (-1423.452) [-1418.931] (-1422.852) -- 0:00:59
262500 -- (-1420.499) (-1420.973) (-1421.155) [-1419.926] * (-1420.367) (-1419.511) [-1418.725] (-1421.555) -- 0:00:59
263000 -- (-1422.216) (-1419.373) (-1421.553) [-1419.825] * (-1419.805) (-1419.501) [-1419.772] (-1420.321) -- 0:00:58
263500 -- (-1420.421) (-1419.759) (-1420.776) [-1419.238] * (-1419.237) (-1420.865) [-1419.119] (-1418.858) -- 0:01:01
264000 -- [-1418.582] (-1418.224) (-1419.763) (-1420.166) * (-1418.504) (-1419.859) (-1421.058) [-1419.907] -- 0:01:01
264500 -- (-1418.819) [-1418.348] (-1420.189) (-1419.054) * (-1418.584) [-1421.254] (-1419.294) (-1421.285) -- 0:01:01
265000 -- (-1420.057) (-1418.204) (-1419.632) [-1418.802] * (-1419.802) (-1419.247) [-1419.002] (-1420.212) -- 0:01:01
Average standard deviation of split frequencies: 0.016737
265500 -- [-1421.096] (-1421.746) (-1420.541) (-1419.123) * (-1419.210) (-1419.590) [-1421.056] (-1427.332) -- 0:01:00
266000 -- [-1422.285] (-1421.457) (-1422.935) (-1421.171) * [-1421.360] (-1421.002) (-1418.926) (-1423.603) -- 0:01:00
266500 -- (-1419.119) (-1421.424) (-1419.825) [-1419.830] * [-1419.667] (-1421.397) (-1420.127) (-1421.935) -- 0:01:00
267000 -- (-1420.817) (-1424.966) (-1420.663) [-1419.933] * (-1421.958) (-1420.379) [-1419.594] (-1419.251) -- 0:01:00
267500 -- (-1422.425) (-1420.951) (-1420.274) [-1420.112] * (-1421.183) (-1419.064) [-1419.256] (-1419.482) -- 0:01:00
268000 -- (-1419.131) (-1420.387) (-1421.123) [-1419.536] * (-1421.875) [-1425.139] (-1419.257) (-1421.547) -- 0:01:00
268500 -- [-1419.066] (-1421.521) (-1421.313) (-1418.711) * (-1421.875) (-1421.022) [-1426.018] (-1421.812) -- 0:00:59
269000 -- (-1417.833) (-1421.101) [-1421.145] (-1419.480) * (-1420.614) (-1420.826) (-1424.339) [-1422.219] -- 0:00:59
269500 -- (-1420.164) [-1419.759] (-1424.342) (-1420.470) * (-1419.719) (-1420.715) (-1419.472) [-1418.496] -- 0:00:59
270000 -- (-1422.054) [-1418.560] (-1421.036) (-1422.931) * (-1421.117) (-1419.058) (-1418.184) [-1419.506] -- 0:00:59
Average standard deviation of split frequencies: 0.016392
270500 -- (-1420.115) [-1418.020] (-1422.441) (-1421.156) * (-1422.829) [-1418.623] (-1419.950) (-1419.327) -- 0:00:59
271000 -- (-1418.785) [-1418.066] (-1422.515) (-1418.379) * [-1424.171] (-1418.597) (-1420.622) (-1417.912) -- 0:00:59
271500 -- (-1419.556) [-1420.855] (-1421.673) (-1418.216) * (-1419.881) [-1418.083] (-1420.299) (-1419.286) -- 0:00:59
272000 -- (-1419.703) [-1420.278] (-1419.870) (-1419.638) * (-1421.459) [-1418.038] (-1420.739) (-1419.979) -- 0:00:58
272500 -- (-1418.279) (-1424.027) [-1420.565] (-1418.399) * (-1421.459) (-1418.496) (-1420.363) [-1419.271] -- 0:00:58
273000 -- (-1423.917) [-1420.351] (-1420.811) (-1418.843) * (-1423.129) (-1419.711) [-1421.605] (-1419.034) -- 0:00:58
273500 -- [-1420.732] (-1419.099) (-1421.823) (-1418.744) * (-1421.298) (-1417.790) (-1420.513) [-1418.427] -- 0:00:58
274000 -- [-1419.878] (-1418.104) (-1423.017) (-1420.767) * [-1421.791] (-1417.631) (-1421.829) (-1419.400) -- 0:00:58
274500 -- [-1419.224] (-1418.200) (-1424.006) (-1418.482) * (-1422.078) (-1419.437) (-1421.654) [-1418.395] -- 0:00:58
275000 -- (-1419.215) [-1419.650] (-1422.510) (-1419.974) * (-1420.003) [-1419.221] (-1421.444) (-1418.412) -- 0:00:58
Average standard deviation of split frequencies: 0.015479
275500 -- (-1420.994) [-1419.525] (-1422.575) (-1418.832) * (-1419.629) [-1421.159] (-1419.772) (-1417.891) -- 0:01:00
276000 -- (-1421.436) (-1422.845) (-1422.228) [-1419.751] * (-1419.412) (-1421.685) [-1421.760] (-1421.605) -- 0:01:00
276500 -- (-1422.479) [-1419.052] (-1418.645) (-1419.812) * [-1420.958] (-1422.013) (-1421.543) (-1418.301) -- 0:01:00
277000 -- (-1418.959) (-1418.730) [-1418.513] (-1418.928) * [-1420.341] (-1424.497) (-1419.145) (-1419.258) -- 0:01:00
277500 -- (-1419.027) (-1418.454) (-1419.069) [-1419.598] * (-1420.433) [-1423.496] (-1419.232) (-1423.321) -- 0:00:59
278000 -- [-1418.794] (-1419.718) (-1419.399) (-1419.694) * (-1419.009) [-1420.631] (-1423.197) (-1422.956) -- 0:00:59
278500 -- (-1418.489) (-1419.284) (-1419.737) [-1421.810] * (-1422.104) [-1421.545] (-1419.219) (-1424.456) -- 0:00:59
279000 -- (-1419.235) (-1420.241) [-1419.493] (-1420.271) * (-1418.334) (-1418.860) (-1421.658) [-1422.434] -- 0:00:59
279500 -- (-1419.193) (-1419.948) (-1420.073) [-1418.281] * [-1418.423] (-1419.216) (-1417.900) (-1419.177) -- 0:00:59
280000 -- (-1420.402) (-1420.842) (-1422.915) [-1418.917] * [-1420.791] (-1422.244) (-1422.198) (-1418.407) -- 0:00:59
Average standard deviation of split frequencies: 0.015011
280500 -- (-1421.454) [-1419.301] (-1420.131) (-1420.461) * [-1419.946] (-1423.110) (-1419.762) (-1420.033) -- 0:00:58
281000 -- (-1420.995) (-1420.408) (-1420.185) [-1422.012] * (-1420.673) (-1420.185) (-1419.245) [-1420.331] -- 0:00:58
281500 -- (-1418.997) (-1419.988) [-1418.936] (-1419.336) * (-1420.011) [-1420.221] (-1420.425) (-1421.868) -- 0:00:58
282000 -- (-1419.127) (-1418.586) (-1418.567) [-1421.962] * [-1418.958] (-1420.021) (-1421.467) (-1424.307) -- 0:00:58
282500 -- (-1421.530) (-1423.292) (-1419.952) [-1419.688] * [-1419.440] (-1419.442) (-1421.568) (-1422.576) -- 0:00:58
283000 -- (-1419.789) (-1422.064) [-1419.875] (-1420.521) * [-1419.882] (-1421.489) (-1421.629) (-1419.207) -- 0:00:58
283500 -- (-1422.528) (-1420.503) [-1419.139] (-1418.692) * (-1421.202) (-1425.095) [-1420.728] (-1420.599) -- 0:00:58
284000 -- (-1419.527) [-1419.749] (-1418.242) (-1418.890) * (-1418.182) (-1422.331) [-1420.766] (-1420.397) -- 0:00:57
284500 -- [-1420.941] (-1419.321) (-1418.652) (-1420.727) * (-1419.711) (-1419.942) (-1421.149) [-1422.833] -- 0:00:57
285000 -- (-1418.745) (-1419.728) [-1420.155] (-1420.261) * (-1419.254) [-1418.838] (-1420.955) (-1420.894) -- 0:00:57
Average standard deviation of split frequencies: 0.014253
285500 -- (-1419.868) (-1419.304) [-1419.541] (-1419.367) * (-1419.534) (-1420.570) [-1419.673] (-1418.359) -- 0:00:57
286000 -- (-1421.396) (-1418.981) [-1419.517] (-1424.759) * (-1420.771) (-1420.140) [-1417.519] (-1423.864) -- 0:00:57
286500 -- (-1417.850) (-1420.071) [-1419.193] (-1424.042) * (-1425.424) (-1420.439) (-1419.533) [-1419.751] -- 0:00:57
287000 -- (-1419.991) [-1421.692] (-1418.838) (-1420.106) * (-1424.109) [-1419.041] (-1421.578) (-1419.396) -- 0:00:57
287500 -- (-1421.321) [-1424.894] (-1420.300) (-1419.178) * (-1425.700) [-1420.454] (-1420.739) (-1418.129) -- 0:00:57
288000 -- (-1419.660) [-1423.138] (-1420.970) (-1418.349) * (-1419.810) [-1420.827] (-1419.463) (-1419.605) -- 0:00:59
288500 -- (-1420.126) (-1419.747) [-1419.659] (-1418.372) * (-1418.821) [-1420.135] (-1419.991) (-1419.955) -- 0:00:59
289000 -- (-1420.098) [-1420.074] (-1424.206) (-1418.190) * (-1420.836) (-1421.716) (-1421.720) [-1423.974] -- 0:00:59
289500 -- (-1421.816) (-1418.622) [-1422.159] (-1418.476) * (-1419.621) (-1422.162) (-1420.836) [-1421.939] -- 0:00:58
290000 -- (-1423.784) (-1419.734) (-1418.234) [-1418.606] * (-1418.788) [-1418.807] (-1419.817) (-1421.914) -- 0:00:58
Average standard deviation of split frequencies: 0.013076
290500 -- (-1423.704) [-1421.294] (-1418.441) (-1421.820) * (-1419.350) (-1418.854) (-1418.329) [-1420.268] -- 0:00:58
291000 -- [-1419.207] (-1420.833) (-1421.126) (-1421.242) * (-1419.422) (-1419.732) (-1420.754) [-1418.039] -- 0:00:58
291500 -- [-1418.872] (-1421.845) (-1420.587) (-1419.791) * [-1422.242] (-1418.902) (-1421.355) (-1419.452) -- 0:00:58
292000 -- (-1422.394) (-1420.800) (-1421.523) [-1420.297] * [-1418.646] (-1421.013) (-1424.821) (-1419.059) -- 0:00:58
292500 -- (-1420.932) (-1419.732) (-1418.598) [-1418.793] * (-1418.644) [-1428.621] (-1420.510) (-1418.269) -- 0:00:58
293000 -- [-1422.248] (-1420.202) (-1418.598) (-1418.367) * (-1418.477) [-1424.047] (-1419.568) (-1420.133) -- 0:00:57
293500 -- (-1419.628) (-1421.874) [-1418.989] (-1417.720) * (-1419.514) (-1420.177) [-1420.394] (-1419.925) -- 0:00:57
294000 -- (-1422.989) (-1420.021) (-1421.184) [-1419.738] * [-1421.478] (-1419.423) (-1422.053) (-1419.925) -- 0:00:57
294500 -- (-1421.340) [-1420.464] (-1421.323) (-1419.722) * (-1420.952) [-1419.068] (-1422.392) (-1420.684) -- 0:00:57
295000 -- [-1422.557] (-1421.875) (-1422.290) (-1418.542) * (-1421.299) (-1418.584) [-1419.225] (-1420.001) -- 0:00:57
Average standard deviation of split frequencies: 0.012366
295500 -- (-1420.499) (-1420.665) (-1421.699) [-1418.186] * (-1419.477) (-1418.570) [-1419.282] (-1419.026) -- 0:00:57
296000 -- (-1423.547) (-1420.588) [-1420.541] (-1418.077) * (-1421.376) (-1423.013) (-1420.309) [-1420.531] -- 0:00:57
296500 -- (-1422.459) [-1419.633] (-1420.532) (-1419.198) * [-1421.836] (-1423.859) (-1421.267) (-1421.329) -- 0:00:56
297000 -- (-1421.028) (-1418.664) [-1421.795] (-1419.477) * (-1419.686) [-1418.727] (-1419.016) (-1430.534) -- 0:00:56
297500 -- (-1419.095) (-1418.002) [-1420.658] (-1419.429) * (-1425.846) (-1418.754) (-1418.908) [-1422.557] -- 0:00:56
298000 -- (-1419.094) (-1422.113) (-1421.091) [-1419.582] * [-1426.804] (-1417.950) (-1417.887) (-1421.494) -- 0:00:56
298500 -- (-1418.457) (-1419.972) (-1419.881) [-1421.181] * (-1419.104) (-1418.429) [-1419.038] (-1417.993) -- 0:00:56
299000 -- (-1418.593) [-1418.663] (-1418.226) (-1425.062) * (-1421.667) (-1419.748) [-1418.975] (-1419.524) -- 0:00:56
299500 -- (-1423.287) (-1419.502) [-1418.282] (-1424.342) * [-1421.816] (-1421.141) (-1418.090) (-1417.943) -- 0:00:56
300000 -- (-1422.696) (-1419.788) [-1420.186] (-1432.219) * (-1420.164) (-1420.724) (-1421.829) [-1418.139] -- 0:00:56
Average standard deviation of split frequencies: 0.010877
300500 -- (-1420.277) (-1421.049) [-1420.211] (-1420.423) * [-1420.068] (-1421.495) (-1422.477) (-1418.114) -- 0:00:58
301000 -- (-1419.529) (-1421.463) [-1421.386] (-1419.035) * (-1418.865) (-1419.145) [-1420.891] (-1418.063) -- 0:00:58
301500 -- [-1419.966] (-1419.782) (-1420.171) (-1419.685) * [-1425.146] (-1421.509) (-1419.276) (-1418.896) -- 0:00:57
302000 -- (-1418.553) (-1421.203) [-1419.207] (-1418.483) * (-1421.436) [-1421.117] (-1420.254) (-1420.141) -- 0:00:57
302500 -- (-1419.527) [-1423.541] (-1424.035) (-1418.414) * (-1418.020) [-1418.917] (-1420.854) (-1420.141) -- 0:00:57
303000 -- (-1419.243) (-1420.854) (-1421.789) [-1424.224] * (-1418.152) (-1420.244) (-1420.645) [-1419.182] -- 0:00:57
303500 -- (-1418.647) (-1418.036) (-1419.723) [-1418.313] * [-1419.149] (-1419.347) (-1422.121) (-1420.198) -- 0:00:57
304000 -- [-1425.368] (-1423.428) (-1419.117) (-1420.581) * (-1418.895) (-1418.303) (-1423.159) [-1420.165] -- 0:00:57
304500 -- (-1423.908) (-1418.843) [-1418.404] (-1418.315) * (-1421.533) (-1418.943) [-1418.615] (-1421.007) -- 0:00:57
305000 -- (-1421.704) [-1418.373] (-1420.812) (-1418.217) * (-1420.649) [-1418.530] (-1419.182) (-1419.715) -- 0:00:56
Average standard deviation of split frequencies: 0.010149
305500 -- (-1423.268) (-1418.490) [-1419.278] (-1418.101) * (-1419.692) [-1418.073] (-1418.651) (-1420.390) -- 0:00:56
306000 -- (-1429.416) [-1421.094] (-1421.184) (-1419.691) * [-1419.367] (-1421.240) (-1418.325) (-1420.967) -- 0:00:56
306500 -- (-1421.827) (-1419.961) [-1422.074] (-1419.366) * [-1418.231] (-1418.350) (-1417.938) (-1420.215) -- 0:00:56
307000 -- [-1421.846] (-1420.286) (-1421.201) (-1424.766) * (-1418.484) (-1423.960) [-1418.776] (-1420.313) -- 0:00:56
307500 -- (-1419.875) (-1421.929) (-1419.116) [-1426.085] * (-1417.948) [-1418.418] (-1421.926) (-1419.493) -- 0:00:56
308000 -- (-1420.342) (-1421.431) [-1421.471] (-1424.343) * [-1417.951] (-1420.364) (-1418.274) (-1420.880) -- 0:00:56
308500 -- (-1420.031) (-1422.175) [-1419.443] (-1420.930) * [-1419.537] (-1418.906) (-1417.578) (-1419.887) -- 0:00:56
309000 -- (-1418.616) [-1422.723] (-1425.405) (-1420.390) * (-1419.529) (-1420.342) (-1419.602) [-1419.837] -- 0:00:55
309500 -- (-1419.443) [-1422.709] (-1419.934) (-1421.089) * (-1418.356) (-1423.741) (-1419.551) [-1422.217] -- 0:00:55
310000 -- (-1418.657) (-1418.502) (-1420.995) [-1420.605] * (-1420.224) (-1424.161) (-1419.881) [-1420.177] -- 0:00:55
Average standard deviation of split frequencies: 0.011937
310500 -- [-1421.296] (-1420.641) (-1420.269) (-1421.108) * (-1419.177) [-1423.209] (-1422.320) (-1423.524) -- 0:00:55
311000 -- (-1419.830) [-1422.488] (-1420.170) (-1422.845) * (-1419.299) [-1422.194] (-1423.640) (-1420.373) -- 0:00:55
311500 -- (-1420.163) (-1420.141) (-1419.191) [-1419.079] * (-1420.629) [-1418.775] (-1420.799) (-1421.065) -- 0:00:55
312000 -- (-1419.740) (-1423.557) [-1418.338] (-1421.078) * (-1419.776) [-1419.443] (-1419.869) (-1420.679) -- 0:00:55
312500 -- [-1419.284] (-1421.397) (-1419.049) (-1418.942) * [-1419.450] (-1420.502) (-1420.598) (-1420.875) -- 0:00:55
313000 -- (-1420.675) [-1422.061] (-1421.032) (-1423.033) * (-1420.308) [-1419.121] (-1420.715) (-1421.597) -- 0:00:57
313500 -- (-1420.914) (-1421.703) (-1418.583) [-1419.244] * (-1420.082) [-1418.988] (-1419.441) (-1418.753) -- 0:00:56
314000 -- (-1422.014) (-1423.138) (-1419.666) [-1419.563] * (-1419.818) (-1418.802) [-1418.589] (-1422.617) -- 0:00:56
314500 -- (-1421.108) [-1420.229] (-1420.969) (-1419.590) * (-1419.470) (-1418.809) (-1420.267) [-1419.338] -- 0:00:56
315000 -- (-1421.178) [-1418.472] (-1418.776) (-1420.061) * (-1421.257) (-1418.706) [-1420.136] (-1420.897) -- 0:00:56
Average standard deviation of split frequencies: 0.011735
315500 -- (-1420.405) (-1421.825) (-1420.396) [-1419.815] * (-1418.360) [-1418.637] (-1419.727) (-1420.536) -- 0:00:56
316000 -- [-1419.139] (-1419.176) (-1418.658) (-1420.506) * (-1422.102) (-1418.102) [-1419.770] (-1419.459) -- 0:00:56
316500 -- (-1418.710) (-1419.376) (-1418.914) [-1419.252] * [-1421.097] (-1420.434) (-1419.414) (-1418.431) -- 0:00:56
317000 -- (-1419.398) (-1421.580) (-1421.231) [-1421.414] * [-1419.232] (-1419.276) (-1418.940) (-1418.381) -- 0:00:56
317500 -- (-1421.891) (-1419.326) [-1420.762] (-1423.964) * (-1419.563) (-1418.438) (-1418.869) [-1421.355] -- 0:00:55
318000 -- (-1419.295) (-1418.360) [-1422.962] (-1422.717) * [-1420.104] (-1418.233) (-1418.487) (-1420.744) -- 0:00:55
318500 -- (-1418.600) (-1419.867) [-1422.460] (-1418.071) * (-1424.322) [-1418.614] (-1418.456) (-1423.801) -- 0:00:55
319000 -- (-1418.971) (-1418.133) (-1425.208) [-1418.336] * (-1419.958) [-1422.123] (-1419.254) (-1422.198) -- 0:00:55
319500 -- (-1419.025) [-1418.039] (-1423.213) (-1418.900) * (-1420.091) (-1420.782) [-1418.568] (-1423.563) -- 0:00:55
320000 -- [-1419.326] (-1418.549) (-1420.853) (-1418.809) * (-1419.848) (-1423.055) (-1418.365) [-1418.860] -- 0:00:57
Average standard deviation of split frequencies: 0.009801
320500 -- (-1420.229) (-1420.886) [-1419.351] (-1419.097) * (-1419.238) [-1423.797] (-1424.284) (-1420.084) -- 0:00:57
321000 -- (-1419.218) [-1418.396] (-1422.212) (-1419.260) * (-1420.573) [-1418.773] (-1423.945) (-1418.710) -- 0:00:57
321500 -- (-1418.043) [-1418.932] (-1419.050) (-1419.826) * (-1421.515) (-1419.481) (-1424.901) [-1418.327] -- 0:00:56
322000 -- [-1423.796] (-1418.917) (-1425.204) (-1420.391) * (-1421.351) (-1419.419) [-1423.380] (-1418.576) -- 0:00:56
322500 -- (-1421.785) [-1418.508] (-1427.221) (-1422.284) * (-1422.516) (-1418.479) [-1420.491] (-1419.077) -- 0:00:56
323000 -- [-1420.821] (-1418.675) (-1424.111) (-1419.197) * (-1424.455) (-1418.204) (-1420.277) [-1418.965] -- 0:00:58
323500 -- (-1420.648) (-1420.297) [-1420.637] (-1420.571) * (-1424.029) (-1418.415) [-1421.732] (-1421.019) -- 0:00:58
324000 -- (-1420.032) [-1419.401] (-1419.651) (-1420.068) * (-1425.864) [-1419.141] (-1420.214) (-1418.711) -- 0:00:58
324500 -- (-1420.677) (-1421.211) [-1420.440] (-1420.066) * (-1419.963) [-1421.534] (-1420.299) (-1419.456) -- 0:00:58
325000 -- (-1422.243) [-1418.482] (-1421.822) (-1422.854) * [-1419.574] (-1421.534) (-1422.410) (-1418.671) -- 0:00:58
Average standard deviation of split frequencies: 0.009062
325500 -- (-1419.133) [-1420.673] (-1418.393) (-1420.248) * (-1421.790) [-1418.499] (-1420.932) (-1418.451) -- 0:00:58
326000 -- (-1424.366) (-1421.036) (-1417.920) [-1418.527] * (-1421.836) (-1418.184) (-1419.640) [-1421.395] -- 0:00:57
326500 -- (-1420.046) [-1420.206] (-1417.742) (-1418.568) * (-1419.350) (-1422.037) [-1424.352] (-1420.694) -- 0:00:57
327000 -- (-1421.660) [-1420.914] (-1418.188) (-1419.865) * (-1419.498) (-1422.808) (-1420.080) [-1419.169] -- 0:00:57
327500 -- (-1421.804) (-1420.499) [-1418.718] (-1419.098) * (-1420.903) [-1421.610] (-1421.524) (-1419.120) -- 0:00:57
328000 -- (-1420.364) (-1417.912) (-1417.869) [-1419.039] * (-1418.473) [-1419.860] (-1418.239) (-1420.073) -- 0:00:57
328500 -- (-1421.384) (-1417.888) [-1420.862] (-1418.183) * (-1419.594) [-1420.794] (-1419.821) (-1422.635) -- 0:00:57
329000 -- [-1418.365] (-1418.959) (-1419.674) (-1419.275) * (-1425.419) (-1420.805) [-1418.336] (-1421.452) -- 0:00:57
329500 -- (-1420.395) (-1422.602) (-1419.439) [-1418.414] * (-1421.288) (-1420.897) (-1418.635) [-1422.683] -- 0:00:56
330000 -- (-1418.342) (-1421.512) [-1427.378] (-1428.683) * [-1420.866] (-1423.046) (-1418.759) (-1420.497) -- 0:00:56
Average standard deviation of split frequencies: 0.008643
330500 -- [-1418.408] (-1422.052) (-1424.693) (-1423.610) * (-1419.146) (-1420.462) (-1419.485) [-1419.956] -- 0:00:56
331000 -- (-1418.641) (-1421.884) [-1420.836] (-1423.725) * (-1418.966) (-1419.977) [-1417.854] (-1418.903) -- 0:00:56
331500 -- (-1418.885) [-1418.753] (-1424.101) (-1427.773) * [-1419.868] (-1421.730) (-1419.773) (-1420.687) -- 0:00:56
332000 -- (-1420.613) (-1421.775) (-1420.604) [-1419.945] * (-1419.653) (-1419.424) (-1419.929) [-1420.958] -- 0:00:56
332500 -- [-1420.098] (-1421.365) (-1421.815) (-1419.051) * (-1423.788) (-1420.039) [-1419.601] (-1419.641) -- 0:00:56
333000 -- (-1420.082) (-1422.264) (-1420.256) [-1419.713] * (-1421.218) (-1417.870) (-1420.320) [-1419.099] -- 0:00:56
333500 -- (-1418.385) (-1419.335) (-1420.686) [-1419.712] * (-1420.599) [-1418.831] (-1419.088) (-1422.855) -- 0:00:55
334000 -- (-1421.876) (-1419.317) (-1425.873) [-1419.291] * (-1418.726) [-1423.390] (-1419.582) (-1423.850) -- 0:00:55
334500 -- (-1420.362) [-1420.312] (-1422.061) (-1420.815) * [-1420.524] (-1418.053) (-1421.257) (-1421.534) -- 0:00:55
335000 -- (-1419.817) (-1421.124) (-1421.484) [-1419.704] * (-1419.636) [-1418.949] (-1419.632) (-1422.669) -- 0:00:57
Average standard deviation of split frequencies: 0.008506
335500 -- (-1420.944) [-1421.560] (-1421.809) (-1420.807) * (-1421.010) (-1418.983) (-1419.845) [-1419.815] -- 0:00:57
336000 -- (-1420.406) (-1422.994) (-1419.832) [-1420.600] * (-1420.146) (-1419.103) (-1419.757) [-1422.774] -- 0:00:57
336500 -- (-1419.832) [-1420.932] (-1419.629) (-1419.242) * (-1420.423) (-1420.062) [-1420.246] (-1422.552) -- 0:00:57
337000 -- (-1419.533) (-1422.021) (-1418.643) [-1419.212] * (-1420.799) [-1420.321] (-1420.200) (-1419.935) -- 0:00:57
337500 -- [-1421.088] (-1424.722) (-1418.645) (-1418.350) * (-1418.393) (-1421.060) [-1419.929] (-1419.145) -- 0:00:56
338000 -- (-1420.294) (-1423.422) [-1419.647] (-1419.894) * (-1418.091) [-1422.059] (-1418.683) (-1418.996) -- 0:00:56
338500 -- (-1421.494) (-1420.335) [-1419.198] (-1420.143) * [-1418.477] (-1418.483) (-1418.210) (-1418.677) -- 0:00:56
339000 -- (-1419.404) (-1422.136) (-1420.409) [-1418.746] * (-1419.605) (-1418.418) (-1418.143) [-1418.420] -- 0:00:56
339500 -- [-1422.987] (-1420.096) (-1419.461) (-1418.227) * (-1421.618) (-1418.169) [-1420.578] (-1419.113) -- 0:00:56
340000 -- (-1421.225) (-1423.862) (-1425.112) [-1419.124] * (-1422.366) (-1418.912) [-1421.289] (-1420.900) -- 0:00:56
Average standard deviation of split frequencies: 0.008303
340500 -- (-1419.016) (-1418.823) (-1423.055) [-1419.124] * [-1421.564] (-1419.255) (-1423.519) (-1421.086) -- 0:00:56
341000 -- (-1418.968) (-1418.611) [-1419.210] (-1421.544) * (-1423.591) [-1418.868] (-1420.247) (-1419.547) -- 0:00:56
341500 -- (-1419.804) (-1419.168) [-1422.216] (-1423.700) * (-1422.476) [-1421.687] (-1419.562) (-1420.016) -- 0:00:55
342000 -- (-1419.434) [-1418.657] (-1421.435) (-1420.069) * [-1419.290] (-1420.789) (-1418.091) (-1420.230) -- 0:00:55
342500 -- [-1418.195] (-1418.611) (-1419.292) (-1418.352) * (-1420.024) (-1423.410) [-1422.413] (-1418.113) -- 0:00:55
343000 -- (-1420.289) (-1418.587) (-1420.542) [-1418.862] * (-1419.833) (-1419.525) [-1420.909] (-1419.292) -- 0:00:55
343500 -- [-1419.358] (-1419.270) (-1419.898) (-1419.267) * (-1422.501) (-1419.431) [-1422.789] (-1423.716) -- 0:00:55
344000 -- (-1418.869) [-1420.118] (-1419.204) (-1421.139) * (-1422.546) (-1418.733) [-1421.053] (-1421.054) -- 0:00:55
344500 -- (-1417.792) (-1419.530) (-1420.023) [-1421.282] * (-1420.853) (-1418.709) [-1422.449] (-1420.603) -- 0:00:55
345000 -- [-1419.189] (-1418.849) (-1419.695) (-1421.393) * (-1420.976) [-1420.457] (-1421.663) (-1419.259) -- 0:00:55
Average standard deviation of split frequencies: 0.008771
345500 -- (-1421.090) (-1419.337) (-1420.476) [-1419.955] * (-1421.102) (-1421.485) (-1418.735) [-1418.145] -- 0:00:54
346000 -- (-1419.813) (-1421.306) (-1421.260) [-1420.844] * (-1418.420) (-1420.813) [-1420.618] (-1419.149) -- 0:00:54
346500 -- (-1420.471) (-1419.216) [-1418.802] (-1419.663) * (-1418.334) (-1420.654) [-1419.123] (-1419.875) -- 0:00:54
347000 -- [-1422.138] (-1418.267) (-1421.434) (-1419.172) * [-1419.810] (-1422.256) (-1418.456) (-1419.553) -- 0:00:54
347500 -- (-1419.983) [-1418.153] (-1421.481) (-1428.723) * (-1419.484) (-1419.398) (-1418.500) [-1423.118] -- 0:00:54
348000 -- (-1418.778) [-1418.986] (-1418.889) (-1421.317) * (-1420.623) (-1427.047) (-1421.281) [-1421.087] -- 0:00:56
348500 -- (-1424.818) (-1417.843) [-1419.065] (-1419.396) * (-1418.683) [-1418.568] (-1420.642) (-1418.188) -- 0:00:56
349000 -- (-1419.216) (-1418.349) (-1417.785) [-1418.647] * (-1421.068) (-1419.614) [-1420.227] (-1418.968) -- 0:00:55
349500 -- (-1419.407) [-1418.537] (-1417.735) (-1424.406) * (-1424.715) (-1420.580) [-1419.954] (-1418.378) -- 0:00:55
350000 -- (-1421.664) (-1418.867) [-1417.748] (-1419.895) * (-1425.243) [-1418.620] (-1419.883) (-1423.516) -- 0:00:55
Average standard deviation of split frequencies: 0.009568
350500 -- (-1418.230) [-1418.676] (-1422.714) (-1418.509) * [-1422.777] (-1419.136) (-1419.428) (-1421.819) -- 0:00:55
351000 -- (-1418.332) [-1417.772] (-1420.345) (-1418.272) * [-1418.683] (-1420.490) (-1419.261) (-1422.113) -- 0:00:55
351500 -- (-1420.032) [-1417.701] (-1418.688) (-1418.607) * (-1418.677) (-1421.650) [-1419.075] (-1419.929) -- 0:00:55
352000 -- (-1422.229) (-1417.962) (-1418.583) [-1418.791] * (-1418.663) (-1421.741) (-1418.164) [-1420.015] -- 0:00:55
352500 -- (-1418.408) (-1418.566) [-1418.861] (-1418.370) * (-1418.820) [-1424.327] (-1421.243) (-1418.458) -- 0:00:55
353000 -- (-1419.870) (-1420.721) [-1419.875] (-1419.753) * [-1418.918] (-1421.694) (-1420.166) (-1422.538) -- 0:00:54
353500 -- [-1420.576] (-1421.596) (-1421.326) (-1418.377) * (-1419.017) [-1420.559] (-1418.342) (-1418.572) -- 0:00:54
354000 -- (-1423.849) (-1420.982) [-1418.377] (-1419.712) * (-1421.173) (-1418.099) [-1418.914] (-1418.112) -- 0:00:54
354500 -- (-1419.244) (-1417.818) [-1418.103] (-1419.441) * (-1423.611) (-1419.464) (-1420.057) [-1423.722] -- 0:00:54
355000 -- [-1419.890] (-1417.829) (-1421.340) (-1418.555) * (-1421.587) (-1420.863) (-1419.544) [-1419.226] -- 0:00:54
Average standard deviation of split frequencies: 0.009269
355500 -- (-1420.667) [-1417.800] (-1421.762) (-1418.772) * [-1418.926] (-1423.216) (-1420.522) (-1419.511) -- 0:00:54
356000 -- (-1419.084) [-1420.136] (-1422.971) (-1421.768) * (-1418.995) [-1422.544] (-1419.451) (-1419.538) -- 0:00:54
356500 -- [-1418.344] (-1419.183) (-1421.454) (-1421.643) * (-1418.749) [-1419.550] (-1422.662) (-1420.923) -- 0:00:54
357000 -- (-1419.092) [-1420.254] (-1420.397) (-1420.888) * [-1422.179] (-1420.340) (-1420.507) (-1420.934) -- 0:00:54
357500 -- (-1421.011) (-1419.068) [-1419.883] (-1422.611) * (-1420.050) (-1420.494) [-1419.103] (-1425.438) -- 0:00:53
358000 -- [-1422.851] (-1418.796) (-1421.159) (-1421.792) * (-1421.710) (-1420.389) [-1418.342] (-1421.198) -- 0:00:53
358500 -- [-1423.466] (-1420.496) (-1420.856) (-1421.139) * (-1418.810) (-1420.073) (-1419.463) [-1419.842] -- 0:00:53
359000 -- (-1419.635) [-1419.284] (-1419.623) (-1420.953) * [-1418.625] (-1420.652) (-1418.897) (-1420.942) -- 0:00:53
359500 -- (-1418.656) (-1419.454) [-1420.303] (-1419.161) * (-1421.241) [-1418.509] (-1423.700) (-1423.225) -- 0:00:53
360000 -- (-1418.805) (-1421.339) [-1422.893] (-1418.918) * [-1419.438] (-1419.870) (-1422.686) (-1424.584) -- 0:00:53
Average standard deviation of split frequencies: 0.009303
360500 -- (-1419.472) (-1423.721) (-1423.858) [-1418.876] * (-1418.886) (-1420.941) (-1420.640) [-1421.830] -- 0:00:54
361000 -- [-1417.982] (-1424.573) (-1421.819) (-1420.003) * [-1420.942] (-1421.139) (-1421.985) (-1419.836) -- 0:00:54
361500 -- (-1417.946) (-1418.826) (-1421.698) [-1419.385] * (-1419.756) (-1425.901) (-1420.129) [-1420.284] -- 0:00:54
362000 -- (-1418.291) [-1419.609] (-1419.928) (-1420.800) * [-1418.671] (-1422.648) (-1426.700) (-1421.016) -- 0:00:54
362500 -- (-1419.639) (-1424.496) (-1420.063) [-1421.752] * [-1421.650] (-1423.900) (-1420.218) (-1419.669) -- 0:00:54
363000 -- (-1425.822) (-1422.098) [-1420.331] (-1422.269) * (-1421.707) (-1421.647) (-1421.806) [-1418.612] -- 0:00:54
363500 -- (-1421.782) (-1423.176) [-1419.864] (-1419.519) * (-1421.914) [-1419.278] (-1420.766) (-1420.153) -- 0:00:54
364000 -- [-1420.306] (-1423.532) (-1419.751) (-1421.856) * (-1421.014) [-1419.677] (-1420.327) (-1419.754) -- 0:00:54
364500 -- [-1419.198] (-1420.822) (-1424.414) (-1419.754) * (-1419.689) (-1419.729) [-1422.942] (-1422.615) -- 0:00:54
365000 -- (-1418.088) (-1420.841) (-1418.145) [-1420.554] * (-1419.096) (-1419.257) (-1421.120) [-1418.960] -- 0:00:53
Average standard deviation of split frequencies: 0.009698
365500 -- (-1419.746) (-1424.825) [-1418.182] (-1418.239) * (-1419.473) [-1420.993] (-1418.816) (-1418.504) -- 0:00:53
366000 -- (-1421.163) (-1420.151) [-1418.467] (-1418.247) * [-1421.678] (-1420.824) (-1418.479) (-1420.246) -- 0:00:53
366500 -- (-1418.994) (-1419.778) [-1422.298] (-1418.639) * (-1418.035) (-1418.914) (-1418.900) [-1418.164] -- 0:00:53
367000 -- [-1418.530] (-1419.472) (-1419.216) (-1419.274) * (-1418.562) [-1417.743] (-1418.945) (-1418.041) -- 0:00:53
367500 -- (-1419.150) (-1418.648) [-1421.102] (-1418.752) * (-1421.939) (-1417.856) (-1422.581) [-1419.981] -- 0:00:53
368000 -- (-1418.308) [-1418.562] (-1421.705) (-1423.140) * (-1423.468) [-1419.929] (-1418.906) (-1421.493) -- 0:00:53
368500 -- (-1419.434) (-1419.898) (-1418.610) [-1425.001] * (-1422.269) [-1418.445] (-1418.752) (-1423.589) -- 0:00:53
369000 -- (-1418.418) (-1418.674) (-1427.482) [-1419.401] * [-1419.514] (-1419.199) (-1420.863) (-1424.084) -- 0:00:53
369500 -- (-1421.106) (-1418.672) [-1424.763] (-1419.670) * (-1420.815) [-1419.074] (-1424.079) (-1422.078) -- 0:00:52
370000 -- (-1422.920) [-1419.716] (-1428.060) (-1419.377) * (-1418.764) [-1418.786] (-1422.352) (-1419.469) -- 0:00:52
Average standard deviation of split frequencies: 0.009127
370500 -- (-1419.505) (-1419.388) (-1418.580) [-1419.596] * (-1419.299) [-1420.804] (-1418.535) (-1420.774) -- 0:00:52
371000 -- (-1419.772) (-1424.122) [-1423.665] (-1419.960) * (-1423.507) (-1421.714) (-1420.298) [-1418.490] -- 0:00:52
371500 -- (-1419.040) (-1420.148) (-1421.682) [-1420.242] * (-1420.612) (-1425.580) (-1422.868) [-1418.462] -- 0:00:52
372000 -- (-1419.591) (-1421.230) [-1420.317] (-1418.677) * [-1418.875] (-1419.398) (-1417.752) (-1420.563) -- 0:00:52
372500 -- [-1419.236] (-1422.995) (-1424.144) (-1419.166) * (-1419.915) [-1419.987] (-1418.955) (-1420.478) -- 0:00:52
373000 -- [-1419.396] (-1420.493) (-1418.968) (-1419.204) * [-1419.084] (-1420.619) (-1421.394) (-1419.332) -- 0:00:52
373500 -- (-1425.974) (-1423.669) [-1419.671] (-1421.838) * [-1418.114] (-1418.835) (-1418.918) (-1418.013) -- 0:00:53
374000 -- [-1422.281] (-1420.521) (-1420.334) (-1418.877) * (-1418.681) (-1418.851) (-1417.878) [-1420.397] -- 0:00:53
374500 -- (-1423.182) (-1419.927) (-1419.135) [-1419.460] * (-1420.612) (-1418.810) [-1419.399] (-1420.298) -- 0:00:53
375000 -- (-1424.751) (-1422.922) [-1419.361] (-1419.659) * (-1420.221) [-1419.410] (-1419.399) (-1425.111) -- 0:00:53
Average standard deviation of split frequencies: 0.009661
375500 -- (-1420.057) (-1421.959) [-1422.802] (-1422.645) * (-1419.437) (-1420.182) (-1418.411) [-1425.343] -- 0:00:53
376000 -- (-1420.352) (-1419.442) (-1418.476) [-1420.821] * (-1419.242) (-1418.989) (-1418.874) [-1420.831] -- 0:00:53
376500 -- (-1421.380) (-1420.437) (-1421.037) [-1418.412] * [-1418.325] (-1422.913) (-1417.969) (-1421.029) -- 0:00:52
377000 -- [-1422.989] (-1421.408) (-1418.523) (-1419.081) * (-1419.816) (-1420.504) [-1417.912] (-1423.934) -- 0:00:52
377500 -- (-1419.778) [-1420.493] (-1418.851) (-1418.734) * (-1421.101) [-1420.077] (-1418.535) (-1425.198) -- 0:00:52
378000 -- [-1420.825] (-1420.929) (-1419.025) (-1418.933) * [-1421.154] (-1419.486) (-1418.425) (-1428.242) -- 0:00:52
378500 -- (-1421.390) (-1424.758) (-1418.869) [-1420.272] * (-1420.295) [-1419.890] (-1419.470) (-1422.272) -- 0:00:52
379000 -- (-1423.816) (-1420.093) (-1419.359) [-1419.304] * (-1420.731) (-1421.781) [-1419.862] (-1422.245) -- 0:00:52
379500 -- [-1422.844] (-1420.610) (-1421.032) (-1427.453) * (-1419.019) (-1420.300) (-1419.759) [-1421.425] -- 0:00:52
380000 -- [-1419.069] (-1419.508) (-1421.474) (-1423.100) * [-1420.572] (-1420.383) (-1425.978) (-1420.253) -- 0:00:52
Average standard deviation of split frequencies: 0.011310
380500 -- (-1418.239) [-1419.348] (-1421.623) (-1423.987) * [-1420.565] (-1419.115) (-1418.020) (-1419.878) -- 0:00:52
381000 -- (-1420.031) (-1422.058) (-1422.890) [-1426.675] * [-1419.140] (-1421.994) (-1418.771) (-1419.649) -- 0:00:51
381500 -- (-1418.562) (-1418.607) [-1420.084] (-1419.979) * (-1420.355) [-1418.776] (-1419.402) (-1421.342) -- 0:00:51
382000 -- (-1420.320) (-1420.721) [-1418.682] (-1419.275) * (-1420.583) [-1420.010] (-1418.358) (-1418.622) -- 0:00:51
382500 -- (-1420.176) (-1420.448) (-1419.231) [-1418.558] * [-1421.099] (-1418.032) (-1420.788) (-1420.057) -- 0:00:51
383000 -- [-1419.686] (-1419.200) (-1421.416) (-1423.177) * (-1419.289) (-1419.639) (-1419.136) [-1419.104] -- 0:00:51
383500 -- (-1420.353) [-1419.123] (-1422.670) (-1418.159) * [-1419.498] (-1418.587) (-1421.146) (-1419.100) -- 0:00:51
384000 -- (-1420.096) (-1420.582) [-1422.411] (-1423.144) * [-1420.271] (-1418.935) (-1420.791) (-1419.558) -- 0:00:51
384500 -- [-1419.612] (-1418.950) (-1422.071) (-1418.707) * (-1417.724) (-1419.839) [-1419.920] (-1419.450) -- 0:00:51
385000 -- (-1420.459) [-1419.939] (-1418.560) (-1418.580) * (-1417.736) (-1420.313) (-1419.888) [-1418.350] -- 0:00:51
Average standard deviation of split frequencies: 0.009770
385500 -- [-1421.528] (-1420.457) (-1419.968) (-1418.322) * [-1417.736] (-1420.041) (-1419.007) (-1419.909) -- 0:00:51
386000 -- (-1423.387) (-1420.968) [-1421.126] (-1420.547) * (-1417.695) (-1419.391) (-1418.284) [-1418.869] -- 0:00:52
386500 -- [-1421.718] (-1420.526) (-1419.342) (-1421.283) * (-1417.600) (-1421.437) (-1419.632) [-1418.592] -- 0:00:52
387000 -- (-1422.228) (-1418.954) (-1419.343) [-1418.019] * [-1417.667] (-1418.897) (-1422.470) (-1418.051) -- 0:00:52
387500 -- (-1421.515) (-1422.597) [-1418.578] (-1418.299) * (-1418.856) [-1418.988] (-1417.901) (-1418.035) -- 0:00:52
388000 -- (-1421.121) (-1420.102) (-1419.452) [-1418.789] * (-1417.977) [-1418.987] (-1417.783) (-1419.957) -- 0:00:52
388500 -- [-1418.681] (-1420.339) (-1418.498) (-1421.359) * (-1418.504) (-1418.929) (-1418.741) [-1418.666] -- 0:00:51
389000 -- (-1419.948) (-1419.433) [-1419.094] (-1420.747) * [-1418.721] (-1421.162) (-1421.253) (-1418.046) -- 0:00:51
389500 -- (-1419.557) (-1421.337) (-1418.900) [-1418.737] * (-1419.665) (-1421.675) (-1420.982) [-1422.169] -- 0:00:51
390000 -- (-1419.780) (-1417.990) (-1421.660) [-1420.794] * [-1419.804] (-1419.696) (-1420.542) (-1424.932) -- 0:00:51
Average standard deviation of split frequencies: 0.010558
390500 -- (-1418.317) (-1418.592) [-1421.052] (-1421.450) * (-1419.386) [-1419.670] (-1419.303) (-1421.590) -- 0:00:51
391000 -- (-1418.513) [-1418.149] (-1419.956) (-1418.941) * (-1419.456) (-1419.534) [-1418.478] (-1421.845) -- 0:00:51
391500 -- (-1421.183) (-1418.706) [-1421.929] (-1418.684) * [-1418.238] (-1424.269) (-1424.231) (-1420.106) -- 0:00:51
392000 -- (-1420.840) (-1420.269) (-1421.749) [-1418.684] * (-1421.597) (-1425.984) (-1422.578) [-1418.291] -- 0:00:51
392500 -- [-1419.929] (-1421.738) (-1421.238) (-1420.330) * (-1421.380) (-1418.797) [-1422.270] (-1420.154) -- 0:00:51
393000 -- (-1418.480) (-1418.765) [-1419.821] (-1420.401) * (-1421.767) (-1419.829) (-1422.169) [-1418.975] -- 0:00:50
393500 -- [-1418.993] (-1420.235) (-1422.226) (-1419.814) * [-1417.805] (-1419.387) (-1420.438) (-1419.503) -- 0:00:50
394000 -- (-1420.969) [-1419.077] (-1419.339) (-1422.600) * (-1418.330) (-1423.340) (-1420.075) [-1419.705] -- 0:00:50
394500 -- (-1422.585) (-1420.110) (-1420.928) [-1419.452] * (-1418.706) (-1419.817) [-1421.101] (-1420.952) -- 0:00:50
395000 -- (-1421.258) (-1421.505) (-1420.575) [-1421.078] * (-1420.517) (-1421.134) (-1420.226) [-1420.892] -- 0:00:50
Average standard deviation of split frequencies: 0.009803
395500 -- (-1422.660) (-1423.250) (-1420.143) [-1420.465] * [-1420.652] (-1419.998) (-1419.112) (-1419.387) -- 0:00:50
396000 -- (-1418.977) (-1419.559) (-1421.753) [-1418.105] * (-1422.211) (-1418.239) [-1418.152] (-1419.374) -- 0:00:50
396500 -- [-1421.256] (-1423.834) (-1419.198) (-1421.628) * (-1420.581) (-1418.359) (-1419.011) [-1418.626] -- 0:00:50
397000 -- (-1422.437) (-1423.478) [-1418.986] (-1419.424) * (-1420.771) [-1417.935] (-1418.075) (-1419.270) -- 0:00:50
397500 -- [-1420.625] (-1423.791) (-1418.745) (-1419.991) * (-1423.598) (-1418.165) (-1418.556) [-1419.900] -- 0:00:50
398000 -- (-1420.431) [-1420.836] (-1420.477) (-1422.218) * [-1418.931] (-1418.165) (-1418.831) (-1419.207) -- 0:00:49
398500 -- [-1419.703] (-1417.742) (-1418.262) (-1418.593) * (-1421.726) (-1420.095) [-1418.736] (-1420.583) -- 0:00:51
399000 -- (-1418.524) (-1417.742) [-1420.351] (-1420.197) * (-1422.490) (-1418.470) [-1420.768] (-1422.452) -- 0:00:51
399500 -- [-1419.762] (-1419.346) (-1421.358) (-1418.646) * (-1422.371) [-1421.593] (-1418.072) (-1419.702) -- 0:00:51
400000 -- (-1420.389) [-1419.155] (-1423.846) (-1420.836) * (-1422.121) (-1424.519) [-1420.034] (-1420.007) -- 0:00:51
Average standard deviation of split frequencies: 0.009412
400500 -- (-1419.967) (-1419.506) (-1423.332) [-1424.248] * (-1419.206) (-1418.495) (-1419.252) [-1419.899] -- 0:00:50
401000 -- (-1419.277) (-1418.889) (-1420.737) [-1422.301] * (-1418.027) (-1419.366) (-1420.249) [-1418.902] -- 0:00:50
401500 -- (-1419.001) [-1417.798] (-1419.273) (-1418.485) * (-1419.806) [-1422.274] (-1419.979) (-1424.023) -- 0:00:50
402000 -- (-1420.979) (-1419.109) [-1422.530] (-1418.437) * (-1421.754) [-1427.614] (-1419.882) (-1419.843) -- 0:00:50
402500 -- (-1420.854) (-1419.595) [-1419.389] (-1423.519) * (-1422.257) (-1420.933) [-1419.635] (-1418.813) -- 0:00:50
403000 -- (-1419.629) [-1421.700] (-1418.886) (-1418.985) * (-1424.298) (-1423.018) (-1419.697) [-1419.031] -- 0:00:50
403500 -- (-1418.100) [-1418.154] (-1419.873) (-1418.362) * (-1420.425) (-1422.091) (-1420.939) [-1420.497] -- 0:00:50
404000 -- (-1421.919) (-1419.428) (-1418.825) [-1417.932] * [-1422.796] (-1420.818) (-1420.129) (-1419.056) -- 0:00:50
404500 -- (-1421.143) (-1421.782) (-1418.563) [-1418.746] * [-1421.887] (-1422.745) (-1419.521) (-1423.679) -- 0:00:50
405000 -- (-1422.884) (-1421.115) (-1419.421) [-1418.181] * [-1421.649] (-1423.215) (-1419.375) (-1422.255) -- 0:00:49
Average standard deviation of split frequencies: 0.009220
405500 -- (-1420.632) (-1422.169) (-1423.989) [-1417.900] * (-1420.107) (-1423.230) [-1419.443] (-1417.732) -- 0:00:49
406000 -- (-1420.559) (-1422.502) [-1422.452] (-1419.730) * (-1420.182) (-1419.669) (-1422.486) [-1419.333] -- 0:00:49
406500 -- (-1420.544) (-1422.515) (-1423.118) [-1418.117] * (-1418.779) [-1430.547] (-1423.522) (-1422.390) -- 0:00:49
407000 -- (-1417.968) [-1419.628] (-1419.865) (-1418.951) * (-1420.482) (-1425.870) [-1420.786] (-1420.683) -- 0:00:49
407500 -- (-1419.805) (-1418.408) (-1418.866) [-1419.140] * (-1420.599) (-1423.944) (-1419.995) [-1419.640] -- 0:00:49
408000 -- (-1418.726) (-1419.185) [-1420.592] (-1422.705) * (-1420.856) (-1419.653) (-1419.492) [-1421.612] -- 0:00:49
408500 -- [-1418.893] (-1419.809) (-1419.934) (-1418.667) * (-1420.578) [-1420.045] (-1418.316) (-1421.873) -- 0:00:49
409000 -- (-1419.641) (-1420.702) (-1419.343) [-1418.861] * [-1420.225] (-1420.709) (-1418.901) (-1421.720) -- 0:00:49
409500 -- (-1421.977) (-1421.259) (-1422.325) [-1419.050] * (-1420.028) (-1420.554) (-1421.080) [-1422.220] -- 0:00:49
410000 -- (-1421.886) (-1423.023) (-1418.343) [-1419.941] * (-1418.894) [-1420.362] (-1420.104) (-1422.287) -- 0:00:48
Average standard deviation of split frequencies: 0.008681
410500 -- [-1418.896] (-1419.685) (-1419.875) (-1425.223) * [-1420.474] (-1426.585) (-1420.063) (-1423.714) -- 0:00:48
411000 -- [-1420.929] (-1419.250) (-1418.700) (-1421.613) * (-1424.599) [-1418.022] (-1419.393) (-1423.615) -- 0:00:50
411500 -- (-1420.616) [-1420.150] (-1419.385) (-1421.561) * (-1420.742) [-1419.487] (-1421.160) (-1422.898) -- 0:00:50
412000 -- [-1422.633] (-1423.688) (-1419.134) (-1419.484) * (-1422.124) (-1419.079) [-1419.494] (-1421.734) -- 0:00:49
412500 -- [-1419.159] (-1420.427) (-1421.630) (-1423.963) * [-1418.732] (-1419.221) (-1419.668) (-1420.479) -- 0:00:49
413000 -- (-1419.332) (-1421.981) [-1422.095] (-1420.142) * (-1419.096) (-1420.256) (-1421.031) [-1419.068] -- 0:00:49
413500 -- (-1419.243) (-1422.298) (-1424.741) [-1422.244] * (-1421.968) (-1420.298) [-1419.609] (-1422.148) -- 0:00:49
414000 -- [-1422.373] (-1419.515) (-1421.910) (-1418.407) * (-1423.922) [-1419.674] (-1419.330) (-1421.489) -- 0:00:49
414500 -- (-1422.784) (-1420.760) (-1422.413) [-1418.616] * (-1424.657) [-1419.646] (-1420.222) (-1422.211) -- 0:00:49
415000 -- (-1422.535) (-1420.235) [-1420.238] (-1420.391) * (-1420.913) [-1419.551] (-1420.368) (-1419.630) -- 0:00:49
Average standard deviation of split frequencies: 0.009349
415500 -- [-1422.877] (-1420.268) (-1420.262) (-1421.471) * (-1419.219) (-1420.327) (-1420.276) [-1418.269] -- 0:00:49
416000 -- (-1420.050) (-1420.248) [-1418.614] (-1419.389) * [-1421.755] (-1417.912) (-1422.628) (-1419.303) -- 0:00:49
416500 -- (-1418.441) (-1421.144) [-1418.845] (-1421.913) * (-1425.696) [-1418.189] (-1419.322) (-1420.796) -- 0:00:49
417000 -- [-1420.990] (-1420.744) (-1419.589) (-1419.212) * (-1418.423) (-1417.832) [-1419.423] (-1418.334) -- 0:00:48
417500 -- (-1419.551) [-1419.286] (-1418.151) (-1419.833) * (-1418.930) (-1421.587) (-1422.581) [-1420.566] -- 0:00:48
418000 -- (-1423.096) (-1419.563) [-1417.721] (-1422.029) * (-1420.598) (-1421.485) [-1424.027] (-1418.740) -- 0:00:48
418500 -- (-1419.157) (-1419.419) [-1418.655] (-1422.636) * (-1420.799) [-1418.431] (-1419.269) (-1421.757) -- 0:00:48
419000 -- (-1418.136) [-1418.974] (-1418.617) (-1422.243) * (-1421.398) (-1419.796) [-1418.330] (-1419.725) -- 0:00:48
419500 -- [-1419.697] (-1420.363) (-1419.015) (-1422.509) * (-1423.010) [-1422.362] (-1417.996) (-1418.654) -- 0:00:48
420000 -- (-1419.171) (-1420.519) (-1419.912) [-1420.912] * (-1421.363) (-1419.773) (-1418.813) [-1418.426] -- 0:00:48
Average standard deviation of split frequencies: 0.008685
420500 -- [-1421.780] (-1419.929) (-1420.961) (-1421.302) * [-1419.540] (-1421.493) (-1419.610) (-1420.131) -- 0:00:48
421000 -- [-1418.726] (-1424.055) (-1422.257) (-1420.984) * (-1423.022) [-1422.905] (-1420.980) (-1420.158) -- 0:00:48
421500 -- (-1419.649) (-1421.753) [-1423.593] (-1419.457) * (-1422.299) (-1421.019) [-1420.352] (-1420.506) -- 0:00:48
422000 -- (-1418.652) [-1419.330] (-1417.722) (-1418.930) * [-1419.490] (-1419.466) (-1420.183) (-1420.710) -- 0:00:47
422500 -- (-1419.671) [-1418.581] (-1420.376) (-1418.298) * [-1421.081] (-1419.334) (-1419.055) (-1421.468) -- 0:00:47
423000 -- (-1423.572) (-1419.179) (-1421.635) [-1418.400] * (-1420.796) (-1421.395) [-1419.767] (-1420.087) -- 0:00:47
423500 -- (-1419.977) [-1418.424] (-1420.191) (-1421.081) * [-1420.375] (-1419.539) (-1420.300) (-1420.407) -- 0:00:49
424000 -- (-1420.386) (-1418.666) (-1421.692) [-1421.623] * (-1422.613) (-1420.120) (-1420.135) [-1421.274] -- 0:00:48
424500 -- (-1418.098) (-1419.407) [-1422.707] (-1424.343) * (-1420.734) (-1419.844) (-1419.928) [-1420.097] -- 0:00:48
425000 -- (-1418.067) (-1420.544) (-1422.112) [-1421.688] * (-1421.088) (-1419.449) [-1418.734] (-1419.150) -- 0:00:48
Average standard deviation of split frequencies: 0.009475
425500 -- [-1420.509] (-1425.917) (-1418.956) (-1421.412) * (-1422.593) (-1425.358) (-1420.625) [-1420.617] -- 0:00:48
426000 -- (-1420.414) [-1420.327] (-1419.219) (-1421.680) * [-1420.140] (-1419.882) (-1419.639) (-1420.898) -- 0:00:48
426500 -- (-1419.965) (-1418.420) (-1418.380) [-1422.408] * (-1421.222) (-1419.398) (-1421.879) [-1421.173] -- 0:00:48
427000 -- [-1420.266] (-1418.638) (-1418.310) (-1421.842) * (-1420.980) (-1418.668) [-1422.083] (-1422.739) -- 0:00:48
427500 -- [-1421.341] (-1418.686) (-1418.302) (-1418.327) * (-1419.593) (-1418.743) [-1423.151] (-1421.615) -- 0:00:48
428000 -- (-1421.867) [-1421.582] (-1418.118) (-1418.375) * (-1420.581) (-1421.976) (-1418.774) [-1419.957] -- 0:00:48
428500 -- (-1421.742) [-1420.798] (-1418.364) (-1421.050) * (-1419.446) (-1424.807) [-1421.006] (-1419.763) -- 0:00:48
429000 -- (-1418.590) [-1419.564] (-1420.205) (-1418.790) * (-1419.023) (-1418.174) (-1420.161) [-1419.993] -- 0:00:47
429500 -- (-1421.003) (-1419.121) [-1420.381] (-1418.190) * [-1418.551] (-1419.352) (-1419.788) (-1417.907) -- 0:00:47
430000 -- [-1422.203] (-1419.618) (-1422.944) (-1418.410) * (-1419.891) (-1419.458) [-1423.297] (-1418.841) -- 0:00:47
Average standard deviation of split frequencies: 0.009988
430500 -- [-1423.473] (-1419.078) (-1422.736) (-1419.679) * (-1421.209) (-1420.602) (-1420.589) [-1418.066] -- 0:00:47
431000 -- (-1420.499) (-1421.405) (-1420.211) [-1418.153] * (-1421.304) (-1420.298) [-1419.627] (-1418.652) -- 0:00:47
431500 -- (-1421.553) (-1421.476) (-1422.334) [-1418.128] * [-1419.877] (-1419.290) (-1420.440) (-1418.360) -- 0:00:47
432000 -- (-1422.164) (-1423.752) (-1420.359) [-1419.884] * [-1418.142] (-1421.667) (-1422.029) (-1418.938) -- 0:00:47
432500 -- [-1420.112] (-1420.961) (-1421.341) (-1419.596) * (-1419.369) (-1420.870) (-1423.105) [-1419.253] -- 0:00:47
433000 -- (-1423.425) (-1421.157) [-1422.240] (-1419.175) * (-1419.369) [-1419.471] (-1425.766) (-1419.019) -- 0:00:47
433500 -- (-1422.898) (-1420.082) (-1428.706) [-1419.716] * [-1420.285] (-1421.281) (-1425.582) (-1420.754) -- 0:00:47
434000 -- (-1427.035) (-1418.558) (-1418.967) [-1419.963] * (-1419.587) (-1421.038) (-1419.356) [-1421.107] -- 0:00:46
434500 -- (-1420.406) (-1419.531) (-1418.084) [-1421.404] * (-1419.587) [-1419.785] (-1423.413) (-1422.683) -- 0:00:46
435000 -- (-1421.589) [-1417.846] (-1422.426) (-1419.824) * (-1422.643) (-1419.231) (-1418.917) [-1419.355] -- 0:00:46
Average standard deviation of split frequencies: 0.009461
435500 -- (-1419.268) (-1418.196) [-1421.503] (-1419.140) * (-1421.258) (-1422.893) [-1419.813] (-1420.416) -- 0:00:46
436000 -- (-1419.094) (-1418.621) [-1421.252] (-1419.904) * (-1421.857) (-1418.543) [-1419.204] (-1419.409) -- 0:00:47
436500 -- [-1418.264] (-1418.431) (-1422.430) (-1421.423) * (-1421.580) (-1418.982) (-1418.460) [-1419.697] -- 0:00:47
437000 -- (-1418.974) (-1423.546) [-1420.586] (-1419.437) * (-1419.633) (-1419.010) (-1419.603) [-1420.379] -- 0:00:47
437500 -- [-1420.739] (-1418.978) (-1418.779) (-1417.703) * (-1419.664) (-1420.470) [-1418.970] (-1424.739) -- 0:00:47
438000 -- (-1421.274) [-1421.773] (-1420.879) (-1419.226) * (-1420.393) [-1418.055] (-1420.161) (-1422.546) -- 0:00:47
438500 -- (-1422.323) (-1425.789) [-1420.982] (-1418.943) * [-1421.413] (-1418.462) (-1419.615) (-1419.975) -- 0:00:47
439000 -- (-1419.896) [-1426.980] (-1421.741) (-1419.025) * (-1421.451) (-1424.145) (-1419.503) [-1421.557] -- 0:00:47
439500 -- (-1418.196) [-1426.209] (-1422.723) (-1420.465) * (-1422.934) (-1421.952) (-1421.751) [-1419.403] -- 0:00:47
440000 -- (-1418.074) [-1425.915] (-1422.775) (-1420.186) * (-1419.446) (-1420.136) (-1420.361) [-1422.237] -- 0:00:47
Average standard deviation of split frequencies: 0.009227
440500 -- (-1418.067) (-1425.590) [-1420.361] (-1420.908) * [-1419.453] (-1420.090) (-1419.192) (-1421.413) -- 0:00:46
441000 -- (-1421.289) [-1423.128] (-1421.999) (-1423.524) * [-1419.273] (-1419.741) (-1421.677) (-1421.726) -- 0:00:46
441500 -- (-1418.663) (-1420.981) [-1418.741] (-1424.199) * (-1420.140) [-1418.665] (-1423.068) (-1428.719) -- 0:00:46
442000 -- (-1420.168) (-1420.628) (-1422.126) [-1422.760] * (-1419.934) [-1419.397] (-1420.827) (-1424.632) -- 0:00:46
442500 -- (-1418.686) [-1420.818] (-1421.272) (-1422.266) * (-1418.912) [-1419.820] (-1419.578) (-1420.633) -- 0:00:46
443000 -- [-1418.808] (-1420.595) (-1421.109) (-1419.070) * [-1418.948] (-1419.482) (-1419.868) (-1423.377) -- 0:00:46
443500 -- (-1418.808) (-1419.217) (-1421.166) [-1419.029] * [-1422.166] (-1420.691) (-1418.720) (-1420.462) -- 0:00:46
444000 -- (-1419.178) (-1418.692) (-1420.629) [-1420.531] * (-1419.339) (-1420.113) (-1420.013) [-1418.328] -- 0:00:46
444500 -- (-1418.969) (-1418.742) [-1421.728] (-1418.901) * (-1420.025) [-1418.856] (-1419.523) (-1418.591) -- 0:00:46
445000 -- (-1418.325) [-1418.533] (-1426.286) (-1420.206) * (-1419.344) (-1421.393) (-1422.068) [-1418.362] -- 0:00:46
Average standard deviation of split frequencies: 0.009645
445500 -- [-1419.267] (-1418.428) (-1421.640) (-1420.202) * [-1419.783] (-1421.277) (-1427.428) (-1420.821) -- 0:00:46
446000 -- (-1418.508) (-1421.570) (-1419.251) [-1418.865] * (-1419.376) (-1419.908) [-1420.051] (-1421.255) -- 0:00:45
446500 -- (-1418.268) (-1418.230) [-1419.121] (-1419.931) * (-1419.236) [-1419.868] (-1418.277) (-1419.343) -- 0:00:45
447000 -- (-1419.134) [-1422.629] (-1423.102) (-1419.024) * [-1418.821] (-1419.773) (-1422.859) (-1421.805) -- 0:00:45
447500 -- (-1419.742) [-1418.643] (-1422.708) (-1421.026) * (-1417.989) [-1418.754] (-1422.271) (-1419.518) -- 0:00:45
448000 -- (-1419.130) (-1419.024) [-1426.071] (-1420.293) * (-1419.903) (-1418.579) (-1421.394) [-1420.129] -- 0:00:45
448500 -- (-1419.835) (-1419.062) (-1423.678) [-1420.580] * (-1421.668) [-1418.556] (-1420.941) (-1418.912) -- 0:00:46
449000 -- (-1419.616) (-1419.004) [-1422.455] (-1423.412) * (-1422.617) (-1419.673) (-1423.471) [-1418.690] -- 0:00:46
449500 -- (-1420.881) (-1420.251) (-1420.407) [-1419.409] * [-1422.667] (-1418.567) (-1420.394) (-1421.225) -- 0:00:46
450000 -- (-1420.953) (-1420.632) [-1420.929] (-1419.418) * (-1421.358) [-1419.196] (-1419.741) (-1420.561) -- 0:00:46
Average standard deviation of split frequencies: 0.009554
450500 -- (-1418.385) (-1418.233) (-1419.543) [-1419.195] * (-1422.692) (-1420.296) [-1419.271] (-1418.671) -- 0:00:46
451000 -- (-1418.290) [-1418.088] (-1418.211) (-1424.159) * (-1419.252) [-1423.426] (-1423.367) (-1423.854) -- 0:00:46
451500 -- (-1418.258) [-1419.689] (-1421.476) (-1421.519) * (-1419.149) (-1419.884) [-1420.321] (-1421.238) -- 0:00:46
452000 -- (-1420.273) (-1418.064) [-1420.783] (-1420.666) * (-1419.155) (-1422.859) [-1418.006] (-1422.684) -- 0:00:46
452500 -- (-1420.267) (-1418.715) [-1419.644] (-1419.572) * (-1419.598) (-1420.716) (-1421.944) [-1420.365] -- 0:00:45
453000 -- [-1423.391] (-1421.542) (-1418.567) (-1422.599) * (-1422.502) [-1423.263] (-1420.860) (-1419.619) -- 0:00:45
453500 -- (-1419.855) (-1422.041) [-1418.863] (-1419.794) * [-1422.140] (-1421.054) (-1420.914) (-1418.721) -- 0:00:45
454000 -- [-1419.575] (-1421.193) (-1419.080) (-1420.688) * [-1425.511] (-1422.356) (-1418.732) (-1417.891) -- 0:00:45
454500 -- (-1421.452) (-1423.727) [-1419.396] (-1421.821) * (-1419.676) [-1420.180] (-1419.271) (-1419.378) -- 0:00:45
455000 -- [-1419.232] (-1419.356) (-1422.218) (-1419.500) * [-1419.464] (-1420.592) (-1418.126) (-1420.702) -- 0:00:45
Average standard deviation of split frequencies: 0.009511
455500 -- (-1419.194) (-1419.911) (-1423.662) [-1417.645] * [-1418.159] (-1418.838) (-1418.261) (-1419.301) -- 0:00:45
456000 -- (-1421.191) (-1421.289) [-1424.365] (-1417.732) * (-1419.764) (-1421.432) [-1419.433] (-1418.272) -- 0:00:45
456500 -- [-1421.734] (-1418.986) (-1422.450) (-1419.493) * (-1420.293) [-1423.312] (-1418.848) (-1421.475) -- 0:00:45
457000 -- (-1419.222) [-1420.832] (-1429.853) (-1420.370) * (-1424.182) (-1419.939) (-1418.693) [-1420.622] -- 0:00:45
457500 -- (-1418.989) [-1420.040] (-1421.303) (-1418.942) * [-1424.429] (-1419.403) (-1418.746) (-1417.610) -- 0:00:45
458000 -- (-1419.066) (-1422.850) (-1418.880) [-1417.990] * [-1419.460] (-1419.626) (-1419.589) (-1417.609) -- 0:00:44
458500 -- (-1420.396) [-1419.021] (-1421.353) (-1419.063) * (-1419.709) (-1419.481) [-1418.733] (-1417.528) -- 0:00:44
459000 -- (-1419.310) (-1419.344) [-1422.706] (-1419.868) * [-1419.617] (-1419.221) (-1421.728) (-1420.206) -- 0:00:44
459500 -- (-1421.175) (-1423.049) (-1420.816) [-1418.641] * [-1418.775] (-1422.319) (-1420.033) (-1420.371) -- 0:00:44
460000 -- (-1421.204) (-1420.439) (-1424.085) [-1419.958] * (-1418.762) (-1419.302) (-1422.863) [-1419.575] -- 0:00:44
Average standard deviation of split frequencies: 0.009338
460500 -- (-1421.719) [-1419.632] (-1424.218) (-1419.438) * (-1418.869) [-1420.312] (-1421.940) (-1420.142) -- 0:00:44
461000 -- (-1419.252) (-1419.543) (-1419.743) [-1418.077] * (-1420.896) (-1419.705) (-1420.613) [-1419.888] -- 0:00:45
461500 -- (-1419.645) (-1420.165) [-1424.167] (-1418.069) * (-1419.041) [-1423.153] (-1418.265) (-1419.574) -- 0:00:45
462000 -- (-1419.628) (-1418.063) (-1418.936) [-1419.033] * [-1418.283] (-1422.197) (-1419.703) (-1418.750) -- 0:00:45
462500 -- (-1419.102) (-1420.060) [-1421.250] (-1419.059) * (-1425.349) [-1421.498] (-1421.497) (-1418.251) -- 0:00:45
463000 -- [-1419.065] (-1419.164) (-1419.265) (-1421.095) * (-1427.324) [-1421.398] (-1421.952) (-1418.251) -- 0:00:45
463500 -- (-1418.886) (-1420.229) (-1419.363) [-1419.577] * [-1418.388] (-1421.112) (-1419.300) (-1418.196) -- 0:00:45
464000 -- (-1418.066) (-1422.553) (-1419.572) [-1418.287] * (-1421.149) (-1420.260) [-1418.523] (-1418.207) -- 0:00:45
464500 -- (-1419.642) (-1421.765) (-1418.883) [-1418.546] * (-1421.150) (-1420.237) (-1418.156) [-1418.417] -- 0:00:44
465000 -- (-1418.846) (-1420.832) (-1419.897) [-1418.816] * (-1424.198) (-1417.981) (-1423.178) [-1418.417] -- 0:00:44
Average standard deviation of split frequencies: 0.009990
465500 -- (-1420.902) (-1423.350) (-1418.879) [-1421.478] * (-1425.160) (-1419.926) [-1420.811] (-1417.704) -- 0:00:44
466000 -- [-1420.527] (-1423.220) (-1418.733) (-1421.122) * [-1421.200] (-1418.308) (-1420.960) (-1419.037) -- 0:00:44
466500 -- (-1418.482) (-1419.434) [-1418.624] (-1417.877) * (-1419.909) (-1417.859) (-1419.629) [-1419.110] -- 0:00:44
467000 -- [-1418.318] (-1419.238) (-1418.899) (-1418.765) * (-1422.545) (-1418.858) (-1419.874) [-1419.537] -- 0:00:44
467500 -- [-1419.464] (-1419.920) (-1418.533) (-1422.865) * [-1419.792] (-1421.895) (-1420.122) (-1420.107) -- 0:00:44
468000 -- (-1419.904) (-1419.718) (-1422.651) [-1421.129] * [-1420.067] (-1420.524) (-1419.446) (-1420.020) -- 0:00:44
468500 -- (-1420.994) (-1420.551) (-1419.361) [-1418.352] * (-1418.930) (-1421.765) (-1419.272) [-1418.624] -- 0:00:44
469000 -- (-1419.293) [-1418.346] (-1418.685) (-1419.535) * [-1418.896] (-1422.968) (-1420.948) (-1419.052) -- 0:00:44
469500 -- (-1420.248) [-1422.092] (-1419.149) (-1419.713) * (-1419.210) [-1419.671] (-1418.781) (-1418.664) -- 0:00:44
470000 -- (-1420.342) (-1418.848) [-1421.830] (-1420.214) * [-1420.647] (-1420.190) (-1418.287) (-1418.035) -- 0:00:43
Average standard deviation of split frequencies: 0.010016
470500 -- (-1422.257) (-1420.505) (-1420.403) [-1418.611] * [-1420.879] (-1424.884) (-1420.235) (-1418.738) -- 0:00:43
471000 -- (-1423.339) [-1419.950] (-1421.208) (-1419.426) * (-1418.450) (-1421.292) [-1417.785] (-1418.789) -- 0:00:43
471500 -- (-1419.702) [-1419.648] (-1420.905) (-1421.063) * [-1418.814] (-1420.363) (-1424.096) (-1421.787) -- 0:00:43
472000 -- (-1419.784) (-1419.726) [-1420.788] (-1419.915) * (-1417.897) (-1421.682) (-1424.531) [-1418.133] -- 0:00:43
472500 -- (-1420.218) (-1421.697) (-1419.470) [-1418.749] * [-1418.125] (-1425.016) (-1418.900) (-1418.501) -- 0:00:43
473000 -- (-1419.548) (-1419.304) (-1420.428) [-1420.678] * (-1418.139) (-1421.797) [-1419.066] (-1422.376) -- 0:00:43
473500 -- (-1419.299) (-1418.892) (-1423.031) [-1423.432] * (-1419.679) (-1424.274) (-1418.842) [-1421.146] -- 0:00:44
474000 -- (-1418.931) (-1417.991) (-1420.600) [-1422.434] * (-1420.608) (-1417.691) (-1419.558) [-1426.430] -- 0:00:44
474500 -- (-1419.670) (-1419.908) [-1417.729] (-1421.365) * (-1419.867) (-1417.912) [-1420.702] (-1419.955) -- 0:00:44
475000 -- (-1423.126) (-1419.087) (-1420.227) [-1422.021] * (-1420.551) (-1418.772) [-1418.823] (-1419.805) -- 0:00:44
Average standard deviation of split frequencies: 0.009842
475500 -- [-1419.986] (-1421.024) (-1419.719) (-1421.400) * (-1419.882) (-1419.014) [-1419.382] (-1420.966) -- 0:00:44
476000 -- (-1424.557) (-1419.310) [-1421.721] (-1422.214) * [-1419.792] (-1422.833) (-1421.911) (-1419.716) -- 0:00:44
476500 -- (-1426.217) (-1420.694) [-1420.371] (-1421.613) * (-1423.581) [-1421.768] (-1421.994) (-1426.754) -- 0:00:43
477000 -- (-1420.695) [-1420.889] (-1419.199) (-1421.872) * [-1420.739] (-1421.178) (-1419.087) (-1422.909) -- 0:00:43
477500 -- (-1426.698) (-1420.570) [-1420.946] (-1418.448) * [-1421.723] (-1420.260) (-1420.139) (-1420.756) -- 0:00:43
478000 -- [-1425.579] (-1424.615) (-1421.670) (-1418.784) * (-1420.781) [-1419.565] (-1418.049) (-1419.386) -- 0:00:43
478500 -- (-1418.129) (-1424.843) (-1422.761) [-1420.023] * (-1422.137) [-1418.334] (-1418.607) (-1423.191) -- 0:00:43
479000 -- (-1417.938) (-1423.153) [-1418.707] (-1418.599) * [-1419.461] (-1419.850) (-1420.039) (-1422.776) -- 0:00:43
479500 -- (-1421.042) [-1423.740] (-1418.428) (-1418.913) * (-1419.478) (-1418.808) (-1422.464) [-1418.650] -- 0:00:43
480000 -- (-1421.747) (-1418.997) (-1419.895) [-1419.918] * (-1419.927) [-1420.307] (-1418.660) (-1419.926) -- 0:00:43
Average standard deviation of split frequencies: 0.009807
480500 -- (-1418.499) (-1418.472) (-1421.731) [-1419.084] * (-1420.034) (-1421.293) (-1419.454) [-1421.926] -- 0:00:43
481000 -- (-1419.031) (-1419.851) [-1418.825] (-1418.056) * (-1420.065) (-1419.923) (-1420.660) [-1422.182] -- 0:00:43
481500 -- [-1419.537] (-1430.365) (-1422.748) (-1418.055) * (-1419.375) (-1420.382) [-1419.882] (-1420.333) -- 0:00:43
482000 -- (-1419.872) (-1426.490) [-1421.470] (-1419.355) * [-1420.299] (-1423.618) (-1424.129) (-1420.822) -- 0:00:42
482500 -- [-1419.585] (-1420.730) (-1421.820) (-1419.723) * (-1420.201) (-1417.817) [-1422.581] (-1418.969) -- 0:00:42
483000 -- (-1420.868) (-1419.152) (-1422.169) [-1424.580] * (-1419.603) [-1419.624] (-1421.247) (-1421.811) -- 0:00:42
483500 -- (-1422.440) [-1418.339] (-1421.852) (-1424.484) * (-1418.706) (-1419.605) [-1421.133] (-1419.121) -- 0:00:42
484000 -- (-1422.299) [-1418.061] (-1419.399) (-1423.485) * [-1418.813] (-1419.251) (-1418.442) (-1429.233) -- 0:00:42
484500 -- [-1418.637] (-1418.538) (-1423.796) (-1419.172) * (-1419.441) (-1420.265) [-1419.130] (-1421.142) -- 0:00:42
485000 -- (-1420.725) [-1417.700] (-1420.159) (-1419.081) * (-1423.489) (-1420.913) (-1420.412) [-1420.898] -- 0:00:42
Average standard deviation of split frequencies: 0.009154
485500 -- (-1421.915) (-1418.360) [-1419.053] (-1419.784) * [-1425.030] (-1423.373) (-1425.268) (-1421.544) -- 0:00:42
486000 -- (-1422.374) (-1419.134) [-1420.010] (-1420.443) * (-1419.566) (-1422.776) (-1425.965) [-1418.621] -- 0:00:43
486500 -- [-1419.149] (-1418.401) (-1420.308) (-1419.861) * (-1424.182) (-1420.464) (-1419.080) [-1419.226] -- 0:00:43
487000 -- (-1422.543) (-1421.848) (-1417.982) [-1423.433] * (-1420.689) (-1419.590) [-1421.043] (-1419.118) -- 0:00:43
487500 -- (-1419.700) (-1420.030) [-1418.640] (-1417.943) * (-1419.361) (-1422.747) (-1420.148) [-1422.559] -- 0:00:43
488000 -- (-1420.917) [-1419.772] (-1424.843) (-1424.426) * (-1420.709) (-1419.037) [-1420.034] (-1420.684) -- 0:00:43
488500 -- (-1421.525) (-1418.419) [-1420.603] (-1420.657) * (-1420.579) (-1419.907) (-1421.994) [-1419.935] -- 0:00:42
489000 -- (-1421.964) (-1419.705) (-1419.781) [-1419.712] * [-1418.477] (-1419.016) (-1420.248) (-1419.780) -- 0:00:42
489500 -- (-1423.067) (-1419.792) (-1420.686) [-1419.804] * (-1418.803) (-1421.783) (-1420.063) [-1421.730] -- 0:00:42
490000 -- (-1421.921) [-1419.884] (-1419.354) (-1422.753) * (-1418.921) (-1423.559) (-1419.421) [-1421.948] -- 0:00:42
Average standard deviation of split frequencies: 0.008767
490500 -- [-1419.663] (-1420.414) (-1421.627) (-1422.736) * (-1420.070) (-1421.097) [-1417.778] (-1420.223) -- 0:00:42
491000 -- (-1419.000) (-1418.802) (-1422.691) [-1418.623] * [-1423.213] (-1421.247) (-1418.361) (-1421.181) -- 0:00:42
491500 -- (-1422.332) [-1419.257] (-1421.463) (-1420.551) * [-1418.878] (-1418.445) (-1418.982) (-1420.075) -- 0:00:42
492000 -- (-1419.724) (-1419.257) (-1422.920) [-1421.037] * (-1419.748) (-1419.872) (-1418.903) [-1423.115] -- 0:00:42
492500 -- (-1420.849) (-1419.625) [-1421.366] (-1419.503) * (-1419.014) (-1418.166) [-1418.696] (-1421.135) -- 0:00:42
493000 -- [-1419.445] (-1421.590) (-1421.584) (-1421.919) * (-1418.211) (-1418.237) [-1420.048] (-1420.349) -- 0:00:42
493500 -- (-1418.497) [-1421.800] (-1422.179) (-1419.789) * [-1420.148] (-1422.515) (-1420.434) (-1418.723) -- 0:00:42
494000 -- (-1418.276) (-1424.555) (-1422.762) [-1419.755] * (-1418.328) [-1418.949] (-1423.981) (-1419.477) -- 0:00:41
494500 -- (-1419.905) (-1419.372) (-1420.457) [-1418.720] * (-1422.552) (-1418.515) [-1419.624] (-1420.354) -- 0:00:41
495000 -- (-1422.580) [-1419.185] (-1418.134) (-1418.566) * (-1420.997) (-1418.566) [-1422.812] (-1420.365) -- 0:00:41
Average standard deviation of split frequencies: 0.008910
495500 -- (-1422.687) (-1419.915) (-1419.664) [-1419.776] * [-1418.764] (-1419.401) (-1423.216) (-1420.116) -- 0:00:41
496000 -- [-1422.093] (-1422.258) (-1418.651) (-1418.774) * (-1420.426) (-1421.385) (-1419.732) [-1420.119] -- 0:00:41
496500 -- (-1421.356) [-1421.153] (-1420.121) (-1420.814) * (-1418.057) (-1420.340) [-1418.718] (-1421.621) -- 0:00:41
497000 -- (-1420.172) (-1422.383) [-1420.279] (-1420.017) * (-1418.401) [-1418.866] (-1418.438) (-1426.066) -- 0:00:41
497500 -- (-1419.782) (-1421.547) (-1418.556) [-1420.146] * (-1418.355) (-1421.079) [-1418.461] (-1420.492) -- 0:00:41
498000 -- (-1422.196) (-1423.318) [-1418.360] (-1419.543) * [-1424.494] (-1420.243) (-1421.236) (-1419.820) -- 0:00:41
498500 -- (-1419.600) (-1422.607) [-1422.837] (-1420.386) * (-1419.447) (-1420.348) (-1418.420) [-1418.642] -- 0:00:42
499000 -- (-1419.369) [-1422.665] (-1422.456) (-1419.322) * (-1420.585) [-1419.527] (-1420.240) (-1418.135) -- 0:00:42
499500 -- [-1418.343] (-1423.336) (-1423.538) (-1419.100) * (-1419.806) [-1418.068] (-1418.799) (-1420.524) -- 0:00:42
500000 -- (-1418.241) (-1420.177) [-1418.466] (-1418.928) * (-1418.206) (-1418.707) (-1418.333) [-1419.824] -- 0:00:42
Average standard deviation of split frequencies: 0.009004
500500 -- (-1418.388) [-1419.170] (-1419.049) (-1419.547) * [-1419.642] (-1419.879) (-1423.047) (-1421.846) -- 0:00:41
501000 -- (-1421.857) (-1420.913) [-1421.020] (-1421.625) * [-1419.886] (-1419.426) (-1419.604) (-1418.900) -- 0:00:41
501500 -- (-1418.866) (-1419.328) [-1419.916] (-1420.737) * (-1419.668) [-1419.247] (-1421.620) (-1419.075) -- 0:00:41
502000 -- (-1418.060) (-1418.343) [-1423.462] (-1423.580) * (-1419.083) [-1420.060] (-1420.291) (-1420.834) -- 0:00:41
502500 -- (-1418.490) [-1418.585] (-1420.464) (-1418.820) * (-1419.443) (-1418.516) (-1422.274) [-1424.268] -- 0:00:41
503000 -- (-1418.437) [-1418.317] (-1418.931) (-1419.921) * (-1419.329) [-1418.853] (-1421.118) (-1419.891) -- 0:00:41
503500 -- (-1421.473) (-1418.264) [-1423.323] (-1420.257) * (-1421.226) [-1417.957] (-1418.687) (-1418.098) -- 0:00:41
504000 -- (-1418.412) [-1417.984] (-1419.935) (-1422.951) * (-1421.722) [-1418.291] (-1420.592) (-1418.015) -- 0:00:41
504500 -- (-1418.728) (-1418.023) [-1418.633] (-1423.056) * (-1420.900) [-1423.474] (-1426.506) (-1418.346) -- 0:00:41
505000 -- (-1418.477) (-1420.085) [-1419.011] (-1423.765) * (-1419.179) [-1419.174] (-1423.379) (-1418.035) -- 0:00:41
Average standard deviation of split frequencies: 0.008792
505500 -- [-1419.210] (-1421.450) (-1420.480) (-1421.112) * (-1419.320) [-1420.399] (-1421.351) (-1420.496) -- 0:00:41
506000 -- (-1422.196) (-1420.126) (-1422.423) [-1418.618] * [-1418.835] (-1419.079) (-1422.245) (-1422.705) -- 0:00:41
506500 -- (-1419.308) (-1419.128) [-1418.107] (-1418.681) * [-1421.142] (-1418.379) (-1419.755) (-1422.591) -- 0:00:40
507000 -- (-1419.014) [-1418.880] (-1419.989) (-1419.921) * (-1419.981) [-1418.129] (-1420.987) (-1422.809) -- 0:00:40
507500 -- (-1422.082) (-1419.835) [-1418.070] (-1418.767) * [-1419.909] (-1418.891) (-1419.245) (-1419.729) -- 0:00:40
508000 -- [-1423.027] (-1419.872) (-1420.541) (-1420.192) * [-1419.190] (-1418.766) (-1419.247) (-1419.920) -- 0:00:40
508500 -- (-1424.583) (-1422.383) (-1419.461) [-1421.174] * [-1419.189] (-1418.863) (-1420.089) (-1420.454) -- 0:00:40
509000 -- (-1418.909) (-1418.916) (-1417.795) [-1420.081] * (-1418.706) [-1419.248] (-1421.511) (-1419.665) -- 0:00:40
509500 -- (-1419.266) (-1420.404) [-1419.935] (-1420.454) * (-1418.776) [-1420.545] (-1420.853) (-1419.968) -- 0:00:40
510000 -- [-1418.370] (-1420.170) (-1418.579) (-1423.220) * [-1419.992] (-1420.519) (-1421.981) (-1418.133) -- 0:00:40
Average standard deviation of split frequencies: 0.008423
510500 -- (-1420.311) (-1418.548) (-1420.104) [-1420.674] * (-1420.124) (-1419.620) (-1419.383) [-1417.960] -- 0:00:40
511000 -- (-1419.325) [-1418.615] (-1419.339) (-1418.435) * [-1417.829] (-1418.447) (-1419.059) (-1418.184) -- 0:00:41
511500 -- (-1419.427) [-1422.490] (-1418.821) (-1421.332) * (-1419.032) (-1419.827) (-1420.621) [-1418.184] -- 0:00:41
512000 -- (-1417.703) (-1424.069) [-1418.304] (-1422.371) * (-1419.659) (-1419.872) [-1420.784] (-1420.546) -- 0:00:40
512500 -- (-1419.015) (-1420.094) [-1418.622] (-1421.010) * (-1421.657) (-1421.827) (-1421.598) [-1419.071] -- 0:00:40
513000 -- (-1418.550) (-1418.481) [-1418.916] (-1420.679) * (-1423.257) (-1421.718) (-1419.022) [-1419.443] -- 0:00:40
513500 -- (-1418.425) (-1419.887) [-1418.682] (-1421.964) * [-1419.915] (-1420.813) (-1420.440) (-1422.470) -- 0:00:40
514000 -- (-1419.593) [-1426.033] (-1418.907) (-1422.188) * [-1418.556] (-1421.625) (-1418.646) (-1426.718) -- 0:00:40
514500 -- (-1424.683) [-1421.632] (-1418.246) (-1419.745) * (-1419.921) (-1421.217) (-1418.974) [-1420.671] -- 0:00:40
515000 -- (-1420.396) (-1421.593) [-1418.692] (-1420.002) * (-1418.352) [-1420.249] (-1420.218) (-1421.235) -- 0:00:40
Average standard deviation of split frequencies: 0.008850
515500 -- [-1421.039] (-1423.822) (-1418.490) (-1419.670) * (-1420.200) [-1419.457] (-1422.040) (-1419.324) -- 0:00:40
516000 -- [-1419.362] (-1421.154) (-1421.848) (-1421.718) * (-1421.179) (-1422.100) [-1422.207] (-1420.888) -- 0:00:40
516500 -- [-1421.389] (-1420.697) (-1418.420) (-1418.876) * (-1424.840) [-1420.057] (-1419.232) (-1418.965) -- 0:00:40
517000 -- (-1421.178) (-1419.544) [-1419.946] (-1418.702) * (-1419.493) (-1421.051) (-1419.343) [-1419.635] -- 0:00:40
517500 -- (-1418.680) [-1419.702] (-1420.069) (-1420.402) * (-1421.072) (-1420.491) (-1420.421) [-1419.650] -- 0:00:40
518000 -- (-1419.653) (-1420.875) (-1420.681) [-1420.356] * (-1418.983) [-1418.605] (-1419.927) (-1418.898) -- 0:00:40
518500 -- (-1422.296) (-1423.945) (-1419.038) [-1420.295] * [-1419.137] (-1417.631) (-1419.834) (-1418.873) -- 0:00:39
519000 -- (-1423.429) (-1423.646) (-1418.554) [-1419.313] * (-1421.252) (-1418.332) [-1417.825] (-1420.525) -- 0:00:39
519500 -- (-1421.918) [-1419.806] (-1418.681) (-1419.420) * (-1424.318) (-1419.507) (-1421.343) [-1418.219] -- 0:00:39
520000 -- (-1419.163) [-1418.471] (-1418.888) (-1419.841) * (-1422.549) (-1420.207) (-1418.281) [-1422.407] -- 0:00:39
Average standard deviation of split frequencies: 0.009450
520500 -- [-1424.994] (-1417.733) (-1419.233) (-1421.324) * (-1420.214) (-1419.896) [-1420.665] (-1420.656) -- 0:00:39
521000 -- (-1424.221) (-1418.185) (-1419.123) [-1420.906] * (-1421.127) [-1419.746] (-1417.951) (-1424.238) -- 0:00:39
521500 -- (-1424.623) [-1420.662] (-1422.422) (-1418.615) * (-1423.558) (-1419.675) [-1418.459] (-1424.549) -- 0:00:39
522000 -- (-1421.506) (-1420.658) [-1423.480] (-1420.494) * (-1425.846) (-1419.834) [-1421.903] (-1420.993) -- 0:00:39
522500 -- (-1420.035) (-1419.507) [-1418.887] (-1419.264) * (-1422.152) [-1419.081] (-1420.045) (-1421.018) -- 0:00:39
523000 -- (-1419.383) (-1419.326) (-1423.027) [-1421.190] * (-1422.379) [-1418.479] (-1419.419) (-1420.003) -- 0:00:39
523500 -- (-1419.167) (-1419.695) (-1418.702) [-1419.221] * (-1421.046) (-1419.201) (-1422.279) [-1418.755] -- 0:00:40
524000 -- (-1420.948) (-1419.086) (-1418.158) [-1419.909] * (-1418.951) (-1418.585) [-1418.798] (-1418.858) -- 0:00:39
524500 -- (-1420.357) (-1418.553) (-1417.926) [-1419.431] * [-1420.708] (-1421.853) (-1418.713) (-1423.060) -- 0:00:39
525000 -- (-1423.062) (-1419.000) (-1420.456) [-1418.255] * (-1425.244) (-1420.723) (-1419.110) [-1420.496] -- 0:00:39
Average standard deviation of split frequencies: 0.009700
525500 -- (-1420.721) (-1420.022) (-1420.776) [-1420.998] * (-1419.782) (-1418.120) (-1420.626) [-1420.993] -- 0:00:39
526000 -- (-1420.713) (-1420.595) (-1420.712) [-1419.620] * [-1423.273] (-1419.586) (-1419.396) (-1420.545) -- 0:00:39
526500 -- [-1419.974] (-1419.324) (-1421.139) (-1421.358) * (-1420.624) (-1421.520) (-1422.682) [-1418.398] -- 0:00:39
527000 -- [-1419.673] (-1418.371) (-1419.312) (-1419.512) * (-1420.410) (-1425.553) (-1422.799) [-1418.829] -- 0:00:39
527500 -- (-1418.149) (-1418.508) [-1420.167] (-1420.193) * (-1424.228) (-1420.609) [-1420.868] (-1419.140) -- 0:00:39
528000 -- [-1418.657] (-1418.789) (-1423.882) (-1419.754) * (-1419.944) (-1422.488) [-1423.042] (-1421.666) -- 0:00:39
528500 -- (-1423.701) (-1421.576) (-1418.892) [-1418.386] * (-1418.855) (-1423.204) (-1422.253) [-1421.076] -- 0:00:39
529000 -- [-1421.065] (-1419.310) (-1418.230) (-1418.529) * (-1418.671) (-1419.598) (-1423.089) [-1421.401] -- 0:00:39
529500 -- (-1420.365) (-1420.572) [-1418.822] (-1418.427) * (-1418.567) (-1418.508) (-1421.758) [-1418.721] -- 0:00:39
530000 -- (-1422.206) (-1418.837) (-1418.520) [-1418.367] * [-1418.523] (-1421.442) (-1419.758) (-1418.720) -- 0:00:39
Average standard deviation of split frequencies: 0.009667
530500 -- (-1417.888) (-1423.795) (-1420.118) [-1418.367] * (-1421.789) (-1422.343) (-1419.466) [-1420.307] -- 0:00:38
531000 -- (-1419.252) [-1421.470] (-1423.612) (-1419.231) * [-1421.744] (-1421.667) (-1418.478) (-1419.144) -- 0:00:38
531500 -- (-1421.329) (-1423.287) [-1425.027] (-1419.109) * (-1419.702) (-1418.821) (-1419.648) [-1422.079] -- 0:00:38
532000 -- [-1419.660] (-1420.043) (-1420.769) (-1419.109) * (-1422.331) (-1420.879) (-1422.850) [-1422.716] -- 0:00:38
532500 -- [-1418.118] (-1417.721) (-1422.687) (-1418.259) * (-1421.880) (-1420.083) (-1422.287) [-1421.598] -- 0:00:38
533000 -- (-1418.118) [-1418.167] (-1421.480) (-1418.867) * (-1418.851) (-1419.214) (-1420.267) [-1418.734] -- 0:00:38
533500 -- (-1419.369) (-1417.764) [-1420.975] (-1421.666) * [-1421.052] (-1419.273) (-1422.247) (-1421.352) -- 0:00:38
534000 -- (-1420.264) (-1417.771) [-1422.216] (-1421.383) * (-1419.815) [-1418.609] (-1421.778) (-1420.819) -- 0:00:38
534500 -- (-1421.822) (-1421.341) (-1419.476) [-1420.799] * [-1420.663] (-1418.724) (-1421.650) (-1421.480) -- 0:00:38
535000 -- (-1421.276) (-1418.758) [-1417.850] (-1420.053) * [-1419.270] (-1419.498) (-1422.925) (-1419.289) -- 0:00:38
Average standard deviation of split frequencies: 0.009345
535500 -- (-1419.682) (-1419.040) [-1420.040] (-1419.041) * [-1420.831] (-1422.796) (-1421.255) (-1421.555) -- 0:00:38
536000 -- [-1419.639] (-1419.251) (-1418.686) (-1418.964) * (-1419.584) [-1419.178] (-1419.722) (-1419.870) -- 0:00:38
536500 -- (-1423.361) [-1419.499] (-1418.349) (-1418.463) * (-1425.226) (-1419.992) (-1419.079) [-1422.295] -- 0:00:38
537000 -- (-1423.415) (-1421.020) (-1419.116) [-1418.376] * [-1421.725] (-1423.851) (-1420.773) (-1419.274) -- 0:00:38
537500 -- (-1419.469) (-1420.018) [-1418.943] (-1419.428) * (-1420.247) [-1424.465] (-1419.204) (-1420.643) -- 0:00:38
538000 -- (-1419.545) [-1420.628] (-1418.808) (-1420.172) * (-1419.304) (-1418.765) (-1419.958) [-1421.090] -- 0:00:38
538500 -- (-1420.798) [-1419.624] (-1418.753) (-1420.135) * (-1418.551) (-1421.056) [-1418.775] (-1419.941) -- 0:00:38
539000 -- (-1418.481) (-1418.495) (-1419.463) [-1419.682] * (-1420.743) (-1419.600) [-1418.509] (-1420.249) -- 0:00:38
539500 -- (-1418.574) (-1418.903) [-1418.762] (-1420.159) * (-1420.362) (-1419.008) (-1419.694) [-1420.883] -- 0:00:38
540000 -- (-1423.610) [-1420.511] (-1421.410) (-1418.341) * (-1418.053) [-1421.401] (-1419.077) (-1418.395) -- 0:00:38
Average standard deviation of split frequencies: 0.009950
540500 -- [-1422.897] (-1418.977) (-1419.994) (-1420.424) * (-1420.437) (-1420.672) (-1418.716) [-1419.958] -- 0:00:38
541000 -- [-1419.356] (-1417.947) (-1420.324) (-1420.904) * (-1418.008) (-1420.896) (-1420.992) [-1420.766] -- 0:00:38
541500 -- (-1417.851) (-1418.385) [-1418.772] (-1418.228) * (-1417.760) [-1419.509] (-1419.047) (-1420.543) -- 0:00:38
542000 -- (-1418.186) (-1419.989) [-1418.793] (-1418.389) * (-1419.304) [-1419.161] (-1420.568) (-1421.358) -- 0:00:38
542500 -- (-1421.747) (-1418.959) [-1419.945] (-1421.357) * (-1421.702) (-1421.006) (-1419.488) [-1422.910] -- 0:00:37
543000 -- (-1424.573) (-1420.181) [-1419.169] (-1419.704) * [-1419.578] (-1422.993) (-1418.714) (-1420.673) -- 0:00:37
543500 -- (-1420.463) (-1423.408) [-1420.619] (-1420.533) * [-1424.060] (-1420.342) (-1423.127) (-1419.504) -- 0:00:37
544000 -- (-1418.749) (-1420.100) (-1419.090) [-1420.263] * (-1420.535) (-1425.324) (-1420.424) [-1419.256] -- 0:00:37
544500 -- (-1418.846) (-1418.547) [-1418.858] (-1420.489) * (-1419.070) (-1420.022) (-1419.278) [-1421.357] -- 0:00:37
545000 -- (-1420.224) (-1417.942) (-1420.246) [-1417.694] * (-1419.135) (-1419.457) [-1417.981] (-1419.457) -- 0:00:37
Average standard deviation of split frequencies: 0.010107
545500 -- [-1425.097] (-1417.828) (-1419.493) (-1418.437) * (-1419.135) (-1419.723) [-1418.971] (-1420.080) -- 0:00:37
546000 -- (-1420.687) (-1418.398) [-1418.447] (-1424.317) * [-1420.469] (-1420.397) (-1418.599) (-1419.300) -- 0:00:37
546500 -- [-1420.921] (-1420.645) (-1420.251) (-1419.561) * (-1419.288) [-1418.206] (-1418.743) (-1418.459) -- 0:00:37
547000 -- (-1421.045) (-1419.848) [-1419.915] (-1418.096) * (-1423.845) [-1421.718] (-1417.668) (-1418.964) -- 0:00:37
547500 -- (-1420.197) (-1419.942) [-1418.324] (-1420.008) * (-1421.840) [-1418.769] (-1424.246) (-1418.191) -- 0:00:37
548000 -- [-1422.511] (-1418.946) (-1418.905) (-1421.341) * [-1420.242] (-1420.951) (-1423.336) (-1418.670) -- 0:00:37
548500 -- [-1419.259] (-1422.093) (-1418.857) (-1420.979) * (-1418.040) (-1420.173) [-1420.908] (-1419.339) -- 0:00:37
549000 -- (-1427.782) [-1421.254] (-1419.080) (-1419.916) * (-1417.973) [-1423.857] (-1419.516) (-1419.194) -- 0:00:37
549500 -- (-1424.301) (-1420.172) [-1418.196] (-1422.398) * (-1421.600) (-1421.207) [-1419.752] (-1422.205) -- 0:00:37
550000 -- (-1418.981) [-1419.723] (-1423.910) (-1419.291) * [-1419.466] (-1419.511) (-1420.505) (-1419.587) -- 0:00:37
Average standard deviation of split frequencies: 0.010222
550500 -- [-1418.982] (-1418.875) (-1419.512) (-1422.677) * (-1419.257) (-1419.535) [-1420.891] (-1418.215) -- 0:00:37
551000 -- (-1420.590) (-1418.658) [-1423.227] (-1421.551) * (-1419.038) [-1420.052] (-1422.606) (-1419.655) -- 0:00:37
551500 -- (-1418.045) (-1419.738) [-1418.041] (-1419.476) * (-1420.934) (-1417.919) (-1427.001) [-1418.555] -- 0:00:37
552000 -- [-1422.660] (-1421.313) (-1419.253) (-1419.002) * (-1419.580) (-1418.955) (-1424.573) [-1421.086] -- 0:00:37
552500 -- (-1419.259) [-1419.464] (-1420.032) (-1419.998) * [-1419.036] (-1419.846) (-1420.432) (-1420.467) -- 0:00:37
553000 -- [-1418.858] (-1418.773) (-1419.456) (-1421.063) * [-1419.977] (-1421.407) (-1420.731) (-1421.039) -- 0:00:37
553500 -- (-1420.882) (-1419.460) (-1421.039) [-1420.614] * (-1422.361) (-1421.680) (-1419.970) [-1419.923] -- 0:00:37
554000 -- (-1418.453) (-1420.258) [-1418.181] (-1421.728) * (-1422.032) (-1423.068) [-1422.168] (-1420.248) -- 0:00:37
554500 -- (-1418.841) [-1418.841] (-1423.037) (-1418.810) * (-1418.101) (-1420.581) [-1419.042] (-1419.978) -- 0:00:36
555000 -- (-1422.466) [-1418.877] (-1420.275) (-1418.302) * (-1421.543) (-1420.729) (-1423.621) [-1418.020] -- 0:00:36
Average standard deviation of split frequencies: 0.010324
555500 -- (-1419.142) (-1418.498) [-1418.763] (-1418.000) * [-1419.664] (-1418.765) (-1419.943) (-1420.153) -- 0:00:36
556000 -- [-1419.067] (-1418.520) (-1418.919) (-1417.975) * (-1420.674) (-1422.273) (-1419.884) [-1421.293] -- 0:00:36
556500 -- [-1419.658] (-1418.603) (-1418.963) (-1418.002) * (-1420.772) (-1420.115) [-1419.314] (-1420.287) -- 0:00:36
557000 -- (-1422.580) [-1417.948] (-1419.189) (-1425.733) * (-1419.360) (-1419.940) [-1418.381] (-1420.939) -- 0:00:36
557500 -- (-1421.958) (-1418.604) [-1421.405] (-1420.768) * (-1419.287) (-1419.601) [-1421.786] (-1421.367) -- 0:00:36
558000 -- [-1422.223] (-1419.796) (-1422.792) (-1426.569) * [-1426.108] (-1418.715) (-1421.787) (-1419.938) -- 0:00:36
558500 -- [-1418.233] (-1421.783) (-1425.565) (-1424.018) * (-1426.022) (-1420.068) [-1418.903] (-1421.836) -- 0:00:36
559000 -- (-1418.491) (-1424.130) (-1421.545) [-1422.001] * (-1420.777) [-1418.235] (-1418.264) (-1419.410) -- 0:00:36
559500 -- (-1419.229) (-1420.043) [-1422.989] (-1419.045) * (-1424.392) (-1418.992) (-1417.951) [-1418.851] -- 0:00:36
560000 -- (-1420.470) [-1419.766] (-1423.978) (-1418.526) * [-1421.246] (-1419.553) (-1417.611) (-1420.485) -- 0:00:36
Average standard deviation of split frequencies: 0.010090
560500 -- (-1421.513) (-1421.544) [-1419.060] (-1419.173) * [-1421.201] (-1421.850) (-1417.978) (-1421.570) -- 0:00:36
561000 -- (-1418.950) (-1419.811) [-1420.359] (-1419.173) * (-1421.357) (-1423.793) [-1419.122] (-1423.922) -- 0:00:35
561500 -- (-1419.519) [-1418.314] (-1419.308) (-1419.711) * (-1421.327) (-1420.829) [-1419.366] (-1421.159) -- 0:00:36
562000 -- (-1418.276) (-1419.250) (-1421.658) [-1421.357] * (-1418.665) (-1422.708) [-1419.872] (-1419.239) -- 0:00:36
562500 -- [-1418.031] (-1420.357) (-1419.906) (-1420.679) * [-1422.442] (-1419.100) (-1421.692) (-1419.094) -- 0:00:36
563000 -- (-1418.003) (-1418.852) [-1419.869] (-1418.090) * (-1421.060) [-1419.212] (-1420.404) (-1419.494) -- 0:00:36
563500 -- (-1419.646) (-1417.832) [-1420.804] (-1418.788) * (-1419.615) (-1422.945) (-1418.404) [-1420.897] -- 0:00:36
564000 -- [-1418.916] (-1420.684) (-1421.429) (-1418.910) * (-1420.110) [-1418.483] (-1418.515) (-1417.868) -- 0:00:36
564500 -- (-1419.356) (-1420.596) (-1421.857) [-1419.892] * [-1422.969] (-1419.218) (-1419.596) (-1418.070) -- 0:00:36
565000 -- (-1418.945) [-1419.522] (-1422.199) (-1418.336) * (-1422.524) (-1418.579) (-1424.840) [-1419.981] -- 0:00:36
Average standard deviation of split frequencies: 0.009945
565500 -- (-1418.562) (-1417.890) (-1420.820) [-1420.141] * [-1423.422] (-1418.536) (-1423.762) (-1419.040) -- 0:00:36
566000 -- (-1418.937) [-1418.458] (-1422.213) (-1421.301) * (-1420.314) (-1417.619) [-1421.415] (-1419.040) -- 0:00:36
566500 -- (-1418.386) [-1420.285] (-1421.471) (-1420.263) * (-1420.434) (-1418.235) [-1420.561] (-1419.649) -- 0:00:35
567000 -- (-1418.671) (-1419.138) (-1419.878) [-1419.314] * (-1420.188) (-1418.565) (-1420.025) [-1419.916] -- 0:00:35
567500 -- (-1418.890) (-1422.910) (-1419.321) [-1421.297] * [-1418.750] (-1420.552) (-1420.747) (-1424.359) -- 0:00:35
568000 -- (-1418.420) (-1420.729) [-1419.355] (-1419.832) * (-1419.094) [-1420.616] (-1423.921) (-1420.408) -- 0:00:35
568500 -- [-1418.466] (-1422.011) (-1420.109) (-1422.729) * [-1418.371] (-1419.881) (-1421.301) (-1419.507) -- 0:00:35
569000 -- (-1419.100) [-1422.098] (-1420.648) (-1422.126) * (-1418.753) (-1419.858) [-1419.666] (-1419.737) -- 0:00:35
569500 -- (-1419.624) [-1419.048] (-1418.718) (-1418.462) * (-1419.100) [-1418.022] (-1419.849) (-1418.934) -- 0:00:35
570000 -- [-1419.143] (-1423.912) (-1418.962) (-1418.970) * (-1419.595) (-1417.983) [-1422.004] (-1421.121) -- 0:00:35
Average standard deviation of split frequencies: 0.009330
570500 -- (-1421.595) (-1421.555) [-1420.394] (-1421.374) * (-1418.839) [-1421.131] (-1423.469) (-1420.503) -- 0:00:35
571000 -- (-1423.019) (-1420.667) [-1418.771] (-1419.811) * (-1419.446) [-1420.938] (-1421.787) (-1419.948) -- 0:00:35
571500 -- (-1418.009) (-1420.314) (-1419.767) [-1419.271] * (-1420.846) (-1424.162) [-1420.297] (-1420.038) -- 0:00:35
572000 -- (-1418.958) [-1421.135] (-1422.006) (-1422.524) * (-1418.448) [-1418.968] (-1419.781) (-1420.301) -- 0:00:35
572500 -- (-1419.004) [-1421.896] (-1418.283) (-1422.020) * (-1419.210) (-1418.753) [-1420.524] (-1419.718) -- 0:00:35
573000 -- (-1418.851) [-1418.978] (-1418.832) (-1424.061) * (-1418.610) (-1418.697) (-1420.268) [-1418.082] -- 0:00:35
573500 -- (-1420.651) (-1420.194) (-1420.816) [-1419.208] * (-1418.622) (-1418.167) [-1420.020] (-1418.852) -- 0:00:34
574000 -- (-1418.494) (-1423.958) [-1420.272] (-1419.873) * [-1419.763] (-1417.816) (-1421.073) (-1420.627) -- 0:00:34
574500 -- (-1420.002) (-1419.948) (-1419.887) [-1420.414] * (-1422.089) [-1419.807] (-1418.645) (-1422.322) -- 0:00:35
575000 -- (-1419.873) [-1419.515] (-1419.467) (-1418.143) * (-1418.439) [-1420.135] (-1419.482) (-1418.682) -- 0:00:35
Average standard deviation of split frequencies: 0.009773
575500 -- [-1418.678] (-1420.345) (-1421.978) (-1419.149) * (-1418.687) (-1422.342) (-1420.589) [-1418.313] -- 0:00:35
576000 -- (-1420.360) (-1422.509) (-1422.334) [-1420.348] * (-1420.294) [-1418.681] (-1421.557) (-1420.752) -- 0:00:35
576500 -- (-1424.404) (-1424.667) (-1421.552) [-1417.787] * (-1424.403) (-1418.911) [-1420.570] (-1420.755) -- 0:00:35
577000 -- (-1421.120) (-1425.700) (-1419.892) [-1417.952] * (-1420.856) (-1418.732) (-1420.366) [-1420.612] -- 0:00:35
577500 -- [-1419.123] (-1422.647) (-1419.294) (-1418.020) * (-1418.908) (-1420.186) (-1421.126) [-1420.223] -- 0:00:35
578000 -- (-1419.433) [-1421.306] (-1420.728) (-1421.715) * (-1421.777) (-1422.270) (-1424.170) [-1421.531] -- 0:00:35
578500 -- (-1418.523) (-1422.582) [-1420.285] (-1419.705) * (-1422.013) (-1420.049) (-1421.936) [-1426.416] -- 0:00:34
579000 -- (-1418.946) [-1420.230] (-1419.211) (-1421.434) * (-1420.908) [-1420.603] (-1419.099) (-1422.326) -- 0:00:34
579500 -- (-1418.958) [-1420.212] (-1425.067) (-1419.045) * (-1419.564) (-1421.944) [-1419.687] (-1422.364) -- 0:00:34
580000 -- (-1422.425) (-1422.223) [-1419.264] (-1419.533) * [-1420.797] (-1418.605) (-1423.699) (-1419.764) -- 0:00:34
Average standard deviation of split frequencies: 0.009408
580500 -- [-1419.153] (-1423.560) (-1420.124) (-1420.744) * [-1419.492] (-1421.135) (-1420.544) (-1418.631) -- 0:00:34
581000 -- [-1418.340] (-1424.216) (-1422.618) (-1420.095) * (-1420.377) [-1421.126] (-1421.562) (-1419.442) -- 0:00:34
581500 -- (-1418.512) [-1418.453] (-1419.633) (-1418.533) * (-1420.499) [-1422.102] (-1420.213) (-1420.002) -- 0:00:34
582000 -- (-1418.389) (-1419.160) [-1419.174] (-1418.119) * (-1422.406) (-1421.095) (-1420.057) [-1418.363] -- 0:00:34
582500 -- (-1419.588) (-1421.982) [-1420.506] (-1420.150) * (-1421.425) (-1419.146) (-1424.673) [-1418.286] -- 0:00:34
583000 -- [-1420.648] (-1419.967) (-1419.027) (-1420.664) * (-1420.377) (-1427.797) [-1423.913] (-1420.393) -- 0:00:34
583500 -- (-1420.324) (-1418.740) (-1418.079) [-1420.836] * (-1418.259) (-1424.243) [-1421.056] (-1422.421) -- 0:00:34
584000 -- (-1421.415) (-1419.938) [-1417.974] (-1420.625) * (-1418.238) (-1425.741) (-1418.481) [-1423.420] -- 0:00:34
584500 -- (-1420.102) [-1418.404] (-1418.199) (-1419.843) * [-1419.135] (-1418.843) (-1418.053) (-1423.186) -- 0:00:34
585000 -- (-1418.129) (-1420.286) (-1418.550) [-1419.235] * (-1418.793) (-1418.310) (-1418.372) [-1418.622] -- 0:00:34
Average standard deviation of split frequencies: 0.009748
585500 -- (-1418.127) (-1420.551) [-1418.356] (-1420.321) * [-1422.064] (-1418.205) (-1419.752) (-1421.491) -- 0:00:33
586000 -- [-1418.321] (-1419.065) (-1418.078) (-1418.068) * (-1421.767) (-1418.089) (-1420.323) [-1420.442] -- 0:00:33
586500 -- (-1421.765) (-1420.342) [-1425.693] (-1418.410) * (-1422.968) [-1418.170] (-1419.347) (-1420.579) -- 0:00:33
587000 -- (-1418.013) [-1420.754] (-1421.628) (-1418.157) * (-1420.354) (-1419.492) (-1419.724) [-1420.253] -- 0:00:34
587500 -- (-1419.269) [-1420.264] (-1420.777) (-1418.184) * [-1419.313] (-1420.959) (-1421.151) (-1419.832) -- 0:00:34
588000 -- (-1419.812) (-1420.520) [-1419.131] (-1419.393) * (-1420.035) (-1420.010) [-1421.764] (-1419.244) -- 0:00:34
588500 -- (-1420.144) (-1419.113) (-1417.689) [-1419.602] * (-1420.280) (-1422.031) (-1420.032) [-1421.462] -- 0:00:34
589000 -- (-1420.098) (-1421.136) [-1417.815] (-1420.491) * (-1418.697) (-1418.362) (-1421.814) [-1417.954] -- 0:00:34
589500 -- (-1418.407) [-1419.431] (-1417.825) (-1418.597) * (-1418.863) (-1421.106) (-1421.592) [-1419.793] -- 0:00:34
590000 -- [-1418.466] (-1418.662) (-1421.067) (-1419.155) * [-1420.842] (-1422.983) (-1420.545) (-1422.538) -- 0:00:34
Average standard deviation of split frequencies: 0.009624
590500 -- [-1418.682] (-1418.789) (-1419.722) (-1422.994) * [-1419.505] (-1421.786) (-1419.265) (-1422.947) -- 0:00:33
591000 -- [-1418.976] (-1418.983) (-1421.098) (-1418.653) * (-1419.890) (-1419.018) [-1420.286] (-1419.365) -- 0:00:33
591500 -- (-1419.283) (-1418.914) (-1425.401) [-1419.199] * [-1421.153] (-1418.493) (-1423.210) (-1421.513) -- 0:00:33
592000 -- (-1418.392) (-1421.252) (-1420.834) [-1421.488] * (-1420.676) [-1420.313] (-1418.988) (-1423.256) -- 0:00:33
592500 -- [-1418.212] (-1420.377) (-1419.063) (-1419.639) * (-1420.520) (-1423.419) (-1419.767) [-1421.067] -- 0:00:33
593000 -- [-1417.917] (-1421.845) (-1417.958) (-1420.468) * [-1419.910] (-1417.984) (-1421.199) (-1418.736) -- 0:00:33
593500 -- (-1419.644) (-1419.166) [-1418.340] (-1423.290) * (-1419.967) (-1422.225) [-1420.292] (-1420.272) -- 0:00:33
594000 -- (-1418.827) (-1419.231) (-1421.609) [-1420.084] * [-1419.590] (-1423.505) (-1419.840) (-1418.821) -- 0:00:33
594500 -- (-1418.217) [-1419.094] (-1420.922) (-1419.612) * (-1419.443) (-1419.066) [-1420.773] (-1418.993) -- 0:00:33
595000 -- (-1419.755) (-1419.206) [-1422.592] (-1420.694) * [-1421.477] (-1421.033) (-1421.011) (-1419.601) -- 0:00:33
Average standard deviation of split frequencies: 0.009305
595500 -- (-1418.690) [-1419.039] (-1418.914) (-1420.519) * (-1419.641) (-1423.857) [-1419.305] (-1422.057) -- 0:00:33
596000 -- (-1420.946) [-1421.081] (-1420.788) (-1422.296) * (-1419.385) (-1420.850) [-1419.380] (-1422.493) -- 0:00:33
596500 -- (-1419.052) (-1425.102) [-1419.043] (-1419.548) * [-1420.851] (-1424.260) (-1422.527) (-1420.603) -- 0:00:33
597000 -- (-1418.841) (-1419.306) [-1420.113] (-1418.709) * [-1417.901] (-1421.492) (-1420.449) (-1420.898) -- 0:00:33
597500 -- (-1420.668) [-1418.968] (-1419.021) (-1418.975) * [-1417.867] (-1419.635) (-1426.079) (-1422.975) -- 0:00:33
598000 -- (-1420.326) (-1418.359) [-1421.192] (-1422.565) * (-1420.153) (-1418.996) (-1419.213) [-1419.383] -- 0:00:32
598500 -- [-1420.326] (-1417.991) (-1420.893) (-1421.953) * (-1419.549) (-1420.833) (-1418.969) [-1424.928] -- 0:00:32
599000 -- (-1419.315) [-1417.991] (-1419.340) (-1420.422) * (-1418.837) (-1418.839) (-1419.372) [-1422.628] -- 0:00:32
599500 -- (-1422.063) (-1418.411) [-1419.840] (-1419.368) * (-1418.945) (-1418.753) [-1421.415] (-1420.280) -- 0:00:33
600000 -- [-1419.906] (-1421.173) (-1419.795) (-1420.564) * [-1419.352] (-1418.343) (-1419.544) (-1421.839) -- 0:00:33
Average standard deviation of split frequencies: 0.008771
600500 -- (-1419.269) [-1419.218] (-1422.111) (-1418.706) * (-1417.931) (-1420.509) [-1418.936] (-1421.920) -- 0:00:33
601000 -- (-1420.220) (-1419.446) [-1418.195] (-1418.853) * (-1417.918) (-1423.097) (-1420.624) [-1422.576] -- 0:00:33
601500 -- (-1421.722) (-1420.377) [-1420.793] (-1420.312) * [-1418.174] (-1418.886) (-1422.009) (-1418.564) -- 0:00:33
602000 -- [-1419.415] (-1419.405) (-1420.647) (-1426.075) * (-1419.118) (-1418.350) (-1420.193) [-1419.086] -- 0:00:33
602500 -- (-1418.334) [-1418.102] (-1421.309) (-1420.125) * (-1424.089) [-1420.165] (-1421.150) (-1418.805) -- 0:00:32
603000 -- (-1418.386) [-1418.382] (-1420.080) (-1420.745) * (-1421.891) (-1420.450) (-1418.984) [-1419.423] -- 0:00:32
603500 -- (-1418.470) (-1423.127) [-1418.150] (-1418.671) * (-1420.204) (-1418.373) (-1421.323) [-1420.950] -- 0:00:32
604000 -- (-1419.652) (-1424.289) [-1420.519] (-1418.641) * (-1422.025) (-1419.090) [-1420.724] (-1422.139) -- 0:00:32
604500 -- [-1419.375] (-1424.659) (-1421.227) (-1417.761) * (-1417.978) [-1421.773] (-1422.140) (-1424.786) -- 0:00:32
605000 -- [-1419.633] (-1422.484) (-1424.932) (-1419.654) * (-1418.481) (-1428.172) [-1418.698] (-1421.600) -- 0:00:32
Average standard deviation of split frequencies: 0.009289
605500 -- (-1421.436) (-1422.439) (-1424.605) [-1421.328] * (-1421.579) (-1423.690) (-1420.929) [-1419.776] -- 0:00:32
606000 -- (-1418.166) (-1425.431) [-1418.772] (-1427.164) * (-1419.261) (-1418.941) [-1422.165] (-1419.889) -- 0:00:32
606500 -- (-1418.302) (-1419.857) [-1418.106] (-1418.939) * [-1418.726] (-1422.537) (-1421.824) (-1419.127) -- 0:00:32
607000 -- (-1418.777) [-1420.378] (-1419.216) (-1419.790) * (-1423.066) (-1420.370) (-1419.844) [-1424.073] -- 0:00:32
607500 -- [-1417.871] (-1419.009) (-1418.780) (-1418.686) * [-1419.763] (-1420.628) (-1420.235) (-1420.781) -- 0:00:32
608000 -- [-1417.698] (-1418.261) (-1420.455) (-1418.628) * [-1418.615] (-1418.677) (-1419.927) (-1418.077) -- 0:00:32
608500 -- [-1417.867] (-1419.266) (-1420.386) (-1419.050) * (-1419.524) (-1419.029) (-1421.378) [-1420.898] -- 0:00:32
609000 -- (-1418.410) (-1424.259) (-1419.969) [-1417.852] * (-1419.101) [-1419.296] (-1418.668) (-1420.042) -- 0:00:32
609500 -- [-1417.833] (-1420.373) (-1424.035) (-1419.922) * (-1418.013) (-1419.393) [-1419.516] (-1419.207) -- 0:00:32
610000 -- (-1418.101) (-1421.198) (-1420.389) [-1419.143] * (-1418.458) [-1419.414] (-1418.218) (-1418.265) -- 0:00:31
Average standard deviation of split frequencies: 0.009627
610500 -- (-1420.091) (-1420.487) [-1420.031] (-1422.714) * [-1418.556] (-1419.912) (-1420.161) (-1419.387) -- 0:00:31
611000 -- (-1418.298) (-1419.732) [-1419.360] (-1419.740) * (-1419.787) (-1420.032) [-1420.202] (-1419.472) -- 0:00:31
611500 -- (-1422.027) (-1422.579) [-1420.077] (-1419.170) * (-1422.314) [-1422.297] (-1420.780) (-1419.528) -- 0:00:31
612000 -- (-1419.248) (-1420.483) (-1421.988) [-1420.417] * (-1418.810) (-1421.993) [-1418.181] (-1418.143) -- 0:00:32
612500 -- (-1419.139) [-1420.514] (-1422.970) (-1422.845) * [-1421.711] (-1419.292) (-1418.588) (-1418.150) -- 0:00:32
613000 -- (-1419.355) (-1419.981) (-1418.539) [-1420.000] * [-1419.026] (-1420.345) (-1419.673) (-1421.366) -- 0:00:32
613500 -- (-1423.615) (-1420.641) (-1420.559) [-1420.188] * [-1418.566] (-1419.365) (-1418.408) (-1420.042) -- 0:00:32
614000 -- (-1420.132) (-1420.710) [-1419.064] (-1421.626) * (-1418.913) [-1420.771] (-1418.439) (-1421.564) -- 0:00:32
614500 -- [-1420.333] (-1423.684) (-1419.898) (-1423.023) * (-1419.822) [-1420.512] (-1419.300) (-1419.826) -- 0:00:31
615000 -- (-1420.413) (-1422.683) [-1419.066] (-1420.113) * (-1419.914) (-1421.854) (-1418.120) [-1421.006] -- 0:00:31
Average standard deviation of split frequencies: 0.009588
615500 -- (-1422.392) (-1419.517) [-1417.678] (-1422.274) * (-1419.714) (-1424.746) (-1419.708) [-1422.688] -- 0:00:31
616000 -- [-1420.520] (-1420.618) (-1417.681) (-1420.356) * (-1419.499) (-1421.878) [-1420.119] (-1418.969) -- 0:00:31
616500 -- (-1420.891) [-1418.163] (-1417.666) (-1420.192) * [-1418.318] (-1426.846) (-1419.932) (-1419.741) -- 0:00:31
617000 -- (-1419.581) (-1419.072) [-1418.789] (-1420.607) * (-1418.890) (-1421.780) (-1419.995) [-1419.939] -- 0:00:31
617500 -- [-1418.325] (-1419.245) (-1418.929) (-1420.358) * (-1419.783) (-1419.040) [-1419.160] (-1420.324) -- 0:00:31
618000 -- (-1421.461) (-1418.490) [-1420.652] (-1419.573) * (-1420.126) [-1417.990] (-1418.489) (-1421.814) -- 0:00:31
618500 -- (-1422.575) [-1421.715] (-1418.918) (-1418.411) * (-1419.723) (-1424.743) [-1418.352] (-1420.475) -- 0:00:31
619000 -- [-1419.492] (-1422.250) (-1419.374) (-1421.965) * (-1420.188) [-1418.914] (-1419.465) (-1420.542) -- 0:00:31
619500 -- [-1418.655] (-1420.604) (-1421.236) (-1421.143) * [-1419.066] (-1419.206) (-1422.538) (-1419.645) -- 0:00:31
620000 -- (-1419.257) (-1420.806) (-1421.211) [-1419.433] * (-1419.258) [-1420.709] (-1422.795) (-1419.673) -- 0:00:31
Average standard deviation of split frequencies: 0.009829
620500 -- (-1421.553) (-1420.462) (-1420.086) [-1421.090] * (-1419.279) (-1420.147) [-1419.017] (-1424.392) -- 0:00:31
621000 -- (-1419.060) (-1419.723) (-1418.984) [-1419.721] * (-1418.800) [-1420.304] (-1420.384) (-1418.882) -- 0:00:31
621500 -- (-1418.471) (-1418.929) (-1419.316) [-1418.831] * (-1420.130) (-1420.351) [-1419.365] (-1418.976) -- 0:00:31
622000 -- (-1420.242) (-1418.853) (-1421.015) [-1421.291] * [-1419.586] (-1419.438) (-1421.605) (-1419.086) -- 0:00:30
622500 -- (-1421.267) (-1418.948) (-1422.523) [-1421.899] * (-1423.383) [-1419.303] (-1423.125) (-1419.841) -- 0:00:30
623000 -- (-1422.500) [-1419.003] (-1418.529) (-1423.857) * (-1421.316) (-1421.916) (-1422.543) [-1419.951] -- 0:00:30
623500 -- (-1419.101) (-1419.293) (-1422.454) [-1418.410] * [-1419.468] (-1419.468) (-1419.873) (-1420.784) -- 0:00:30
624000 -- [-1419.311] (-1420.240) (-1422.398) (-1418.997) * [-1419.108] (-1419.661) (-1418.950) (-1420.264) -- 0:00:30
624500 -- (-1425.438) (-1422.245) (-1418.247) [-1418.406] * (-1420.629) (-1419.292) (-1418.805) [-1418.971] -- 0:00:31
625000 -- (-1418.733) (-1425.370) (-1418.197) [-1419.504] * (-1421.515) (-1419.866) (-1421.861) [-1417.961] -- 0:00:31
Average standard deviation of split frequencies: 0.009834
625500 -- [-1419.129] (-1422.577) (-1418.789) (-1420.963) * (-1422.990) (-1417.799) (-1419.348) [-1418.595] -- 0:00:31
626000 -- [-1420.468] (-1421.208) (-1419.768) (-1420.680) * [-1418.959] (-1418.749) (-1422.028) (-1421.344) -- 0:00:31
626500 -- [-1421.675] (-1419.521) (-1424.456) (-1422.261) * (-1418.551) (-1418.778) (-1419.229) [-1421.562] -- 0:00:31
627000 -- (-1424.861) (-1419.065) (-1419.621) [-1425.404] * [-1418.568] (-1417.787) (-1418.165) (-1420.960) -- 0:00:30
627500 -- [-1422.483] (-1419.373) (-1419.533) (-1420.237) * (-1420.192) (-1418.373) [-1418.362] (-1420.962) -- 0:00:30
628000 -- (-1429.010) [-1420.880] (-1421.170) (-1420.695) * (-1420.902) [-1420.823] (-1419.577) (-1419.320) -- 0:00:30
628500 -- (-1419.579) [-1420.341] (-1420.948) (-1421.822) * (-1421.904) (-1419.198) [-1418.565] (-1419.361) -- 0:00:30
629000 -- (-1422.408) (-1418.218) (-1420.312) [-1420.195] * (-1422.945) (-1417.932) (-1420.645) [-1421.019] -- 0:00:30
629500 -- (-1419.000) (-1418.275) (-1420.391) [-1420.276] * (-1418.414) (-1418.429) [-1421.863] (-1423.871) -- 0:00:30
630000 -- [-1422.935] (-1418.785) (-1418.588) (-1419.324) * (-1418.980) (-1420.553) [-1422.280] (-1425.839) -- 0:00:30
Average standard deviation of split frequencies: 0.009541
630500 -- [-1418.492] (-1420.458) (-1420.664) (-1419.966) * (-1418.334) [-1419.029] (-1419.130) (-1422.923) -- 0:00:30
631000 -- (-1418.596) (-1420.451) [-1420.373] (-1418.486) * [-1418.369] (-1421.276) (-1423.919) (-1419.096) -- 0:00:30
631500 -- [-1418.823] (-1420.377) (-1420.130) (-1421.055) * (-1419.328) (-1422.332) (-1422.699) [-1419.484] -- 0:00:30
632000 -- (-1420.597) [-1418.126] (-1421.422) (-1420.456) * (-1419.432) (-1419.787) (-1424.681) [-1419.628] -- 0:00:30
632500 -- (-1424.602) (-1422.210) [-1418.943] (-1419.223) * (-1419.891) [-1419.665] (-1426.914) (-1420.179) -- 0:00:30
633000 -- (-1418.015) (-1423.576) [-1420.082] (-1423.086) * [-1419.642] (-1420.929) (-1421.318) (-1420.140) -- 0:00:30
633500 -- (-1420.187) [-1419.185] (-1423.640) (-1421.162) * (-1419.559) (-1421.526) (-1419.593) [-1418.778] -- 0:00:30
634000 -- (-1419.629) [-1418.917] (-1421.371) (-1418.602) * [-1419.920] (-1419.625) (-1420.732) (-1418.990) -- 0:00:30
634500 -- [-1419.531] (-1420.507) (-1421.748) (-1421.304) * (-1426.702) (-1421.744) (-1420.694) [-1419.252] -- 0:00:29
635000 -- [-1418.356] (-1422.117) (-1420.695) (-1419.560) * [-1421.766] (-1418.888) (-1420.418) (-1420.761) -- 0:00:29
Average standard deviation of split frequencies: 0.009592
635500 -- [-1418.344] (-1422.592) (-1420.088) (-1419.179) * (-1422.376) [-1418.969] (-1424.435) (-1418.644) -- 0:00:29
636000 -- [-1422.226] (-1417.802) (-1420.355) (-1419.243) * (-1419.206) [-1419.745] (-1421.904) (-1418.553) -- 0:00:29
636500 -- [-1421.313] (-1419.035) (-1422.752) (-1420.210) * [-1418.943] (-1419.068) (-1418.187) (-1423.671) -- 0:00:29
637000 -- (-1419.897) (-1422.720) (-1422.836) [-1419.798] * [-1418.218] (-1418.699) (-1419.920) (-1419.145) -- 0:00:30
637500 -- (-1421.015) [-1424.293] (-1421.089) (-1420.022) * (-1418.218) [-1419.294] (-1419.589) (-1419.818) -- 0:00:30
638000 -- (-1419.446) (-1421.140) (-1417.715) [-1418.401] * (-1419.827) [-1418.685] (-1419.688) (-1419.145) -- 0:00:30
638500 -- (-1418.480) (-1420.302) (-1424.340) [-1419.772] * [-1419.311] (-1418.464) (-1423.048) (-1422.453) -- 0:00:30
639000 -- (-1420.880) [-1420.182] (-1424.257) (-1418.263) * [-1419.659] (-1419.205) (-1424.725) (-1422.440) -- 0:00:29
639500 -- [-1419.969] (-1423.181) (-1425.166) (-1422.325) * (-1419.171) [-1420.536] (-1419.215) (-1422.316) -- 0:00:29
640000 -- [-1420.290] (-1417.764) (-1422.118) (-1419.644) * (-1420.630) (-1419.986) [-1422.817] (-1423.457) -- 0:00:29
Average standard deviation of split frequencies: 0.009609
640500 -- [-1422.485] (-1419.059) (-1425.419) (-1419.146) * (-1420.928) [-1419.490] (-1420.651) (-1419.133) -- 0:00:29
641000 -- (-1418.177) (-1423.096) (-1418.490) [-1419.400] * (-1420.617) (-1419.938) (-1420.156) [-1418.743] -- 0:00:29
641500 -- [-1418.729] (-1418.998) (-1419.301) (-1423.231) * (-1424.130) (-1424.778) (-1421.507) [-1419.138] -- 0:00:29
642000 -- [-1419.065] (-1419.590) (-1418.802) (-1421.809) * (-1424.089) (-1420.264) (-1425.818) [-1417.775] -- 0:00:29
642500 -- (-1423.701) (-1420.766) (-1418.258) [-1424.110] * [-1419.339] (-1418.018) (-1426.911) (-1419.003) -- 0:00:29
643000 -- [-1418.747] (-1419.945) (-1419.025) (-1422.176) * [-1418.936] (-1418.758) (-1419.423) (-1419.081) -- 0:00:29
643500 -- (-1420.220) (-1421.549) (-1423.970) [-1420.069] * [-1420.897] (-1419.168) (-1420.027) (-1419.801) -- 0:00:29
644000 -- (-1421.941) (-1419.362) [-1424.358] (-1422.190) * (-1418.468) (-1419.409) (-1421.844) [-1420.046] -- 0:00:29
644500 -- (-1422.249) [-1418.375] (-1418.378) (-1424.394) * (-1419.863) (-1417.485) (-1418.326) [-1419.472] -- 0:00:29
645000 -- (-1421.268) (-1418.102) [-1420.767] (-1418.811) * (-1424.870) (-1417.484) [-1418.015] (-1420.410) -- 0:00:29
Average standard deviation of split frequencies: 0.009959
645500 -- (-1422.017) (-1418.102) [-1422.873] (-1420.245) * (-1421.138) [-1417.997] (-1421.443) (-1420.933) -- 0:00:29
646000 -- (-1421.130) (-1418.055) [-1418.129] (-1420.814) * [-1417.876] (-1419.440) (-1423.883) (-1419.442) -- 0:00:29
646500 -- (-1419.775) [-1418.098] (-1418.440) (-1419.738) * (-1417.938) (-1418.114) (-1424.824) [-1419.733] -- 0:00:28
647000 -- (-1421.103) [-1418.391] (-1419.519) (-1418.883) * (-1425.018) (-1418.646) [-1420.099] (-1423.917) -- 0:00:28
647500 -- (-1417.712) [-1418.580] (-1421.835) (-1419.071) * (-1420.303) (-1420.676) [-1419.428] (-1423.914) -- 0:00:28
648000 -- [-1417.761] (-1421.817) (-1423.683) (-1421.455) * [-1420.133] (-1425.697) (-1420.663) (-1421.435) -- 0:00:28
648500 -- [-1419.288] (-1422.074) (-1423.844) (-1420.171) * (-1419.937) (-1424.683) (-1420.112) [-1421.221] -- 0:00:28
649000 -- (-1419.629) (-1423.791) (-1420.258) [-1418.690] * [-1420.429] (-1419.350) (-1418.466) (-1423.711) -- 0:00:28
649500 -- (-1420.157) [-1422.132] (-1421.319) (-1418.254) * [-1420.011] (-1421.762) (-1419.608) (-1422.264) -- 0:00:28
650000 -- (-1418.842) (-1419.609) (-1424.653) [-1418.328] * (-1419.037) (-1421.413) (-1419.938) [-1423.451] -- 0:00:29
Average standard deviation of split frequencies: 0.009546
650500 -- [-1418.599] (-1419.183) (-1420.643) (-1418.283) * (-1421.093) (-1422.692) [-1420.164] (-1428.699) -- 0:00:29
651000 -- (-1417.659) (-1418.570) [-1417.753] (-1424.530) * [-1419.263] (-1422.331) (-1419.167) (-1419.683) -- 0:00:28
651500 -- (-1419.446) (-1420.244) (-1419.148) [-1426.300] * (-1420.542) (-1421.095) [-1420.967] (-1420.102) -- 0:00:28
652000 -- [-1418.311] (-1422.794) (-1417.923) (-1423.019) * (-1420.138) (-1422.841) [-1421.013] (-1422.166) -- 0:00:28
652500 -- (-1420.852) (-1418.508) [-1423.487] (-1423.658) * (-1420.860) (-1428.888) [-1420.321] (-1421.250) -- 0:00:28
653000 -- (-1418.094) (-1420.344) (-1421.609) [-1420.211] * (-1421.349) [-1420.830] (-1419.678) (-1421.069) -- 0:00:28
653500 -- (-1418.834) (-1420.787) [-1419.796] (-1419.090) * (-1420.799) (-1420.396) [-1423.138] (-1418.170) -- 0:00:28
654000 -- [-1418.657] (-1422.536) (-1419.435) (-1418.527) * (-1420.144) (-1419.776) (-1418.834) [-1421.275] -- 0:00:28
654500 -- (-1420.203) (-1420.785) [-1418.923] (-1422.842) * (-1418.277) (-1418.375) [-1418.907] (-1423.146) -- 0:00:28
655000 -- (-1418.820) [-1418.813] (-1417.976) (-1421.165) * (-1418.459) (-1418.420) (-1422.295) [-1419.491] -- 0:00:28
Average standard deviation of split frequencies: 0.008877
655500 -- (-1420.583) [-1418.807] (-1419.382) (-1423.385) * [-1418.963] (-1424.023) (-1422.779) (-1423.370) -- 0:00:28
656000 -- (-1421.267) (-1419.359) [-1423.172] (-1423.182) * (-1418.687) (-1420.077) (-1418.838) [-1419.764] -- 0:00:28
656500 -- [-1421.358] (-1420.074) (-1419.383) (-1423.468) * (-1420.136) (-1424.339) [-1418.614] (-1420.487) -- 0:00:28
657000 -- [-1426.358] (-1421.738) (-1419.102) (-1423.357) * [-1419.050] (-1419.015) (-1426.759) (-1420.704) -- 0:00:28
657500 -- (-1418.463) [-1422.053] (-1423.720) (-1421.233) * (-1418.678) [-1419.952] (-1419.057) (-1419.858) -- 0:00:28
658000 -- [-1419.662] (-1419.046) (-1420.939) (-1419.323) * (-1421.585) (-1422.308) [-1419.057] (-1419.341) -- 0:00:28
658500 -- (-1422.953) [-1418.774] (-1418.692) (-1419.323) * [-1419.548] (-1419.150) (-1419.497) (-1420.570) -- 0:00:28
659000 -- [-1417.835] (-1419.114) (-1426.346) (-1418.139) * [-1421.000] (-1419.200) (-1423.367) (-1420.331) -- 0:00:27
659500 -- [-1421.836] (-1419.931) (-1419.294) (-1419.139) * [-1421.168] (-1418.815) (-1421.077) (-1420.308) -- 0:00:27
660000 -- [-1418.379] (-1421.628) (-1419.390) (-1419.857) * (-1418.904) [-1419.312] (-1419.025) (-1418.305) -- 0:00:27
Average standard deviation of split frequencies: 0.008940
660500 -- (-1418.975) (-1420.082) [-1418.224] (-1422.632) * (-1419.340) (-1418.904) [-1426.225] (-1418.560) -- 0:00:27
661000 -- (-1419.416) (-1420.449) [-1418.264] (-1419.857) * (-1423.506) (-1422.179) (-1419.646) [-1419.525] -- 0:00:27
661500 -- (-1419.226) (-1420.028) (-1419.743) [-1419.330] * (-1423.196) (-1418.291) [-1418.512] (-1421.170) -- 0:00:27
662000 -- [-1420.376] (-1419.937) (-1419.493) (-1421.865) * (-1420.567) [-1418.574] (-1419.777) (-1421.995) -- 0:00:28
662500 -- (-1424.298) (-1418.823) (-1417.874) [-1420.151] * (-1420.828) [-1418.944] (-1423.235) (-1418.878) -- 0:00:28
663000 -- (-1421.051) (-1418.823) [-1418.940] (-1418.965) * [-1420.748] (-1418.818) (-1421.221) (-1419.192) -- 0:00:27
663500 -- (-1420.144) [-1420.559] (-1420.055) (-1422.456) * (-1418.478) [-1418.007] (-1422.493) (-1418.825) -- 0:00:27
664000 -- (-1421.421) [-1419.683] (-1419.804) (-1420.040) * (-1419.235) (-1419.592) (-1420.119) [-1418.002] -- 0:00:27
664500 -- (-1420.020) [-1420.330] (-1419.313) (-1420.894) * (-1421.696) (-1421.897) [-1422.530] (-1418.018) -- 0:00:27
665000 -- [-1422.146] (-1418.429) (-1419.769) (-1422.628) * (-1422.228) (-1418.293) (-1420.407) [-1418.118] -- 0:00:27
Average standard deviation of split frequencies: 0.009202
665500 -- (-1420.153) [-1419.694] (-1424.214) (-1420.135) * (-1422.052) [-1418.920] (-1418.667) (-1419.735) -- 0:00:27
666000 -- (-1421.369) [-1419.621] (-1421.122) (-1423.163) * (-1418.703) (-1419.917) (-1421.814) [-1418.936] -- 0:00:27
666500 -- (-1420.261) (-1419.029) [-1420.393] (-1419.299) * [-1420.211] (-1420.164) (-1422.256) (-1417.726) -- 0:00:27
667000 -- (-1419.299) (-1420.059) [-1422.334] (-1418.620) * (-1419.835) [-1419.660] (-1419.674) (-1417.857) -- 0:00:27
667500 -- (-1418.324) (-1419.733) [-1419.760] (-1418.918) * (-1420.703) (-1421.709) (-1423.343) [-1418.633] -- 0:00:27
668000 -- [-1418.531] (-1419.247) (-1419.909) (-1418.288) * (-1419.775) [-1419.419] (-1425.149) (-1423.851) -- 0:00:27
668500 -- (-1419.180) (-1420.129) (-1420.034) [-1418.466] * (-1419.623) (-1426.531) (-1420.260) [-1421.820] -- 0:00:27
669000 -- (-1421.167) (-1420.875) (-1419.251) [-1420.129] * (-1420.045) [-1427.731] (-1421.286) (-1420.160) -- 0:00:27
669500 -- (-1425.493) (-1421.699) (-1424.096) [-1418.242] * [-1419.582] (-1428.504) (-1422.058) (-1419.224) -- 0:00:27
670000 -- (-1422.860) (-1421.212) (-1425.707) [-1417.858] * [-1417.863] (-1420.316) (-1421.443) (-1420.352) -- 0:00:27
Average standard deviation of split frequencies: 0.009014
670500 -- [-1418.551] (-1419.146) (-1421.488) (-1422.186) * [-1418.584] (-1422.280) (-1422.483) (-1423.883) -- 0:00:27
671000 -- (-1419.127) (-1422.366) (-1420.400) [-1420.034] * [-1419.545] (-1422.535) (-1425.749) (-1420.160) -- 0:00:26
671500 -- (-1419.542) [-1421.001] (-1422.313) (-1421.654) * [-1421.602] (-1419.757) (-1417.843) (-1418.541) -- 0:00:26
672000 -- [-1418.913] (-1419.339) (-1421.364) (-1421.131) * (-1418.741) (-1425.983) (-1420.495) [-1419.040] -- 0:00:26
672500 -- [-1419.798] (-1419.700) (-1418.439) (-1424.283) * [-1419.650] (-1421.339) (-1419.322) (-1420.928) -- 0:00:26
673000 -- [-1419.807] (-1418.188) (-1418.250) (-1419.642) * [-1419.725] (-1422.573) (-1418.876) (-1424.727) -- 0:00:26
673500 -- [-1419.305] (-1418.252) (-1419.163) (-1419.694) * (-1418.242) [-1419.060] (-1418.525) (-1420.666) -- 0:00:26
674000 -- (-1419.065) (-1421.357) [-1418.598] (-1419.487) * (-1420.310) (-1419.330) (-1418.637) [-1421.094] -- 0:00:26
674500 -- (-1418.362) (-1419.411) [-1419.416] (-1421.705) * [-1420.073] (-1419.847) (-1422.962) (-1418.216) -- 0:00:26
675000 -- (-1421.158) [-1420.796] (-1421.846) (-1421.591) * (-1419.740) (-1420.319) (-1419.185) [-1420.010] -- 0:00:26
Average standard deviation of split frequencies: 0.008901
675500 -- [-1420.422] (-1419.463) (-1420.874) (-1420.349) * (-1421.620) (-1420.641) [-1419.119] (-1420.842) -- 0:00:26
676000 -- (-1420.561) (-1418.566) (-1426.547) [-1417.942] * (-1418.042) [-1421.864] (-1418.292) (-1421.634) -- 0:00:26
676500 -- (-1420.969) (-1420.601) (-1421.848) [-1419.181] * (-1419.431) (-1421.678) [-1419.820] (-1420.731) -- 0:00:26
677000 -- (-1418.695) [-1421.047] (-1419.655) (-1418.381) * (-1419.923) (-1420.198) (-1419.735) [-1419.395] -- 0:00:26
677500 -- [-1419.567] (-1420.607) (-1418.213) (-1421.217) * (-1420.257) [-1421.854] (-1419.375) (-1418.250) -- 0:00:26
678000 -- (-1421.221) [-1419.524] (-1418.802) (-1419.199) * (-1417.957) (-1420.666) [-1419.363] (-1419.559) -- 0:00:26
678500 -- (-1420.229) (-1418.819) (-1417.687) [-1420.780] * (-1418.436) [-1420.270] (-1418.451) (-1420.150) -- 0:00:26
679000 -- [-1419.185] (-1420.696) (-1418.208) (-1421.367) * [-1421.692] (-1418.901) (-1421.772) (-1418.366) -- 0:00:26
679500 -- (-1420.169) (-1420.113) [-1419.646] (-1421.024) * (-1419.422) [-1418.863] (-1420.910) (-1419.231) -- 0:00:26
680000 -- (-1423.850) [-1420.792] (-1418.178) (-1419.123) * [-1418.367] (-1419.263) (-1419.870) (-1420.224) -- 0:00:26
Average standard deviation of split frequencies: 0.008744
680500 -- (-1420.907) (-1419.518) (-1418.507) [-1418.925] * (-1419.192) (-1419.753) (-1421.071) [-1418.957] -- 0:00:26
681000 -- (-1419.661) [-1420.247] (-1419.490) (-1421.335) * (-1419.071) (-1424.173) (-1420.073) [-1420.758] -- 0:00:26
681500 -- (-1419.656) (-1420.220) (-1421.482) [-1418.988] * [-1418.881] (-1421.609) (-1418.026) (-1420.334) -- 0:00:26
682000 -- [-1419.408] (-1420.509) (-1420.174) (-1421.121) * [-1420.305] (-1419.101) (-1420.303) (-1420.464) -- 0:00:26
682500 -- (-1421.841) (-1418.894) [-1420.691] (-1420.972) * [-1420.188] (-1419.809) (-1422.740) (-1418.913) -- 0:00:26
683000 -- (-1417.923) (-1420.276) (-1428.079) [-1422.561] * (-1420.267) [-1418.883] (-1422.448) (-1419.321) -- 0:00:25
683500 -- (-1418.353) (-1422.057) (-1419.743) [-1422.032] * [-1418.877] (-1419.743) (-1421.749) (-1420.314) -- 0:00:25
684000 -- [-1418.044] (-1419.937) (-1421.015) (-1421.457) * (-1419.358) (-1418.835) (-1421.105) [-1419.332] -- 0:00:25
684500 -- (-1418.473) (-1419.708) [-1422.133] (-1419.180) * (-1420.244) (-1423.486) [-1421.760] (-1420.506) -- 0:00:25
685000 -- (-1423.020) (-1423.348) (-1424.472) [-1420.460] * (-1420.370) (-1424.812) (-1424.785) [-1418.275] -- 0:00:25
Average standard deviation of split frequencies: 0.008367
685500 -- (-1420.171) [-1419.072] (-1417.917) (-1419.391) * (-1420.884) [-1419.207] (-1425.837) (-1418.070) -- 0:00:25
686000 -- (-1421.060) (-1418.378) [-1419.857] (-1420.670) * (-1419.277) [-1420.115] (-1420.998) (-1419.785) -- 0:00:25
686500 -- (-1419.295) (-1422.710) [-1420.281] (-1419.761) * (-1420.536) [-1419.315] (-1420.198) (-1419.236) -- 0:00:25
687000 -- (-1419.187) (-1418.769) [-1419.612] (-1421.892) * (-1421.908) (-1419.622) (-1422.528) [-1420.068] -- 0:00:25
687500 -- (-1420.086) (-1418.351) [-1418.861] (-1420.223) * (-1422.566) (-1421.045) [-1420.195] (-1419.828) -- 0:00:25
688000 -- (-1420.108) [-1418.351] (-1420.333) (-1421.583) * (-1418.840) [-1418.453] (-1421.358) (-1420.540) -- 0:00:25
688500 -- (-1422.451) [-1419.155] (-1418.422) (-1421.188) * (-1418.826) (-1423.120) [-1419.097] (-1418.603) -- 0:00:25
689000 -- (-1420.498) [-1418.764] (-1417.989) (-1420.294) * (-1418.491) (-1425.094) [-1420.249] (-1419.962) -- 0:00:25
689500 -- [-1420.125] (-1425.292) (-1417.805) (-1419.015) * (-1418.096) (-1422.014) [-1420.956] (-1417.676) -- 0:00:25
690000 -- (-1420.732) (-1421.539) (-1418.407) [-1418.429] * [-1420.115] (-1421.272) (-1419.962) (-1418.123) -- 0:00:25
Average standard deviation of split frequencies: 0.006996
690500 -- (-1418.698) (-1420.025) (-1419.748) [-1420.243] * [-1417.942] (-1422.912) (-1418.492) (-1421.533) -- 0:00:25
691000 -- (-1419.223) [-1418.702] (-1419.675) (-1418.803) * (-1418.094) [-1421.523] (-1421.841) (-1421.840) -- 0:00:25
691500 -- (-1419.365) (-1419.248) [-1419.707] (-1420.487) * (-1419.141) (-1420.197) [-1422.172] (-1419.225) -- 0:00:25
692000 -- (-1418.747) [-1419.028] (-1420.612) (-1420.245) * (-1420.347) [-1421.286] (-1423.029) (-1419.416) -- 0:00:25
692500 -- (-1418.556) [-1417.634] (-1420.716) (-1419.153) * [-1419.118] (-1417.629) (-1418.116) (-1420.719) -- 0:00:25
693000 -- (-1419.550) [-1417.693] (-1419.389) (-1420.981) * (-1418.036) (-1417.624) [-1419.073] (-1420.176) -- 0:00:25
693500 -- (-1419.830) (-1418.236) [-1420.542] (-1421.370) * (-1418.120) [-1417.714] (-1418.234) (-1420.162) -- 0:00:25
694000 -- (-1421.060) (-1418.766) [-1420.203] (-1419.917) * (-1419.210) (-1417.714) [-1418.970] (-1418.942) -- 0:00:25
694500 -- (-1423.658) (-1424.617) (-1423.202) [-1419.211] * (-1419.961) (-1418.771) (-1424.484) [-1420.870] -- 0:00:25
695000 -- [-1420.909] (-1418.112) (-1422.169) (-1420.812) * (-1419.298) [-1417.866] (-1419.616) (-1420.519) -- 0:00:25
Average standard deviation of split frequencies: 0.006773
695500 -- [-1419.973] (-1418.539) (-1418.139) (-1419.456) * (-1420.500) (-1420.983) (-1422.976) [-1423.181] -- 0:00:24
696000 -- (-1420.448) [-1419.500] (-1418.511) (-1419.674) * (-1422.179) (-1417.680) [-1420.308] (-1419.907) -- 0:00:24
696500 -- [-1419.178] (-1419.207) (-1418.026) (-1420.859) * (-1424.915) (-1419.458) [-1419.459] (-1421.275) -- 0:00:24
697000 -- [-1418.920] (-1419.676) (-1418.091) (-1419.256) * (-1420.518) [-1419.365] (-1422.601) (-1424.338) -- 0:00:24
697500 -- [-1419.649] (-1421.931) (-1418.644) (-1420.285) * (-1418.438) [-1419.196] (-1421.749) (-1419.563) -- 0:00:24
698000 -- (-1419.824) [-1422.742] (-1418.679) (-1420.199) * (-1418.481) (-1422.356) (-1420.879) [-1418.476] -- 0:00:24
698500 -- (-1426.713) (-1419.329) (-1420.478) [-1422.551] * [-1423.699] (-1419.848) (-1422.727) (-1418.120) -- 0:00:24
699000 -- (-1422.972) (-1419.258) (-1419.674) [-1423.868] * [-1422.455] (-1419.152) (-1419.743) (-1419.518) -- 0:00:24
699500 -- (-1423.567) [-1418.956] (-1420.381) (-1419.174) * (-1423.128) [-1420.558] (-1419.138) (-1418.615) -- 0:00:24
700000 -- (-1420.157) (-1420.453) (-1420.186) [-1418.681] * (-1422.842) [-1420.355] (-1421.295) (-1422.551) -- 0:00:24
Average standard deviation of split frequencies: 0.007779
700500 -- (-1420.035) (-1422.053) [-1418.358] (-1419.954) * [-1419.534] (-1421.815) (-1418.977) (-1421.177) -- 0:00:24
701000 -- (-1423.310) [-1419.097] (-1420.061) (-1421.736) * (-1418.204) (-1422.788) (-1418.021) [-1424.730] -- 0:00:24
701500 -- [-1422.331] (-1419.332) (-1420.093) (-1421.430) * (-1422.686) (-1419.574) [-1418.394] (-1424.920) -- 0:00:24
702000 -- (-1418.906) [-1419.560] (-1420.183) (-1419.549) * (-1419.038) (-1423.451) [-1420.854] (-1421.598) -- 0:00:24
702500 -- (-1419.818) [-1423.188] (-1418.949) (-1418.518) * (-1418.381) (-1421.106) [-1421.463] (-1420.946) -- 0:00:24
703000 -- (-1420.194) (-1423.276) (-1424.112) [-1418.570] * (-1425.748) (-1419.192) (-1419.994) [-1422.579] -- 0:00:24
703500 -- (-1419.728) [-1418.926] (-1423.296) (-1419.148) * [-1420.741] (-1419.044) (-1419.036) (-1418.332) -- 0:00:24
704000 -- [-1418.266] (-1419.015) (-1423.553) (-1418.728) * [-1420.284] (-1418.251) (-1420.994) (-1422.231) -- 0:00:24
704500 -- [-1418.661] (-1419.025) (-1420.779) (-1419.836) * (-1421.363) (-1419.272) [-1420.327] (-1419.342) -- 0:00:24
705000 -- [-1418.712] (-1421.307) (-1420.190) (-1419.852) * (-1420.309) [-1420.322] (-1418.007) (-1419.300) -- 0:00:24
Average standard deviation of split frequencies: 0.007934
705500 -- (-1422.153) [-1419.191] (-1418.825) (-1420.101) * (-1420.797) [-1420.486] (-1418.752) (-1421.347) -- 0:00:24
706000 -- (-1423.108) (-1418.848) (-1418.275) [-1419.415] * [-1419.560] (-1419.266) (-1419.401) (-1422.016) -- 0:00:24
706500 -- (-1425.192) (-1419.273) [-1421.010] (-1418.084) * (-1422.982) (-1419.086) [-1421.150] (-1422.908) -- 0:00:24
707000 -- (-1420.483) (-1419.935) (-1422.529) [-1417.865] * (-1419.144) (-1418.965) [-1420.520] (-1420.462) -- 0:00:24
707500 -- (-1420.180) (-1419.334) (-1423.108) [-1420.232] * [-1419.826] (-1418.529) (-1421.494) (-1420.284) -- 0:00:23
708000 -- [-1421.136] (-1420.493) (-1423.622) (-1419.306) * (-1419.641) (-1418.443) (-1419.571) [-1419.555] -- 0:00:23
708500 -- (-1423.530) [-1418.969] (-1420.385) (-1420.153) * [-1420.063] (-1420.240) (-1420.130) (-1419.595) -- 0:00:23
709000 -- (-1419.885) [-1418.816] (-1418.358) (-1419.638) * [-1418.442] (-1420.861) (-1420.218) (-1418.860) -- 0:00:23
709500 -- [-1420.283] (-1420.189) (-1417.817) (-1418.076) * (-1419.670) [-1421.509] (-1417.928) (-1422.026) -- 0:00:23
710000 -- (-1419.323) [-1420.122] (-1417.817) (-1418.371) * (-1420.366) [-1421.455] (-1420.052) (-1418.420) -- 0:00:23
Average standard deviation of split frequencies: 0.007882
710500 -- (-1418.092) (-1419.722) [-1418.657] (-1420.336) * (-1422.651) (-1419.912) [-1420.114] (-1419.928) -- 0:00:23
711000 -- (-1418.861) (-1417.927) [-1419.835] (-1420.870) * [-1420.317] (-1421.672) (-1419.796) (-1421.810) -- 0:00:23
711500 -- (-1420.047) [-1418.715] (-1423.074) (-1421.142) * [-1419.603] (-1418.609) (-1422.555) (-1421.949) -- 0:00:23
712000 -- (-1419.381) [-1419.565] (-1421.080) (-1421.520) * (-1421.044) [-1422.005] (-1420.339) (-1426.131) -- 0:00:23
712500 -- (-1418.483) (-1420.804) [-1420.720] (-1418.333) * (-1422.917) (-1422.831) [-1419.314] (-1424.257) -- 0:00:23
713000 -- (-1421.238) [-1418.711] (-1423.396) (-1419.108) * [-1420.635] (-1425.299) (-1420.659) (-1420.099) -- 0:00:23
713500 -- (-1418.354) [-1419.537] (-1420.571) (-1420.783) * (-1427.296) [-1425.475] (-1420.361) (-1419.840) -- 0:00:23
714000 -- (-1427.786) (-1420.593) (-1420.657) [-1421.158] * (-1420.726) [-1421.946] (-1420.507) (-1420.143) -- 0:00:23
714500 -- (-1420.874) (-1419.836) (-1421.600) [-1419.398] * [-1422.803] (-1428.169) (-1421.976) (-1421.232) -- 0:00:23
715000 -- (-1422.520) [-1420.974] (-1420.518) (-1418.170) * (-1421.596) (-1419.489) [-1419.670] (-1421.817) -- 0:00:23
Average standard deviation of split frequencies: 0.007983
715500 -- (-1418.181) (-1420.991) (-1420.518) [-1418.853] * (-1419.261) (-1420.559) (-1418.999) [-1419.679] -- 0:00:23
716000 -- (-1423.187) (-1419.217) (-1424.435) [-1419.981] * (-1419.409) (-1422.448) (-1420.259) [-1418.571] -- 0:00:23
716500 -- (-1419.588) (-1419.823) [-1418.529] (-1420.478) * [-1419.893] (-1421.075) (-1418.259) (-1422.082) -- 0:00:23
717000 -- (-1421.637) (-1419.144) (-1420.378) [-1418.879] * (-1419.228) (-1422.429) (-1419.385) [-1419.589] -- 0:00:23
717500 -- (-1418.202) (-1422.497) (-1420.867) [-1422.183] * (-1418.442) [-1419.051] (-1420.016) (-1422.493) -- 0:00:23
718000 -- [-1421.943] (-1421.797) (-1418.268) (-1420.183) * (-1419.563) [-1419.188] (-1423.741) (-1418.483) -- 0:00:23
718500 -- (-1418.703) [-1420.169] (-1418.735) (-1419.828) * (-1418.464) (-1423.012) (-1423.607) [-1419.740] -- 0:00:23
719000 -- (-1418.493) [-1422.905] (-1419.876) (-1419.574) * (-1421.346) (-1419.834) [-1421.231] (-1420.626) -- 0:00:23
719500 -- [-1418.377] (-1420.540) (-1421.270) (-1420.689) * [-1424.788] (-1419.586) (-1417.918) (-1420.565) -- 0:00:23
720000 -- (-1418.793) (-1422.653) [-1418.496] (-1419.435) * [-1420.922] (-1419.154) (-1422.094) (-1418.519) -- 0:00:22
Average standard deviation of split frequencies: 0.008234
720500 -- (-1419.724) (-1425.191) [-1418.780] (-1422.540) * (-1418.960) (-1425.050) (-1418.256) [-1418.401] -- 0:00:22
721000 -- [-1418.822] (-1422.840) (-1420.789) (-1419.002) * (-1420.888) (-1420.751) (-1421.968) [-1421.073] -- 0:00:22
721500 -- (-1422.564) (-1421.649) (-1421.580) [-1420.623] * (-1422.050) [-1418.679] (-1419.581) (-1420.261) -- 0:00:22
722000 -- [-1418.306] (-1420.367) (-1419.040) (-1418.133) * (-1420.477) [-1418.842] (-1420.427) (-1419.273) -- 0:00:22
722500 -- [-1419.942] (-1421.723) (-1420.565) (-1418.458) * (-1421.247) (-1419.582) [-1420.013] (-1421.296) -- 0:00:22
723000 -- [-1419.535] (-1418.457) (-1420.870) (-1420.487) * (-1422.746) (-1418.164) [-1420.000] (-1420.519) -- 0:00:22
723500 -- (-1419.813) (-1419.094) [-1420.456] (-1420.857) * (-1419.495) [-1421.795] (-1420.979) (-1421.487) -- 0:00:22
724000 -- (-1420.597) (-1422.744) (-1419.709) [-1418.955] * (-1421.383) (-1427.344) (-1418.621) [-1420.093] -- 0:00:22
724500 -- (-1421.358) (-1421.309) [-1418.402] (-1419.326) * (-1421.129) (-1420.103) [-1420.802] (-1421.059) -- 0:00:22
725000 -- (-1424.513) [-1421.343] (-1420.038) (-1418.813) * (-1422.860) (-1420.235) (-1419.272) [-1425.166] -- 0:00:22
Average standard deviation of split frequencies: 0.007639
725500 -- [-1422.207] (-1418.862) (-1421.943) (-1419.945) * (-1417.658) [-1419.285] (-1423.642) (-1419.563) -- 0:00:22
726000 -- (-1418.815) [-1424.754] (-1421.847) (-1419.935) * (-1422.528) (-1419.050) (-1419.345) [-1419.649] -- 0:00:22
726500 -- (-1418.674) [-1418.392] (-1421.835) (-1425.308) * (-1422.738) (-1420.224) [-1420.977] (-1419.770) -- 0:00:22
727000 -- [-1420.149] (-1420.035) (-1419.861) (-1423.048) * (-1424.156) [-1420.798] (-1420.635) (-1417.901) -- 0:00:22
727500 -- (-1419.463) (-1421.936) [-1418.588] (-1419.563) * [-1421.004] (-1420.911) (-1420.487) (-1424.326) -- 0:00:22
728000 -- (-1419.504) (-1418.218) [-1418.470] (-1422.959) * (-1419.328) [-1421.517] (-1418.921) (-1424.959) -- 0:00:22
728500 -- [-1419.038] (-1421.931) (-1418.028) (-1418.346) * [-1420.825] (-1417.970) (-1419.519) (-1420.300) -- 0:00:22
729000 -- (-1419.771) [-1419.434] (-1421.614) (-1422.483) * (-1418.214) (-1417.958) (-1421.306) [-1423.345] -- 0:00:22
729500 -- (-1418.157) (-1419.578) (-1421.418) [-1422.712] * (-1421.235) (-1417.866) (-1421.339) [-1420.793] -- 0:00:22
730000 -- [-1418.571] (-1423.964) (-1423.025) (-1423.781) * (-1421.214) (-1421.034) [-1423.367] (-1418.077) -- 0:00:22
Average standard deviation of split frequencies: 0.007258
730500 -- (-1420.278) (-1419.983) (-1422.505) [-1421.488] * (-1419.439) [-1418.461] (-1417.642) (-1418.199) -- 0:00:22
731000 -- (-1418.052) [-1419.490] (-1422.196) (-1421.048) * (-1417.635) (-1418.456) [-1417.642] (-1419.865) -- 0:00:22
731500 -- (-1419.617) (-1420.720) [-1421.093] (-1420.076) * (-1422.662) (-1420.945) [-1417.969] (-1420.237) -- 0:00:22
732000 -- (-1420.012) (-1419.693) [-1418.485] (-1420.136) * (-1417.946) (-1425.292) (-1419.707) [-1419.253] -- 0:00:21
732500 -- (-1421.557) [-1420.500] (-1418.816) (-1419.094) * (-1418.798) (-1421.834) [-1420.699] (-1418.297) -- 0:00:21
733000 -- [-1418.616] (-1420.470) (-1418.347) (-1421.284) * [-1420.045] (-1419.175) (-1419.446) (-1419.536) -- 0:00:21
733500 -- (-1418.384) (-1421.240) (-1420.919) [-1419.082] * (-1421.874) [-1419.308] (-1418.748) (-1422.162) -- 0:00:21
734000 -- (-1419.404) (-1421.404) [-1422.861] (-1418.957) * (-1418.673) [-1422.887] (-1419.558) (-1420.382) -- 0:00:21
734500 -- (-1419.398) (-1418.168) [-1420.660] (-1420.190) * (-1420.165) (-1418.492) (-1421.535) [-1418.695] -- 0:00:21
735000 -- (-1420.016) [-1420.635] (-1422.988) (-1418.197) * (-1420.277) (-1420.751) [-1419.083] (-1418.059) -- 0:00:21
Average standard deviation of split frequencies: 0.006805
735500 -- (-1422.366) (-1420.864) [-1419.971] (-1420.581) * (-1418.503) (-1422.678) [-1421.326] (-1418.046) -- 0:00:21
736000 -- (-1420.641) [-1419.401] (-1419.778) (-1419.501) * (-1421.528) [-1421.495] (-1418.484) (-1423.018) -- 0:00:21
736500 -- (-1420.500) (-1418.203) [-1419.142] (-1420.812) * (-1422.254) (-1423.350) [-1419.287] (-1421.599) -- 0:00:21
737000 -- (-1422.564) (-1422.559) [-1418.855] (-1418.433) * (-1422.634) [-1420.569] (-1419.205) (-1419.597) -- 0:00:21
737500 -- [-1420.568] (-1420.744) (-1418.085) (-1422.083) * (-1426.158) (-1422.989) [-1420.024] (-1421.636) -- 0:00:21
738000 -- (-1421.294) (-1430.016) (-1425.394) [-1418.840] * (-1421.210) (-1418.248) [-1420.206] (-1418.570) -- 0:00:21
738500 -- [-1419.434] (-1423.679) (-1420.989) (-1418.832) * [-1419.330] (-1421.197) (-1420.003) (-1418.750) -- 0:00:21
739000 -- (-1421.140) (-1422.807) [-1419.192] (-1417.930) * (-1418.121) (-1419.576) [-1419.547] (-1418.560) -- 0:00:21
739500 -- (-1420.335) [-1423.029] (-1423.316) (-1419.814) * [-1419.023] (-1418.580) (-1420.768) (-1420.589) -- 0:00:21
740000 -- (-1421.364) [-1419.307] (-1420.711) (-1417.939) * (-1418.008) (-1418.834) [-1420.185] (-1422.160) -- 0:00:21
Average standard deviation of split frequencies: 0.007338
740500 -- (-1419.856) (-1426.135) (-1420.986) [-1419.933] * [-1418.698] (-1417.563) (-1419.584) (-1419.804) -- 0:00:21
741000 -- (-1419.649) (-1423.215) [-1419.829] (-1418.861) * (-1419.511) [-1417.507] (-1418.035) (-1420.117) -- 0:00:21
741500 -- (-1419.833) [-1422.614] (-1417.726) (-1419.790) * (-1424.710) [-1417.986] (-1419.757) (-1421.158) -- 0:00:21
742000 -- [-1417.537] (-1425.587) (-1421.625) (-1418.420) * (-1419.386) [-1417.865] (-1419.757) (-1418.109) -- 0:00:21
742500 -- (-1421.589) (-1419.625) (-1418.263) [-1421.428] * (-1418.919) [-1421.808] (-1421.046) (-1419.415) -- 0:00:21
743000 -- (-1419.840) (-1421.222) (-1420.417) [-1419.226] * (-1419.932) (-1420.131) (-1420.334) [-1422.305] -- 0:00:21
743500 -- (-1418.650) (-1419.464) (-1418.208) [-1418.730] * (-1421.747) [-1418.712] (-1419.143) (-1419.537) -- 0:00:21
744000 -- [-1418.103] (-1423.073) (-1418.498) (-1420.646) * (-1420.690) (-1419.422) [-1419.795] (-1419.196) -- 0:00:20
744500 -- (-1418.811) [-1418.939] (-1418.812) (-1417.758) * (-1424.192) (-1423.587) [-1418.257] (-1418.309) -- 0:00:20
745000 -- (-1420.233) (-1418.956) [-1420.863] (-1419.106) * (-1419.235) (-1420.395) [-1419.684] (-1421.308) -- 0:00:20
Average standard deviation of split frequencies: 0.007758
745500 -- [-1421.709] (-1418.849) (-1418.884) (-1418.938) * (-1417.995) (-1420.487) [-1418.609] (-1419.454) -- 0:00:20
746000 -- (-1420.338) [-1417.843] (-1419.094) (-1420.470) * (-1419.113) (-1425.822) [-1418.028] (-1419.880) -- 0:00:20
746500 -- (-1418.315) [-1417.841] (-1419.220) (-1423.436) * (-1419.235) (-1426.044) [-1419.320] (-1422.191) -- 0:00:20
747000 -- (-1420.952) (-1419.867) [-1418.276] (-1424.402) * (-1419.497) (-1418.220) [-1422.965] (-1420.394) -- 0:00:20
747500 -- [-1420.701] (-1421.210) (-1418.997) (-1420.803) * (-1418.780) [-1419.056] (-1420.512) (-1419.356) -- 0:00:20
748000 -- (-1419.347) (-1419.496) [-1422.172] (-1420.463) * (-1419.803) (-1420.971) [-1418.196] (-1421.469) -- 0:00:20
748500 -- (-1420.290) [-1419.290] (-1425.777) (-1421.583) * (-1421.663) (-1420.432) [-1420.332] (-1419.038) -- 0:00:20
749000 -- (-1421.087) [-1420.079] (-1418.182) (-1418.791) * (-1420.928) [-1419.287] (-1419.658) (-1420.752) -- 0:00:20
749500 -- (-1420.444) (-1419.573) (-1418.160) [-1418.651] * [-1423.158] (-1419.354) (-1419.972) (-1421.363) -- 0:00:20
750000 -- (-1419.900) [-1420.679] (-1421.282) (-1419.723) * [-1419.585] (-1425.614) (-1421.564) (-1418.219) -- 0:00:20
Average standard deviation of split frequencies: 0.007499
750500 -- [-1418.768] (-1421.558) (-1421.847) (-1422.354) * [-1418.544] (-1419.614) (-1417.986) (-1420.405) -- 0:00:20
751000 -- (-1418.664) (-1420.728) (-1418.692) [-1419.665] * (-1419.404) (-1420.246) [-1418.425] (-1420.267) -- 0:00:20
751500 -- (-1419.580) [-1420.320] (-1422.380) (-1418.376) * [-1418.895] (-1421.714) (-1418.100) (-1420.345) -- 0:00:20
752000 -- (-1418.388) (-1421.226) (-1426.714) [-1418.558] * (-1418.824) (-1420.795) (-1418.918) [-1419.181] -- 0:00:20
752500 -- [-1419.182] (-1422.658) (-1426.624) (-1421.066) * (-1421.278) [-1419.515] (-1419.742) (-1422.228) -- 0:00:20
753000 -- [-1419.207] (-1419.677) (-1426.392) (-1420.093) * (-1419.510) (-1420.787) (-1420.652) [-1419.176] -- 0:00:20
753500 -- (-1421.742) (-1422.054) (-1424.233) [-1421.005] * [-1419.327] (-1420.525) (-1422.780) (-1421.766) -- 0:00:20
754000 -- (-1420.032) (-1421.046) (-1420.523) [-1419.982] * (-1419.247) (-1424.210) [-1419.756] (-1420.756) -- 0:00:20
754500 -- (-1421.154) (-1421.047) [-1419.324] (-1420.051) * (-1422.046) (-1425.475) [-1421.894] (-1420.503) -- 0:00:20
755000 -- (-1420.319) (-1420.694) [-1417.933] (-1422.876) * (-1418.633) (-1423.488) (-1426.789) [-1419.814] -- 0:00:20
Average standard deviation of split frequencies: 0.007152
755500 -- (-1418.636) (-1419.497) [-1417.942] (-1419.425) * (-1420.303) (-1419.016) (-1418.112) [-1418.511] -- 0:00:20
756000 -- [-1418.181] (-1420.036) (-1418.819) (-1420.091) * (-1421.032) [-1421.819] (-1418.383) (-1420.322) -- 0:00:20
756500 -- (-1418.148) [-1422.197] (-1420.237) (-1418.890) * (-1420.074) (-1423.349) (-1422.227) [-1419.202] -- 0:00:19
757000 -- [-1418.153] (-1420.133) (-1419.146) (-1420.234) * (-1419.576) (-1424.038) [-1419.280] (-1418.937) -- 0:00:19
757500 -- [-1419.183] (-1419.455) (-1418.581) (-1418.893) * (-1419.171) [-1419.946] (-1420.035) (-1420.670) -- 0:00:19
758000 -- (-1421.563) (-1420.485) [-1418.247] (-1418.833) * (-1419.189) (-1426.367) [-1422.643] (-1419.235) -- 0:00:19
758500 -- (-1418.490) [-1419.173] (-1419.391) (-1418.373) * (-1419.440) [-1418.518] (-1424.868) (-1419.007) -- 0:00:19
759000 -- (-1419.030) [-1419.021] (-1420.199) (-1418.388) * (-1420.382) (-1421.694) (-1420.651) [-1422.317] -- 0:00:19
759500 -- (-1418.510) (-1420.771) (-1422.220) [-1419.575] * (-1421.706) [-1419.087] (-1418.219) (-1422.500) -- 0:00:19
760000 -- (-1419.738) (-1419.664) (-1418.036) [-1423.678] * [-1422.607] (-1419.247) (-1417.883) (-1421.091) -- 0:00:19
Average standard deviation of split frequencies: 0.006858
760500 -- (-1421.402) (-1424.686) [-1418.303] (-1420.079) * (-1420.616) (-1420.079) [-1421.855] (-1421.574) -- 0:00:19
761000 -- (-1419.607) (-1423.037) (-1420.123) [-1420.641] * (-1420.070) (-1421.155) [-1420.006] (-1424.633) -- 0:00:19
761500 -- (-1418.149) (-1421.375) (-1417.712) [-1419.256] * (-1419.095) [-1420.889] (-1422.390) (-1420.031) -- 0:00:19
762000 -- (-1418.960) (-1421.163) [-1417.889] (-1418.709) * (-1419.645) [-1420.779] (-1423.236) (-1420.661) -- 0:00:19
762500 -- (-1418.014) (-1418.985) [-1420.060] (-1419.725) * [-1420.988] (-1419.274) (-1421.916) (-1423.120) -- 0:00:19
763000 -- (-1419.326) (-1418.789) (-1418.675) [-1419.187] * [-1418.417] (-1421.364) (-1419.569) (-1421.819) -- 0:00:19
763500 -- (-1422.698) (-1418.539) [-1423.637] (-1419.347) * (-1418.049) (-1419.319) [-1418.261] (-1419.631) -- 0:00:19
764000 -- (-1419.649) (-1418.178) (-1421.409) [-1418.585] * (-1418.049) (-1423.022) [-1418.635] (-1418.562) -- 0:00:19
764500 -- [-1420.963] (-1421.106) (-1420.723) (-1419.026) * (-1419.022) (-1422.616) (-1418.915) [-1420.212] -- 0:00:19
765000 -- (-1421.720) [-1419.422] (-1419.186) (-1419.091) * (-1419.087) (-1422.670) (-1417.934) [-1423.058] -- 0:00:19
Average standard deviation of split frequencies: 0.006770
765500 -- [-1420.476] (-1419.428) (-1419.460) (-1420.244) * (-1417.974) (-1420.735) (-1421.013) [-1419.679] -- 0:00:19
766000 -- [-1420.838] (-1417.954) (-1420.810) (-1420.394) * (-1420.282) [-1418.922] (-1420.574) (-1420.614) -- 0:00:19
766500 -- (-1419.538) (-1418.794) (-1422.011) [-1423.366] * [-1417.905] (-1418.977) (-1420.209) (-1419.698) -- 0:00:19
767000 -- (-1418.351) (-1418.571) [-1418.577] (-1418.091) * (-1418.846) [-1418.863] (-1421.540) (-1419.910) -- 0:00:19
767500 -- (-1419.807) [-1421.676] (-1419.005) (-1418.027) * [-1419.097] (-1420.079) (-1419.298) (-1420.698) -- 0:00:19
768000 -- (-1419.866) (-1418.109) (-1419.228) [-1419.376] * (-1420.149) [-1420.164] (-1421.632) (-1420.405) -- 0:00:19
768500 -- (-1420.679) [-1418.961] (-1418.810) (-1420.135) * (-1419.089) (-1421.471) [-1421.369] (-1419.491) -- 0:00:18
769000 -- (-1420.374) (-1420.335) (-1419.196) [-1422.564] * (-1420.749) [-1419.483] (-1420.292) (-1418.456) -- 0:00:18
769500 -- (-1421.377) (-1419.278) [-1418.074] (-1419.962) * [-1423.928] (-1420.891) (-1423.006) (-1419.651) -- 0:00:18
770000 -- (-1421.264) (-1421.370) (-1421.214) [-1418.479] * [-1422.214] (-1420.617) (-1419.815) (-1420.760) -- 0:00:18
Average standard deviation of split frequencies: 0.007264
770500 -- (-1429.259) (-1425.815) [-1420.566] (-1418.743) * (-1417.986) (-1420.408) (-1418.339) [-1419.052] -- 0:00:18
771000 -- (-1426.651) (-1417.752) [-1421.619] (-1421.495) * (-1418.039) [-1419.091] (-1418.967) (-1418.249) -- 0:00:18
771500 -- (-1424.165) (-1422.342) [-1419.511] (-1422.982) * (-1419.010) [-1419.682] (-1421.382) (-1419.282) -- 0:00:18
772000 -- (-1420.474) (-1420.849) [-1420.075] (-1426.211) * (-1420.522) (-1418.730) (-1424.192) [-1419.444] -- 0:00:18
772500 -- (-1419.955) [-1419.984] (-1420.963) (-1425.501) * (-1419.699) [-1418.999] (-1421.730) (-1418.197) -- 0:00:18
773000 -- [-1419.530] (-1422.691) (-1418.841) (-1422.682) * (-1421.679) (-1418.138) (-1419.990) [-1418.316] -- 0:00:18
773500 -- (-1417.785) (-1422.164) [-1419.418] (-1418.178) * (-1427.117) [-1418.508] (-1418.322) (-1420.335) -- 0:00:18
774000 -- (-1421.325) (-1418.592) (-1420.570) [-1418.348] * (-1423.606) [-1418.599] (-1418.839) (-1422.408) -- 0:00:18
774500 -- (-1426.972) [-1418.647] (-1425.595) (-1418.163) * (-1421.285) (-1422.339) (-1419.074) [-1419.214] -- 0:00:18
775000 -- (-1421.003) [-1417.804] (-1419.281) (-1421.761) * (-1422.699) (-1420.127) (-1419.122) [-1419.698] -- 0:00:18
Average standard deviation of split frequencies: 0.006966
775500 -- (-1420.404) (-1420.137) [-1419.715] (-1420.830) * [-1419.015] (-1418.193) (-1418.557) (-1428.488) -- 0:00:18
776000 -- (-1419.845) (-1419.116) (-1423.383) [-1419.460] * (-1420.054) (-1421.940) (-1419.462) [-1420.123] -- 0:00:18
776500 -- (-1420.613) (-1421.137) (-1424.174) [-1422.332] * (-1423.168) (-1421.923) (-1420.408) [-1418.361] -- 0:00:18
777000 -- [-1420.644] (-1420.876) (-1422.148) (-1419.516) * (-1421.260) (-1423.371) [-1417.743] (-1420.930) -- 0:00:18
777500 -- (-1419.805) (-1420.392) [-1419.333] (-1420.651) * (-1421.111) (-1418.520) [-1419.398] (-1421.288) -- 0:00:18
778000 -- [-1420.044] (-1418.788) (-1418.832) (-1419.004) * (-1419.248) (-1419.760) [-1421.297] (-1419.402) -- 0:00:18
778500 -- (-1418.939) (-1418.056) [-1420.039] (-1420.256) * [-1419.115] (-1418.930) (-1420.155) (-1420.316) -- 0:00:18
779000 -- (-1418.794) [-1418.397] (-1419.772) (-1418.409) * (-1419.789) (-1425.882) [-1422.069] (-1420.656) -- 0:00:18
779500 -- (-1422.076) (-1424.014) (-1422.008) [-1418.594] * [-1418.937] (-1419.286) (-1420.148) (-1422.723) -- 0:00:18
780000 -- (-1424.435) (-1419.951) [-1418.380] (-1418.624) * (-1419.783) (-1421.530) (-1418.434) [-1419.237] -- 0:00:18
Average standard deviation of split frequencies: 0.006803
780500 -- (-1420.563) [-1420.905] (-1418.619) (-1419.635) * (-1419.567) (-1418.384) [-1418.788] (-1418.161) -- 0:00:17
781000 -- (-1423.654) (-1420.120) (-1419.963) [-1419.959] * (-1419.134) (-1419.011) (-1419.336) [-1420.460] -- 0:00:17
781500 -- (-1421.582) [-1420.218] (-1420.501) (-1419.732) * [-1417.826] (-1427.198) (-1421.386) (-1419.461) -- 0:00:17
782000 -- (-1420.358) [-1420.630] (-1419.643) (-1421.352) * [-1421.614] (-1419.272) (-1420.138) (-1421.602) -- 0:00:17
782500 -- (-1419.523) [-1419.229] (-1420.655) (-1419.670) * (-1418.511) (-1420.608) (-1419.152) [-1423.702] -- 0:00:17
783000 -- (-1418.333) [-1420.122] (-1418.671) (-1424.797) * (-1418.617) [-1418.214] (-1418.607) (-1423.749) -- 0:00:17
783500 -- [-1419.373] (-1421.864) (-1419.062) (-1419.441) * (-1417.894) (-1418.848) [-1418.646] (-1421.690) -- 0:00:17
784000 -- (-1419.882) (-1421.089) [-1426.256] (-1419.206) * (-1419.621) [-1420.359] (-1419.653) (-1419.938) -- 0:00:17
784500 -- (-1418.820) [-1422.841] (-1421.782) (-1419.200) * (-1424.070) [-1420.736] (-1418.547) (-1419.317) -- 0:00:17
785000 -- (-1425.417) (-1423.125) (-1418.847) [-1418.995] * (-1425.639) (-1422.358) (-1419.482) [-1421.533] -- 0:00:17
Average standard deviation of split frequencies: 0.006335
785500 -- (-1420.798) (-1419.974) [-1420.006] (-1421.468) * (-1421.504) [-1422.194] (-1420.517) (-1421.656) -- 0:00:17
786000 -- [-1419.540] (-1419.415) (-1418.938) (-1425.979) * (-1419.187) (-1420.165) [-1419.213] (-1420.687) -- 0:00:17
786500 -- (-1419.847) (-1421.651) [-1420.972] (-1422.518) * (-1420.453) (-1419.413) (-1423.812) [-1424.905] -- 0:00:17
787000 -- [-1423.271] (-1421.478) (-1420.905) (-1422.176) * [-1418.905] (-1424.205) (-1422.497) (-1419.671) -- 0:00:17
787500 -- (-1421.993) [-1420.298] (-1424.763) (-1418.851) * (-1418.997) [-1418.397] (-1420.429) (-1418.291) -- 0:00:17
788000 -- [-1422.409] (-1420.877) (-1420.475) (-1419.208) * [-1421.257] (-1419.726) (-1421.253) (-1417.962) -- 0:00:17
788500 -- [-1419.707] (-1419.427) (-1422.930) (-1419.772) * (-1421.436) (-1422.742) (-1419.624) [-1417.659] -- 0:00:17
789000 -- (-1419.993) (-1418.277) (-1421.830) [-1418.768] * [-1422.074] (-1422.903) (-1419.097) (-1417.600) -- 0:00:17
789500 -- (-1420.766) (-1418.284) [-1419.622] (-1419.547) * (-1419.497) (-1420.734) [-1420.279] (-1419.915) -- 0:00:17
790000 -- (-1419.383) [-1421.468] (-1421.292) (-1418.388) * (-1419.445) (-1419.992) (-1419.050) [-1419.904] -- 0:00:17
Average standard deviation of split frequencies: 0.006335
790500 -- (-1420.259) [-1422.763] (-1421.441) (-1422.127) * (-1419.969) (-1418.642) [-1419.091] (-1419.275) -- 0:00:17
791000 -- [-1420.858] (-1422.166) (-1419.298) (-1422.776) * [-1419.100] (-1419.973) (-1418.185) (-1420.666) -- 0:00:17
791500 -- (-1419.171) [-1419.203] (-1420.035) (-1420.368) * (-1420.426) (-1419.804) [-1420.508] (-1421.475) -- 0:00:17
792000 -- [-1419.368] (-1420.030) (-1420.823) (-1418.588) * (-1418.389) [-1418.803] (-1420.189) (-1420.244) -- 0:00:17
792500 -- (-1418.236) [-1418.589] (-1421.902) (-1418.895) * (-1419.390) (-1419.591) (-1418.688) [-1418.477] -- 0:00:17
793000 -- [-1418.814] (-1419.971) (-1420.253) (-1418.407) * (-1418.423) (-1420.950) [-1419.482] (-1417.729) -- 0:00:16
793500 -- (-1420.768) (-1423.090) [-1421.116] (-1418.505) * (-1421.411) (-1421.839) [-1419.338] (-1417.914) -- 0:00:16
794000 -- [-1418.131] (-1420.121) (-1419.014) (-1419.894) * (-1421.146) (-1421.486) [-1419.613] (-1420.297) -- 0:00:16
794500 -- (-1418.472) [-1419.684] (-1421.706) (-1419.583) * [-1419.170] (-1422.735) (-1420.063) (-1419.405) -- 0:00:16
795000 -- (-1420.904) (-1422.382) [-1420.820] (-1421.210) * (-1419.201) [-1419.000] (-1419.250) (-1419.394) -- 0:00:16
Average standard deviation of split frequencies: 0.006514
795500 -- (-1420.219) (-1420.038) (-1418.096) [-1419.423] * (-1419.162) [-1422.809] (-1420.666) (-1420.147) -- 0:00:16
796000 -- (-1426.098) [-1421.246] (-1418.746) (-1418.633) * (-1419.087) [-1421.638] (-1420.656) (-1418.259) -- 0:00:16
796500 -- (-1418.229) (-1419.795) (-1419.918) [-1419.499] * (-1423.906) [-1418.834] (-1420.273) (-1417.829) -- 0:00:16
797000 -- [-1418.229] (-1419.418) (-1418.314) (-1418.961) * (-1419.055) (-1421.774) [-1420.868] (-1418.454) -- 0:00:16
797500 -- (-1418.345) [-1423.434] (-1419.470) (-1420.818) * (-1420.015) (-1422.908) [-1419.651] (-1420.952) -- 0:00:16
798000 -- [-1419.163] (-1423.110) (-1419.297) (-1419.146) * [-1418.141] (-1419.487) (-1419.031) (-1418.624) -- 0:00:16
798500 -- (-1419.369) [-1421.479] (-1417.502) (-1419.166) * (-1418.143) (-1418.251) (-1418.865) [-1419.001] -- 0:00:16
799000 -- (-1420.538) (-1418.289) [-1418.512] (-1419.268) * (-1418.264) (-1421.729) [-1420.613] (-1420.173) -- 0:00:16
799500 -- [-1420.309] (-1419.034) (-1418.791) (-1422.095) * (-1422.091) (-1421.252) [-1420.860] (-1420.849) -- 0:00:16
800000 -- [-1419.458] (-1417.851) (-1418.696) (-1423.312) * [-1419.013] (-1421.356) (-1418.517) (-1420.577) -- 0:00:16
Average standard deviation of split frequencies: 0.006437
800500 -- (-1420.855) (-1420.950) [-1418.266] (-1419.205) * (-1419.210) [-1419.828] (-1418.524) (-1421.922) -- 0:00:16
801000 -- [-1418.948] (-1419.997) (-1419.540) (-1419.861) * (-1419.809) (-1421.577) [-1420.279] (-1421.647) -- 0:00:16
801500 -- (-1418.857) (-1418.594) [-1420.720] (-1418.948) * [-1422.112] (-1422.413) (-1420.297) (-1422.568) -- 0:00:16
802000 -- (-1422.516) [-1419.534] (-1420.063) (-1418.406) * (-1422.094) (-1418.293) [-1420.679] (-1420.656) -- 0:00:16
802500 -- [-1419.217] (-1424.941) (-1421.530) (-1421.213) * [-1423.653] (-1418.427) (-1420.408) (-1421.990) -- 0:00:16
803000 -- (-1422.800) (-1418.714) [-1420.438] (-1423.440) * (-1418.689) (-1418.458) (-1419.518) [-1420.038] -- 0:00:16
803500 -- (-1421.173) (-1421.087) [-1421.332] (-1418.065) * (-1420.311) [-1419.928] (-1418.837) (-1420.851) -- 0:00:16
804000 -- (-1425.581) (-1420.978) (-1419.261) [-1418.887] * (-1420.054) (-1420.017) (-1419.635) [-1420.217] -- 0:00:16
804500 -- (-1419.868) [-1422.170] (-1421.549) (-1420.250) * (-1420.402) (-1420.355) [-1420.073] (-1418.075) -- 0:00:16
805000 -- [-1420.452] (-1422.085) (-1420.838) (-1419.192) * (-1421.145) (-1418.464) (-1422.436) [-1419.565] -- 0:00:15
Average standard deviation of split frequencies: 0.006287
805500 -- (-1418.413) (-1423.734) (-1421.124) [-1419.603] * (-1421.914) (-1418.952) [-1418.839] (-1423.020) -- 0:00:15
806000 -- (-1418.735) (-1419.798) [-1421.374] (-1419.644) * (-1420.901) (-1419.155) (-1422.169) [-1418.460] -- 0:00:15
806500 -- (-1419.758) (-1418.613) [-1423.465] (-1419.534) * (-1419.194) (-1419.725) (-1421.436) [-1418.860] -- 0:00:15
807000 -- (-1423.742) [-1419.648] (-1420.845) (-1418.777) * (-1418.987) (-1420.474) (-1420.760) [-1418.327] -- 0:00:15
807500 -- (-1420.027) [-1419.523] (-1420.808) (-1420.255) * (-1417.916) (-1420.300) (-1418.765) [-1420.143] -- 0:00:15
808000 -- (-1420.831) (-1428.448) (-1420.437) [-1418.525] * [-1417.938] (-1421.757) (-1418.618) (-1419.278) -- 0:00:15
808500 -- (-1418.808) (-1420.111) (-1420.202) [-1418.765] * (-1418.833) (-1421.010) [-1418.851] (-1419.248) -- 0:00:15
809000 -- (-1419.886) (-1419.075) (-1421.393) [-1419.039] * (-1417.741) [-1419.131] (-1421.395) (-1419.171) -- 0:00:15
809500 -- [-1421.282] (-1421.228) (-1418.654) (-1419.014) * (-1419.097) [-1418.979] (-1421.073) (-1420.979) -- 0:00:15
810000 -- (-1421.126) (-1418.872) [-1420.813] (-1419.051) * [-1419.097] (-1419.130) (-1420.607) (-1419.104) -- 0:00:15
Average standard deviation of split frequencies: 0.005582
810500 -- (-1420.354) [-1419.820] (-1418.871) (-1418.771) * (-1419.394) [-1422.013] (-1420.570) (-1423.237) -- 0:00:15
811000 -- (-1421.349) (-1422.821) [-1422.276] (-1418.925) * (-1423.314) [-1421.295] (-1419.912) (-1418.831) -- 0:00:15
811500 -- (-1420.961) [-1420.535] (-1419.442) (-1418.697) * [-1421.057] (-1421.472) (-1420.244) (-1418.975) -- 0:00:15
812000 -- (-1420.810) (-1419.367) [-1421.597] (-1418.106) * (-1419.874) (-1420.620) [-1422.800] (-1418.760) -- 0:00:15
812500 -- (-1421.897) (-1421.508) [-1423.114] (-1419.385) * (-1421.878) (-1422.823) (-1420.115) [-1418.961] -- 0:00:15
813000 -- (-1423.341) [-1420.185] (-1422.465) (-1420.637) * (-1421.799) [-1418.734] (-1419.384) (-1418.681) -- 0:00:15
813500 -- (-1421.296) (-1418.405) [-1419.208] (-1421.563) * (-1421.403) [-1417.820] (-1421.299) (-1418.978) -- 0:00:15
814000 -- (-1425.322) (-1417.772) [-1419.191] (-1420.912) * (-1419.015) [-1417.655] (-1419.321) (-1420.503) -- 0:00:15
814500 -- (-1421.494) [-1419.112] (-1419.761) (-1419.957) * [-1418.724] (-1417.658) (-1419.772) (-1421.033) -- 0:00:15
815000 -- (-1421.093) (-1417.914) [-1419.576] (-1418.816) * (-1420.379) [-1419.027] (-1422.265) (-1420.168) -- 0:00:15
Average standard deviation of split frequencies: 0.005430
815500 -- (-1418.587) [-1420.657] (-1419.269) (-1424.189) * (-1424.193) [-1420.088] (-1420.898) (-1420.648) -- 0:00:15
816000 -- [-1422.180] (-1418.723) (-1418.804) (-1424.393) * (-1421.840) (-1421.736) (-1426.722) [-1420.728] -- 0:00:15
816500 -- (-1422.160) [-1417.757] (-1419.151) (-1423.192) * (-1419.280) [-1420.338] (-1419.141) (-1420.375) -- 0:00:15
817000 -- [-1420.035] (-1420.143) (-1419.902) (-1419.220) * (-1418.789) (-1420.558) [-1419.751] (-1419.699) -- 0:00:15
817500 -- (-1419.815) [-1418.102] (-1418.915) (-1422.050) * [-1419.128] (-1421.423) (-1420.191) (-1419.187) -- 0:00:14
818000 -- (-1420.827) (-1419.084) [-1418.125] (-1423.451) * (-1417.924) [-1419.848] (-1419.332) (-1418.838) -- 0:00:14
818500 -- (-1418.672) (-1422.087) [-1419.784] (-1424.717) * (-1418.181) [-1419.343] (-1419.482) (-1419.629) -- 0:00:14
819000 -- (-1419.152) [-1422.770] (-1418.973) (-1421.644) * [-1422.333] (-1424.558) (-1418.561) (-1419.623) -- 0:00:14
819500 -- [-1424.496] (-1421.697) (-1418.834) (-1419.686) * [-1422.365] (-1424.259) (-1423.338) (-1420.889) -- 0:00:14
820000 -- (-1419.516) [-1422.684] (-1420.588) (-1418.447) * (-1419.839) [-1420.251] (-1422.374) (-1418.093) -- 0:00:14
Average standard deviation of split frequencies: 0.005421
820500 -- (-1419.636) (-1421.860) (-1418.645) [-1418.376] * (-1418.589) (-1419.081) [-1420.991] (-1420.019) -- 0:00:14
821000 -- (-1420.548) (-1419.068) (-1419.827) [-1421.503] * (-1419.317) (-1419.377) (-1420.392) [-1418.795] -- 0:00:14
821500 -- (-1419.183) (-1421.685) [-1420.417] (-1421.446) * (-1418.975) (-1418.984) (-1419.554) [-1418.798] -- 0:00:14
822000 -- (-1418.563) (-1427.482) (-1422.315) [-1424.849] * [-1422.439] (-1419.460) (-1419.468) (-1419.412) -- 0:00:14
822500 -- [-1418.899] (-1419.616) (-1418.888) (-1424.283) * (-1423.773) (-1418.977) (-1418.172) [-1420.468] -- 0:00:14
823000 -- [-1418.073] (-1422.188) (-1421.354) (-1422.603) * (-1423.925) [-1418.250] (-1420.404) (-1419.154) -- 0:00:14
823500 -- (-1421.791) (-1420.632) (-1421.440) [-1425.301] * (-1417.836) (-1421.257) [-1419.851] (-1421.034) -- 0:00:14
824000 -- [-1419.726] (-1422.368) (-1421.279) (-1421.719) * [-1420.312] (-1418.000) (-1420.778) (-1419.664) -- 0:00:14
824500 -- [-1419.929] (-1422.423) (-1423.336) (-1419.973) * [-1419.714] (-1418.187) (-1419.861) (-1420.803) -- 0:00:14
825000 -- [-1422.652] (-1418.533) (-1423.687) (-1419.401) * (-1419.669) (-1421.373) (-1420.091) [-1422.638] -- 0:00:14
Average standard deviation of split frequencies: 0.005992
825500 -- [-1420.330] (-1427.092) (-1420.575) (-1418.645) * (-1420.902) [-1420.227] (-1422.043) (-1422.390) -- 0:00:14
826000 -- (-1421.193) (-1424.486) [-1419.289] (-1418.934) * (-1418.159) (-1422.275) [-1418.973] (-1420.687) -- 0:00:14
826500 -- (-1418.059) (-1422.917) (-1418.965) [-1418.216] * [-1418.621] (-1422.719) (-1419.165) (-1420.602) -- 0:00:14
827000 -- [-1420.124] (-1418.625) (-1421.616) (-1420.945) * (-1419.134) (-1421.004) [-1419.207] (-1420.815) -- 0:00:14
827500 -- [-1421.594] (-1419.182) (-1424.476) (-1425.110) * (-1418.867) (-1421.705) (-1418.807) [-1421.700] -- 0:00:14
828000 -- (-1425.316) (-1419.061) [-1422.425] (-1421.591) * (-1419.922) [-1420.885] (-1419.356) (-1422.015) -- 0:00:14
828500 -- (-1418.791) (-1418.523) (-1421.200) [-1423.909] * (-1419.664) (-1418.727) [-1422.351] (-1419.151) -- 0:00:14
829000 -- (-1419.440) (-1421.629) (-1419.158) [-1419.055] * (-1419.453) (-1420.540) (-1418.842) [-1418.098] -- 0:00:14
829500 -- [-1418.801] (-1422.619) (-1419.850) (-1419.521) * [-1419.969] (-1420.392) (-1421.207) (-1419.562) -- 0:00:13
830000 -- [-1419.243] (-1422.738) (-1422.315) (-1420.638) * (-1419.688) [-1418.723] (-1418.294) (-1420.496) -- 0:00:13
Average standard deviation of split frequencies: 0.006207
830500 -- (-1418.385) [-1419.483] (-1423.137) (-1420.388) * (-1422.190) (-1418.085) [-1418.682] (-1418.815) -- 0:00:13
831000 -- [-1421.919] (-1419.564) (-1419.749) (-1420.904) * [-1421.142] (-1418.231) (-1421.294) (-1418.757) -- 0:00:13
831500 -- (-1418.730) (-1424.308) [-1419.721] (-1420.194) * (-1418.316) (-1419.623) (-1419.188) [-1420.462] -- 0:00:13
832000 -- [-1427.872] (-1424.453) (-1423.774) (-1419.202) * [-1418.082] (-1421.220) (-1421.163) (-1418.002) -- 0:00:13
832500 -- [-1425.991] (-1419.862) (-1419.144) (-1419.908) * [-1418.714] (-1419.999) (-1423.501) (-1420.082) -- 0:00:13
833000 -- (-1422.311) (-1419.209) (-1421.756) [-1419.658] * (-1418.725) (-1418.891) (-1420.815) [-1419.008] -- 0:00:13
833500 -- (-1419.294) (-1418.245) (-1428.108) [-1419.815] * [-1418.669] (-1419.314) (-1423.767) (-1418.518) -- 0:00:13
834000 -- [-1418.725] (-1419.019) (-1419.440) (-1420.745) * [-1417.957] (-1421.193) (-1420.054) (-1421.226) -- 0:00:13
834500 -- (-1419.987) (-1419.387) (-1419.183) [-1419.411] * [-1418.692] (-1423.616) (-1418.244) (-1424.019) -- 0:00:13
835000 -- (-1422.987) (-1418.316) [-1422.913] (-1417.763) * (-1421.026) [-1419.566] (-1419.516) (-1424.717) -- 0:00:13
Average standard deviation of split frequencies: 0.006062
835500 -- (-1420.957) (-1418.589) [-1419.034] (-1417.666) * (-1420.348) (-1418.435) (-1418.332) [-1419.797] -- 0:00:13
836000 -- (-1419.209) (-1420.616) [-1419.174] (-1418.474) * (-1420.306) (-1419.577) [-1419.057] (-1419.818) -- 0:00:13
836500 -- (-1419.548) [-1419.849] (-1419.481) (-1418.255) * (-1418.772) (-1418.248) (-1418.962) [-1419.090] -- 0:00:13
837000 -- (-1418.523) (-1420.118) [-1419.821] (-1418.107) * [-1420.128] (-1418.954) (-1420.019) (-1421.172) -- 0:00:13
837500 -- (-1418.757) (-1418.924) (-1418.836) [-1418.677] * [-1418.421] (-1422.616) (-1420.506) (-1424.938) -- 0:00:13
838000 -- (-1419.843) (-1418.506) [-1418.160] (-1420.084) * [-1418.169] (-1418.839) (-1420.382) (-1420.102) -- 0:00:13
838500 -- (-1418.462) (-1419.545) [-1418.356] (-1423.941) * (-1419.364) (-1418.929) [-1417.822] (-1419.361) -- 0:00:13
839000 -- (-1423.816) [-1421.106] (-1418.553) (-1423.368) * (-1419.500) [-1418.109] (-1418.124) (-1419.725) -- 0:00:13
839500 -- (-1423.733) [-1418.165] (-1420.961) (-1419.120) * [-1419.278] (-1418.012) (-1423.485) (-1418.903) -- 0:00:13
840000 -- [-1420.056] (-1424.818) (-1421.616) (-1423.203) * (-1418.798) [-1418.588] (-1418.543) (-1418.232) -- 0:00:13
Average standard deviation of split frequencies: 0.005888
840500 -- (-1420.017) [-1419.243] (-1420.839) (-1418.002) * [-1421.161] (-1427.655) (-1419.584) (-1420.651) -- 0:00:13
841000 -- (-1419.307) (-1419.451) (-1418.638) [-1418.034] * (-1418.106) (-1421.338) [-1420.630] (-1419.404) -- 0:00:13
841500 -- [-1421.031] (-1426.312) (-1418.633) (-1419.153) * (-1419.006) (-1419.251) (-1422.188) [-1421.466] -- 0:00:12
842000 -- (-1420.332) (-1418.207) (-1420.958) [-1419.461] * (-1422.675) [-1418.005] (-1421.647) (-1419.125) -- 0:00:12
842500 -- (-1421.186) (-1423.035) [-1419.405] (-1418.487) * (-1417.924) (-1419.388) (-1419.359) [-1418.748] -- 0:00:12
843000 -- (-1420.938) (-1421.373) [-1419.869] (-1423.591) * (-1418.218) (-1419.155) [-1421.565] (-1421.288) -- 0:00:12
843500 -- (-1421.336) (-1422.317) [-1421.380] (-1419.814) * [-1421.476] (-1421.101) (-1419.305) (-1423.338) -- 0:00:12
844000 -- [-1420.766] (-1418.627) (-1420.580) (-1418.594) * (-1418.442) [-1421.104] (-1418.970) (-1418.976) -- 0:00:12
844500 -- (-1421.367) (-1418.233) [-1420.690] (-1417.983) * [-1419.492] (-1421.197) (-1418.252) (-1427.484) -- 0:00:12
845000 -- (-1422.480) (-1418.293) [-1420.835] (-1420.611) * (-1423.706) (-1419.758) [-1418.773] (-1420.109) -- 0:00:12
Average standard deviation of split frequencies: 0.006060
845500 -- (-1420.288) [-1418.016] (-1418.585) (-1418.280) * (-1420.121) (-1418.728) [-1418.369] (-1422.763) -- 0:00:12
846000 -- [-1419.605] (-1418.852) (-1421.651) (-1420.053) * (-1418.516) (-1421.742) [-1420.428] (-1422.616) -- 0:00:12
846500 -- (-1426.612) [-1421.425] (-1419.424) (-1421.403) * (-1419.106) (-1420.280) (-1420.153) [-1418.963] -- 0:00:12
847000 -- (-1422.478) [-1420.364] (-1419.255) (-1418.722) * [-1420.756] (-1418.020) (-1418.860) (-1419.675) -- 0:00:12
847500 -- [-1418.970] (-1421.134) (-1418.199) (-1418.261) * (-1417.845) [-1418.318] (-1419.807) (-1418.715) -- 0:00:12
848000 -- (-1417.686) [-1422.048] (-1418.603) (-1418.982) * [-1420.082] (-1419.828) (-1421.113) (-1418.389) -- 0:00:12
848500 -- [-1419.300] (-1420.158) (-1419.769) (-1420.487) * (-1419.550) (-1419.120) (-1421.023) [-1420.201] -- 0:00:12
849000 -- [-1420.168] (-1419.895) (-1420.310) (-1420.160) * (-1418.798) (-1419.891) (-1418.913) [-1418.609] -- 0:00:12
849500 -- (-1419.958) (-1420.143) [-1419.560] (-1418.770) * [-1418.685] (-1418.077) (-1420.540) (-1419.331) -- 0:00:12
850000 -- [-1422.107] (-1420.835) (-1419.753) (-1418.164) * (-1418.385) (-1422.047) (-1420.870) [-1418.210] -- 0:00:12
Average standard deviation of split frequencies: 0.006234
850500 -- (-1417.828) (-1420.140) [-1422.401] (-1418.770) * [-1418.128] (-1422.004) (-1419.577) (-1419.737) -- 0:00:12
851000 -- (-1419.278) (-1424.080) [-1418.571] (-1419.253) * (-1420.911) (-1421.003) (-1418.206) [-1418.998] -- 0:00:12
851500 -- (-1418.032) (-1418.852) (-1420.751) [-1421.258] * (-1419.982) [-1422.782] (-1422.336) (-1421.118) -- 0:00:12
852000 -- [-1421.307] (-1418.929) (-1421.320) (-1418.153) * [-1422.328] (-1420.556) (-1418.305) (-1418.219) -- 0:00:12
852500 -- (-1424.642) (-1420.815) (-1419.623) [-1420.654] * (-1419.607) (-1419.603) (-1420.704) [-1418.728] -- 0:00:12
853000 -- (-1423.033) (-1418.773) (-1422.199) [-1418.213] * (-1424.950) (-1419.472) [-1420.200] (-1422.825) -- 0:00:12
853500 -- (-1419.135) [-1418.830] (-1419.376) (-1418.467) * (-1420.962) (-1418.007) [-1421.027] (-1418.131) -- 0:00:12
854000 -- (-1419.930) (-1419.997) [-1418.783] (-1420.379) * [-1418.841] (-1417.987) (-1418.386) (-1418.450) -- 0:00:11
854500 -- (-1420.301) (-1421.006) (-1419.898) [-1419.564] * (-1419.589) (-1420.635) [-1421.179] (-1419.134) -- 0:00:11
855000 -- (-1420.777) (-1421.682) (-1419.239) [-1418.762] * (-1421.602) [-1419.325] (-1420.209) (-1418.444) -- 0:00:11
Average standard deviation of split frequencies: 0.006333
855500 -- (-1421.891) (-1419.210) [-1420.309] (-1420.446) * (-1422.053) [-1419.965] (-1419.025) (-1421.801) -- 0:00:11
856000 -- [-1421.151] (-1420.599) (-1421.120) (-1418.869) * [-1422.604] (-1420.361) (-1418.270) (-1419.502) -- 0:00:11
856500 -- (-1420.031) (-1418.448) (-1422.118) [-1420.588] * (-1418.193) (-1420.400) (-1418.167) [-1418.639] -- 0:00:11
857000 -- [-1419.616] (-1418.811) (-1420.991) (-1418.826) * (-1422.275) (-1421.195) (-1419.292) [-1418.499] -- 0:00:11
857500 -- (-1422.909) [-1419.668] (-1419.086) (-1418.921) * (-1424.033) (-1421.593) [-1419.260] (-1417.955) -- 0:00:11
858000 -- (-1421.748) (-1419.276) (-1419.086) [-1420.823] * (-1420.105) (-1424.778) [-1421.124] (-1418.048) -- 0:00:11
858500 -- [-1420.737] (-1421.935) (-1418.513) (-1425.874) * (-1418.857) (-1425.793) (-1418.015) [-1418.662] -- 0:00:11
859000 -- (-1420.355) [-1422.441] (-1421.713) (-1418.432) * (-1421.905) (-1426.041) (-1418.375) [-1418.081] -- 0:00:11
859500 -- (-1421.216) (-1422.976) (-1419.196) [-1420.258] * (-1418.548) (-1422.743) (-1418.754) [-1419.500] -- 0:00:11
860000 -- (-1420.560) (-1418.639) [-1418.953] (-1419.581) * (-1418.234) (-1420.010) [-1419.798] (-1421.938) -- 0:00:11
Average standard deviation of split frequencies: 0.006196
860500 -- (-1420.439) [-1418.503] (-1418.804) (-1421.352) * (-1418.844) [-1420.354] (-1420.290) (-1423.221) -- 0:00:11
861000 -- (-1420.036) (-1419.423) [-1419.463] (-1422.492) * [-1419.698] (-1423.079) (-1419.633) (-1422.225) -- 0:00:11
861500 -- (-1421.142) (-1419.133) [-1422.223] (-1420.962) * (-1418.492) (-1418.585) [-1420.611] (-1419.946) -- 0:00:11
862000 -- (-1418.658) (-1422.899) (-1418.727) [-1419.555] * (-1420.737) (-1418.754) [-1418.238] (-1420.981) -- 0:00:11
862500 -- (-1420.177) (-1420.283) (-1419.953) [-1420.053] * [-1422.405] (-1419.088) (-1418.108) (-1422.398) -- 0:00:11
863000 -- [-1420.010] (-1421.410) (-1424.004) (-1421.516) * (-1421.404) (-1418.958) [-1420.564] (-1423.683) -- 0:00:11
863500 -- (-1423.287) [-1424.496] (-1423.932) (-1421.715) * [-1425.477] (-1420.278) (-1419.145) (-1424.567) -- 0:00:11
864000 -- [-1419.646] (-1423.617) (-1419.922) (-1420.650) * (-1418.773) (-1419.517) (-1420.022) [-1421.826] -- 0:00:11
864500 -- (-1420.984) (-1419.363) (-1420.295) [-1419.490] * [-1420.208] (-1419.277) (-1419.099) (-1420.945) -- 0:00:11
865000 -- (-1422.272) (-1421.641) [-1419.825] (-1419.948) * (-1417.791) (-1418.792) (-1418.290) [-1420.640] -- 0:00:11
Average standard deviation of split frequencies: 0.005572
865500 -- [-1419.503] (-1420.627) (-1418.440) (-1420.020) * [-1420.429] (-1419.193) (-1418.472) (-1419.484) -- 0:00:11
866000 -- (-1418.787) (-1419.592) [-1419.058] (-1418.587) * (-1421.846) [-1418.360] (-1420.398) (-1418.896) -- 0:00:10
866500 -- (-1419.619) [-1419.207] (-1420.168) (-1419.693) * [-1420.594] (-1422.138) (-1419.224) (-1419.379) -- 0:00:10
867000 -- (-1423.096) (-1420.437) (-1419.438) [-1418.928] * [-1418.984] (-1422.118) (-1419.028) (-1418.855) -- 0:00:10
867500 -- (-1420.588) (-1425.618) [-1421.010] (-1418.197) * [-1419.425] (-1418.346) (-1419.896) (-1419.564) -- 0:00:10
868000 -- [-1420.928] (-1419.917) (-1420.650) (-1418.250) * (-1421.808) [-1423.765] (-1419.482) (-1418.959) -- 0:00:10
868500 -- (-1420.250) (-1423.219) (-1420.745) [-1418.621] * (-1419.749) (-1423.946) [-1418.381] (-1423.485) -- 0:00:10
869000 -- (-1426.620) (-1421.439) [-1417.943] (-1418.477) * (-1418.139) (-1419.271) [-1421.111] (-1420.006) -- 0:00:10
869500 -- (-1425.368) [-1422.378] (-1419.559) (-1422.166) * (-1418.318) (-1423.859) (-1420.521) [-1422.163] -- 0:00:10
870000 -- (-1418.639) [-1418.405] (-1420.733) (-1422.404) * [-1418.782] (-1420.003) (-1420.968) (-1422.045) -- 0:00:10
Average standard deviation of split frequencies: 0.006656
870500 -- [-1420.727] (-1418.364) (-1421.341) (-1419.284) * (-1420.137) (-1419.348) (-1419.033) [-1420.559] -- 0:00:10
871000 -- (-1421.622) (-1419.272) [-1420.141] (-1419.970) * (-1423.933) (-1422.892) (-1418.785) [-1421.204] -- 0:00:10
871500 -- (-1418.129) (-1421.115) [-1424.067] (-1418.484) * [-1420.506] (-1421.976) (-1418.734) (-1418.845) -- 0:00:10
872000 -- (-1421.643) (-1418.106) (-1419.806) [-1419.407] * [-1420.495] (-1420.460) (-1417.756) (-1418.177) -- 0:00:10
872500 -- (-1421.442) (-1417.986) (-1423.762) [-1417.942] * (-1423.004) [-1420.916] (-1418.087) (-1420.562) -- 0:00:10
873000 -- (-1418.895) [-1420.387] (-1421.668) (-1419.274) * (-1419.230) (-1421.554) [-1421.262] (-1418.794) -- 0:00:10
873500 -- (-1418.638) (-1417.754) (-1418.737) [-1419.155] * (-1420.718) (-1421.180) [-1421.601] (-1420.159) -- 0:00:10
874000 -- (-1417.927) (-1418.541) [-1417.855] (-1419.366) * [-1420.076] (-1422.696) (-1420.000) (-1420.827) -- 0:00:10
874500 -- (-1423.774) (-1419.642) (-1420.632) [-1418.323] * (-1424.498) [-1420.690] (-1418.873) (-1421.403) -- 0:00:10
875000 -- (-1418.939) (-1422.921) (-1419.244) [-1419.583] * [-1419.659] (-1420.744) (-1421.384) (-1425.905) -- 0:00:10
Average standard deviation of split frequencies: 0.006742
875500 -- (-1420.049) [-1418.095] (-1418.763) (-1421.016) * [-1419.541] (-1426.091) (-1420.643) (-1418.367) -- 0:00:10
876000 -- (-1423.558) [-1420.590] (-1418.619) (-1419.504) * (-1419.391) [-1422.047] (-1422.029) (-1418.234) -- 0:00:10
876500 -- (-1424.605) [-1422.026] (-1418.277) (-1420.637) * (-1419.391) (-1422.152) (-1420.390) [-1425.377] -- 0:00:10
877000 -- (-1417.557) [-1421.408] (-1419.508) (-1422.158) * (-1419.397) (-1420.059) [-1421.136] (-1418.955) -- 0:00:10
877500 -- (-1420.176) (-1420.286) (-1421.270) [-1419.608] * (-1418.978) [-1419.005] (-1420.183) (-1417.702) -- 0:00:10
878000 -- (-1420.439) (-1424.789) [-1418.722] (-1418.654) * (-1419.482) (-1422.752) [-1419.858] (-1418.147) -- 0:00:10
878500 -- [-1419.723] (-1420.083) (-1419.506) (-1419.395) * (-1421.677) (-1425.204) (-1419.274) [-1417.729] -- 0:00:09
879000 -- (-1419.739) (-1420.152) (-1418.801) [-1421.653] * [-1418.996] (-1419.641) (-1420.210) (-1420.602) -- 0:00:09
879500 -- [-1418.802] (-1421.092) (-1420.253) (-1419.362) * (-1418.829) (-1419.185) (-1420.093) [-1419.332] -- 0:00:09
880000 -- (-1418.381) [-1420.052] (-1420.730) (-1419.783) * (-1418.517) [-1417.793] (-1421.984) (-1420.079) -- 0:00:09
Average standard deviation of split frequencies: 0.006675
880500 -- [-1419.411] (-1417.865) (-1420.746) (-1420.053) * (-1420.556) (-1419.379) [-1421.762] (-1421.466) -- 0:00:09
881000 -- (-1419.085) (-1419.374) (-1419.862) [-1420.952] * (-1420.750) [-1422.322] (-1422.721) (-1419.438) -- 0:00:09
881500 -- (-1418.949) (-1419.108) (-1419.727) [-1418.399] * (-1421.903) (-1422.103) [-1419.460] (-1418.168) -- 0:00:09
882000 -- (-1423.315) [-1421.530] (-1418.418) (-1418.266) * (-1426.689) (-1418.667) [-1419.272] (-1423.640) -- 0:00:09
882500 -- (-1419.865) [-1419.136] (-1418.168) (-1418.423) * (-1424.779) (-1420.496) (-1418.623) [-1419.516] -- 0:00:09
883000 -- (-1420.270) (-1421.763) [-1418.888] (-1417.819) * (-1420.962) (-1425.647) [-1418.787] (-1419.803) -- 0:00:09
883500 -- (-1417.723) (-1419.387) [-1419.709] (-1421.167) * (-1423.063) (-1420.515) [-1420.594] (-1420.635) -- 0:00:09
884000 -- (-1420.456) (-1418.752) (-1418.436) [-1420.744] * [-1418.154] (-1420.146) (-1418.608) (-1424.199) -- 0:00:09
884500 -- (-1419.410) (-1421.061) (-1419.664) [-1419.742] * (-1419.887) (-1419.293) (-1418.036) [-1419.504] -- 0:00:09
885000 -- (-1420.814) [-1420.374] (-1417.921) (-1421.742) * (-1419.245) (-1418.427) (-1418.248) [-1420.080] -- 0:00:09
Average standard deviation of split frequencies: 0.006604
885500 -- [-1420.841] (-1420.375) (-1425.168) (-1419.999) * (-1422.412) [-1419.542] (-1418.517) (-1420.253) -- 0:00:09
886000 -- (-1418.443) (-1418.725) [-1421.472] (-1422.317) * [-1421.582] (-1419.596) (-1420.354) (-1422.623) -- 0:00:09
886500 -- [-1422.893] (-1419.904) (-1419.760) (-1421.519) * (-1423.650) (-1422.178) [-1419.384] (-1421.324) -- 0:00:09
887000 -- [-1419.130] (-1419.629) (-1418.806) (-1422.125) * (-1420.225) (-1420.516) [-1417.986] (-1421.120) -- 0:00:09
887500 -- [-1421.516] (-1422.395) (-1425.688) (-1423.653) * (-1421.061) [-1418.410] (-1418.287) (-1418.326) -- 0:00:09
888000 -- [-1419.170] (-1423.632) (-1421.379) (-1421.826) * (-1418.462) (-1422.366) [-1418.553] (-1419.031) -- 0:00:09
888500 -- (-1419.412) [-1420.533] (-1421.586) (-1421.176) * [-1420.245] (-1419.885) (-1421.416) (-1420.559) -- 0:00:09
889000 -- (-1420.006) (-1418.470) [-1419.927] (-1419.854) * [-1420.067] (-1419.059) (-1424.837) (-1419.196) -- 0:00:09
889500 -- (-1420.661) (-1418.666) [-1417.919] (-1420.001) * (-1421.910) (-1421.405) [-1418.800] (-1420.770) -- 0:00:09
890000 -- (-1422.183) (-1419.058) (-1418.420) [-1417.879] * (-1425.437) [-1417.675] (-1418.779) (-1421.289) -- 0:00:09
Average standard deviation of split frequencies: 0.006320
890500 -- (-1423.994) (-1421.938) (-1418.084) [-1417.669] * (-1424.063) (-1419.123) [-1418.959] (-1418.926) -- 0:00:08
891000 -- (-1419.161) (-1419.083) [-1418.850] (-1417.653) * [-1419.513] (-1418.749) (-1422.272) (-1420.123) -- 0:00:08
891500 -- (-1419.197) [-1419.621] (-1420.384) (-1418.321) * [-1420.823] (-1417.700) (-1420.373) (-1418.243) -- 0:00:08
892000 -- (-1418.850) (-1419.984) [-1422.221] (-1418.430) * (-1422.267) [-1422.478] (-1419.330) (-1418.760) -- 0:00:08
892500 -- (-1418.851) [-1418.659] (-1419.601) (-1418.980) * (-1422.806) (-1420.196) (-1420.300) [-1419.273] -- 0:00:08
893000 -- (-1423.076) (-1418.006) [-1418.706] (-1420.272) * (-1422.021) (-1420.088) [-1424.080] (-1425.306) -- 0:00:08
893500 -- (-1420.342) (-1417.924) [-1419.715] (-1422.707) * (-1421.080) (-1420.222) (-1420.933) [-1419.490] -- 0:00:08
894000 -- [-1419.031] (-1422.599) (-1424.492) (-1420.052) * (-1424.310) [-1419.907] (-1421.278) (-1418.938) -- 0:00:08
894500 -- (-1422.533) [-1423.209] (-1422.242) (-1423.005) * (-1423.487) [-1419.719] (-1423.256) (-1425.257) -- 0:00:08
895000 -- [-1419.596] (-1419.241) (-1422.227) (-1420.528) * [-1420.204] (-1419.738) (-1422.322) (-1424.313) -- 0:00:08
Average standard deviation of split frequencies: 0.006468
895500 -- (-1422.901) [-1421.376] (-1420.052) (-1417.991) * [-1420.684] (-1421.900) (-1424.788) (-1423.178) -- 0:00:08
896000 -- (-1420.230) [-1420.328] (-1418.697) (-1418.983) * (-1423.583) (-1418.330) (-1420.879) [-1418.130] -- 0:00:08
896500 -- (-1423.308) (-1419.675) (-1418.972) [-1418.602] * (-1419.936) (-1418.017) (-1422.027) [-1418.101] -- 0:00:08
897000 -- (-1421.249) (-1418.970) [-1420.220] (-1420.046) * (-1423.764) (-1420.006) (-1422.585) [-1419.030] -- 0:00:08
897500 -- (-1422.546) [-1422.195] (-1420.915) (-1418.400) * (-1423.966) [-1418.891] (-1424.531) (-1422.053) -- 0:00:08
898000 -- (-1418.181) (-1421.648) [-1419.733] (-1421.002) * (-1418.769) [-1418.613] (-1422.897) (-1427.758) -- 0:00:08
898500 -- (-1418.533) (-1426.840) (-1421.998) [-1424.021] * (-1421.260) (-1420.294) [-1419.687] (-1426.855) -- 0:00:08
899000 -- (-1419.128) [-1420.205] (-1420.839) (-1420.790) * [-1419.029] (-1426.688) (-1419.585) (-1422.264) -- 0:00:08
899500 -- [-1418.181] (-1419.623) (-1419.593) (-1419.067) * [-1419.693] (-1419.932) (-1419.119) (-1420.068) -- 0:00:08
900000 -- (-1421.851) (-1419.333) (-1418.701) [-1419.754] * (-1418.999) [-1421.579] (-1422.224) (-1418.474) -- 0:00:08
Average standard deviation of split frequencies: 0.006188
900500 -- (-1420.381) [-1419.988] (-1419.481) (-1419.704) * (-1418.874) [-1418.004] (-1425.236) (-1418.050) -- 0:00:08
901000 -- (-1419.842) (-1421.172) (-1420.351) [-1419.673] * (-1419.110) (-1419.896) (-1418.449) [-1418.305] -- 0:00:08
901500 -- [-1419.444] (-1419.406) (-1420.344) (-1420.120) * [-1420.194] (-1422.117) (-1418.620) (-1421.091) -- 0:00:08
902000 -- (-1421.320) (-1419.498) [-1419.680] (-1419.344) * (-1420.190) [-1419.462] (-1418.787) (-1421.707) -- 0:00:08
902500 -- (-1419.875) [-1418.024] (-1419.428) (-1421.297) * (-1420.712) (-1423.195) [-1419.949] (-1423.026) -- 0:00:07
903000 -- (-1423.841) (-1420.575) (-1422.896) [-1421.455] * (-1419.167) [-1423.565] (-1420.483) (-1420.381) -- 0:00:07
903500 -- (-1419.024) [-1419.955] (-1421.694) (-1421.058) * [-1419.128] (-1423.899) (-1419.855) (-1421.695) -- 0:00:07
904000 -- [-1418.837] (-1418.979) (-1417.906) (-1421.796) * (-1422.207) (-1423.631) [-1419.694] (-1419.083) -- 0:00:07
904500 -- [-1419.277] (-1419.586) (-1418.079) (-1420.782) * (-1420.023) (-1420.388) (-1420.037) [-1425.104] -- 0:00:07
905000 -- (-1419.001) (-1421.626) (-1418.800) [-1421.282] * (-1421.157) (-1419.550) [-1417.888] (-1423.279) -- 0:00:07
Average standard deviation of split frequencies: 0.006183
905500 -- (-1422.025) (-1418.949) (-1418.210) [-1418.606] * (-1418.490) (-1422.273) [-1421.136] (-1418.809) -- 0:00:07
906000 -- (-1419.188) (-1421.047) (-1421.691) [-1419.701] * (-1421.570) (-1420.016) (-1421.019) [-1418.864] -- 0:00:07
906500 -- (-1424.189) (-1421.741) [-1418.921] (-1419.338) * [-1420.337] (-1419.599) (-1421.761) (-1418.651) -- 0:00:07
907000 -- [-1418.779] (-1419.388) (-1418.952) (-1419.352) * (-1420.903) [-1419.066] (-1420.578) (-1422.700) -- 0:00:07
907500 -- (-1422.058) (-1418.345) [-1418.041] (-1425.392) * [-1421.302] (-1421.275) (-1421.137) (-1418.132) -- 0:00:07
908000 -- (-1423.509) (-1420.954) (-1419.721) [-1419.954] * (-1419.483) [-1420.646] (-1421.946) (-1420.453) -- 0:00:07
908500 -- (-1424.226) [-1418.359] (-1420.894) (-1419.024) * [-1420.744] (-1419.445) (-1420.045) (-1421.909) -- 0:00:07
909000 -- (-1425.686) (-1421.390) [-1420.592] (-1420.381) * (-1421.212) (-1420.078) [-1419.484] (-1421.718) -- 0:00:07
909500 -- [-1426.108] (-1421.673) (-1418.222) (-1419.739) * (-1423.605) (-1422.232) [-1420.060] (-1420.081) -- 0:00:07
910000 -- (-1419.537) [-1420.630] (-1417.856) (-1419.244) * (-1421.869) (-1418.864) [-1424.090] (-1422.653) -- 0:00:07
Average standard deviation of split frequencies: 0.006303
910500 -- (-1419.649) (-1418.497) (-1420.530) [-1419.337] * (-1423.351) [-1419.449] (-1419.455) (-1419.966) -- 0:00:07
911000 -- (-1423.839) (-1418.523) (-1418.013) [-1420.254] * (-1421.740) (-1419.848) (-1420.397) [-1421.926] -- 0:00:07
911500 -- (-1422.435) [-1418.755] (-1418.338) (-1423.414) * (-1421.112) (-1418.038) (-1419.400) [-1420.303] -- 0:00:07
912000 -- (-1422.344) (-1420.111) (-1420.911) [-1420.722] * [-1421.596] (-1420.266) (-1419.536) (-1418.577) -- 0:00:07
912500 -- [-1421.556] (-1418.793) (-1423.636) (-1418.635) * [-1418.571] (-1418.822) (-1420.984) (-1419.521) -- 0:00:07
913000 -- (-1424.530) [-1420.391] (-1421.076) (-1419.458) * [-1420.747] (-1421.489) (-1426.527) (-1418.987) -- 0:00:07
913500 -- (-1418.126) [-1419.802] (-1427.445) (-1418.905) * (-1421.243) (-1418.768) (-1424.798) [-1421.994] -- 0:00:07
914000 -- [-1425.154] (-1421.015) (-1419.704) (-1421.656) * (-1420.441) [-1419.507] (-1421.132) (-1424.321) -- 0:00:07
914500 -- (-1419.102) (-1425.037) [-1420.895] (-1419.455) * (-1420.441) [-1419.685] (-1420.826) (-1426.620) -- 0:00:07
915000 -- [-1420.143] (-1419.735) (-1419.063) (-1418.779) * (-1417.860) (-1422.529) [-1426.454] (-1428.826) -- 0:00:06
Average standard deviation of split frequencies: 0.005983
915500 -- (-1420.289) [-1420.401] (-1421.791) (-1423.809) * (-1421.837) (-1418.891) (-1420.983) [-1420.812] -- 0:00:06
916000 -- [-1419.145] (-1424.521) (-1425.242) (-1419.442) * [-1417.759] (-1418.683) (-1419.092) (-1420.276) -- 0:00:06
916500 -- (-1420.023) (-1422.031) [-1421.820] (-1423.833) * (-1421.481) (-1422.582) (-1419.362) [-1428.440] -- 0:00:06
917000 -- (-1418.326) (-1421.757) [-1419.716] (-1422.555) * [-1419.844] (-1423.190) (-1418.225) (-1424.317) -- 0:00:06
917500 -- [-1418.264] (-1421.072) (-1420.239) (-1422.964) * [-1418.476] (-1421.888) (-1420.950) (-1420.689) -- 0:00:06
918000 -- (-1418.497) [-1419.849] (-1422.884) (-1419.812) * (-1419.550) (-1417.760) (-1421.132) [-1418.077] -- 0:00:06
918500 -- (-1419.181) (-1419.313) (-1421.057) [-1418.862] * (-1418.680) (-1418.272) (-1419.608) [-1418.513] -- 0:00:06
919000 -- [-1418.398] (-1421.132) (-1423.774) (-1419.892) * (-1421.136) (-1420.667) (-1421.699) [-1417.875] -- 0:00:06
919500 -- (-1418.225) [-1419.278] (-1420.931) (-1420.995) * (-1421.011) [-1419.506] (-1421.091) (-1419.401) -- 0:00:06
920000 -- (-1418.858) (-1418.753) (-1419.137) [-1422.348] * (-1420.967) (-1422.714) [-1419.983] (-1418.793) -- 0:00:06
Average standard deviation of split frequencies: 0.006240
920500 -- (-1419.630) (-1417.956) (-1422.235) [-1419.088] * [-1419.902] (-1421.541) (-1418.922) (-1419.904) -- 0:00:06
921000 -- (-1425.844) (-1421.877) (-1425.876) [-1419.955] * (-1419.013) (-1419.321) [-1423.249] (-1421.981) -- 0:00:06
921500 -- (-1421.169) [-1420.275] (-1417.680) (-1419.657) * (-1419.619) [-1418.578] (-1424.265) (-1424.383) -- 0:00:06
922000 -- [-1421.349] (-1420.376) (-1417.660) (-1419.372) * (-1420.943) (-1420.804) [-1421.834] (-1420.732) -- 0:00:06
922500 -- [-1421.815] (-1422.152) (-1418.633) (-1421.015) * (-1420.944) (-1421.264) (-1423.427) [-1421.212] -- 0:00:06
923000 -- [-1420.136] (-1417.747) (-1419.485) (-1418.660) * [-1419.062] (-1420.702) (-1422.454) (-1420.389) -- 0:00:06
923500 -- (-1422.440) (-1417.880) (-1419.546) [-1419.048] * [-1421.116] (-1422.613) (-1421.080) (-1418.362) -- 0:00:06
924000 -- [-1422.051] (-1421.371) (-1428.687) (-1420.590) * [-1418.563] (-1421.703) (-1421.108) (-1420.835) -- 0:00:06
924500 -- [-1417.692] (-1420.418) (-1422.135) (-1418.612) * (-1420.223) (-1420.094) [-1428.896] (-1419.998) -- 0:00:06
925000 -- (-1420.155) [-1419.540] (-1418.398) (-1419.133) * (-1419.266) [-1420.873] (-1420.229) (-1419.218) -- 0:00:06
Average standard deviation of split frequencies: 0.006738
925500 -- (-1419.145) [-1419.088] (-1418.572) (-1421.117) * (-1419.299) [-1418.950] (-1418.445) (-1420.045) -- 0:00:06
926000 -- (-1419.450) [-1419.765] (-1418.754) (-1419.546) * (-1419.559) [-1420.103] (-1418.324) (-1419.933) -- 0:00:06
926500 -- (-1419.251) [-1418.248] (-1424.696) (-1419.544) * (-1419.555) (-1418.278) (-1420.510) [-1419.589] -- 0:00:06
927000 -- [-1420.183] (-1418.067) (-1418.498) (-1420.165) * (-1424.712) [-1419.140] (-1417.965) (-1418.449) -- 0:00:05
927500 -- (-1422.406) (-1422.411) (-1418.681) [-1420.071] * (-1424.956) (-1422.751) (-1419.829) [-1419.578] -- 0:00:05
928000 -- (-1418.890) (-1420.353) [-1418.794] (-1418.713) * [-1422.564] (-1417.876) (-1420.577) (-1419.508) -- 0:00:05
928500 -- (-1418.986) (-1419.222) [-1421.992] (-1417.932) * (-1423.941) [-1418.810] (-1419.844) (-1418.254) -- 0:00:05
929000 -- [-1420.529] (-1417.792) (-1420.293) (-1419.017) * (-1418.757) (-1420.132) [-1418.221] (-1418.010) -- 0:00:05
929500 -- (-1419.828) (-1426.592) (-1422.364) [-1418.984] * [-1418.597] (-1418.894) (-1420.225) (-1418.533) -- 0:00:05
930000 -- (-1419.633) (-1423.251) (-1420.759) [-1420.456] * (-1419.067) (-1423.191) (-1419.048) [-1419.300] -- 0:00:05
Average standard deviation of split frequencies: 0.006793
930500 -- [-1418.188] (-1421.397) (-1418.361) (-1420.349) * (-1422.279) (-1421.773) [-1419.106] (-1420.833) -- 0:00:05
931000 -- (-1418.414) [-1418.725] (-1423.839) (-1419.756) * (-1418.999) [-1419.201] (-1420.798) (-1423.111) -- 0:00:05
931500 -- (-1419.214) (-1418.550) [-1421.039] (-1423.098) * (-1419.047) (-1424.797) [-1419.036] (-1418.359) -- 0:00:05
932000 -- (-1419.530) (-1418.144) [-1418.752] (-1419.891) * (-1420.624) (-1425.999) (-1420.807) [-1418.885] -- 0:00:05
932500 -- (-1421.322) (-1418.424) [-1417.912] (-1422.929) * (-1419.768) (-1422.060) (-1421.062) [-1420.219] -- 0:00:05
933000 -- (-1419.974) [-1418.684] (-1419.214) (-1419.411) * (-1422.517) (-1420.927) (-1419.642) [-1419.544] -- 0:00:05
933500 -- (-1420.806) (-1419.459) [-1420.124] (-1420.211) * (-1424.532) (-1424.171) (-1424.020) [-1422.890] -- 0:00:05
934000 -- (-1420.603) [-1420.290] (-1420.071) (-1418.370) * (-1426.989) (-1420.171) (-1419.599) [-1419.869] -- 0:00:05
934500 -- (-1420.577) (-1422.104) (-1421.870) [-1418.552] * (-1426.846) [-1418.174] (-1420.907) (-1422.185) -- 0:00:05
935000 -- (-1418.488) (-1425.952) [-1419.524] (-1418.840) * (-1423.045) (-1419.238) (-1421.015) [-1418.842] -- 0:00:05
Average standard deviation of split frequencies: 0.006607
935500 -- (-1418.250) [-1419.167] (-1422.741) (-1418.310) * (-1422.144) (-1418.947) (-1417.917) [-1421.064] -- 0:00:05
936000 -- (-1419.326) [-1420.406] (-1422.326) (-1418.089) * [-1421.017] (-1418.759) (-1424.113) (-1418.769) -- 0:00:05
936500 -- (-1418.173) (-1418.302) (-1419.839) [-1418.347] * (-1421.666) (-1419.062) [-1421.990] (-1421.213) -- 0:00:05
937000 -- (-1417.949) (-1423.576) (-1419.667) [-1418.540] * (-1420.257) (-1419.511) [-1420.254] (-1420.107) -- 0:00:05
937500 -- (-1421.505) (-1419.609) (-1418.732) [-1420.577] * (-1420.196) [-1418.788] (-1422.150) (-1420.811) -- 0:00:05
938000 -- (-1420.682) (-1419.240) [-1418.009] (-1420.918) * (-1420.843) (-1423.327) [-1422.287] (-1418.767) -- 0:00:05
938500 -- (-1419.434) (-1420.769) [-1418.659] (-1423.339) * [-1418.402] (-1419.161) (-1420.365) (-1419.204) -- 0:00:05
939000 -- [-1419.022] (-1418.422) (-1418.773) (-1419.442) * [-1420.176] (-1421.240) (-1423.875) (-1426.006) -- 0:00:05
939500 -- (-1420.571) [-1418.282] (-1418.639) (-1422.822) * [-1421.562] (-1419.285) (-1423.025) (-1424.785) -- 0:00:04
940000 -- (-1420.610) [-1419.137] (-1419.244) (-1424.800) * (-1418.362) [-1419.908] (-1417.647) (-1420.836) -- 0:00:04
Average standard deviation of split frequencies: 0.006338
940500 -- (-1418.774) (-1418.608) (-1421.789) [-1420.805] * (-1418.362) (-1422.983) (-1417.993) [-1424.350] -- 0:00:04
941000 -- (-1418.891) [-1420.271] (-1419.583) (-1422.082) * [-1419.768] (-1422.044) (-1420.107) (-1420.290) -- 0:00:04
941500 -- (-1417.932) [-1420.419] (-1419.283) (-1420.574) * (-1421.054) (-1422.768) [-1418.863] (-1418.792) -- 0:00:04
942000 -- (-1421.542) [-1419.198] (-1419.993) (-1420.275) * (-1420.487) (-1421.340) [-1421.259] (-1419.869) -- 0:00:04
942500 -- (-1423.325) [-1421.324] (-1420.872) (-1421.070) * [-1420.650] (-1421.509) (-1425.164) (-1420.627) -- 0:00:04
943000 -- [-1419.642] (-1422.195) (-1420.819) (-1419.418) * (-1419.449) (-1419.091) (-1429.079) [-1419.344] -- 0:00:04
943500 -- [-1418.052] (-1421.241) (-1420.142) (-1418.132) * (-1418.421) [-1419.222] (-1422.499) (-1419.771) -- 0:00:04
944000 -- (-1421.104) (-1421.682) (-1425.398) [-1418.383] * (-1418.495) (-1420.402) [-1418.726] (-1421.860) -- 0:00:04
944500 -- (-1421.197) (-1425.581) (-1420.077) [-1418.834] * [-1419.785] (-1424.449) (-1419.808) (-1420.033) -- 0:00:04
945000 -- (-1419.969) (-1421.164) (-1419.932) [-1419.370] * (-1419.831) (-1421.669) [-1422.471] (-1419.888) -- 0:00:04
Average standard deviation of split frequencies: 0.006185
945500 -- (-1418.222) (-1419.945) (-1423.205) [-1419.537] * [-1418.871] (-1418.957) (-1420.094) (-1417.974) -- 0:00:04
946000 -- [-1418.744] (-1419.166) (-1418.979) (-1419.849) * [-1420.593] (-1419.541) (-1420.543) (-1419.159) -- 0:00:04
946500 -- (-1418.035) (-1419.761) [-1420.583] (-1420.950) * (-1421.572) (-1419.939) [-1421.816] (-1418.648) -- 0:00:04
947000 -- (-1419.111) [-1420.700] (-1422.289) (-1423.364) * (-1419.582) (-1419.924) [-1420.978] (-1424.319) -- 0:00:04
947500 -- (-1419.426) (-1419.627) (-1423.191) [-1421.426] * (-1419.015) (-1419.557) (-1422.380) [-1419.395] -- 0:00:04
948000 -- (-1419.013) [-1421.801] (-1418.213) (-1420.469) * (-1427.885) [-1421.076] (-1420.145) (-1418.988) -- 0:00:04
948500 -- (-1418.972) (-1422.088) [-1418.475] (-1421.557) * (-1423.413) [-1421.118] (-1420.617) (-1418.196) -- 0:00:04
949000 -- (-1418.321) [-1420.010] (-1418.497) (-1424.062) * (-1418.862) (-1420.701) [-1420.815] (-1419.291) -- 0:00:04
949500 -- (-1418.185) (-1420.733) [-1418.900] (-1421.272) * (-1418.796) (-1418.787) [-1422.092] (-1421.247) -- 0:00:04
950000 -- (-1418.933) (-1420.272) (-1420.845) [-1421.930] * (-1419.604) [-1418.747] (-1421.309) (-1422.162) -- 0:00:04
Average standard deviation of split frequencies: 0.006330
950500 -- (-1419.195) [-1419.572] (-1419.519) (-1419.815) * (-1419.420) (-1423.217) [-1418.849] (-1420.374) -- 0:00:04
951000 -- (-1419.024) (-1419.670) (-1419.216) [-1418.935] * (-1420.139) [-1422.613] (-1420.935) (-1420.822) -- 0:00:04
951500 -- (-1423.417) (-1422.245) [-1422.658] (-1422.493) * (-1419.845) [-1424.916] (-1421.654) (-1418.751) -- 0:00:03
952000 -- [-1423.576] (-1420.095) (-1422.042) (-1422.488) * (-1420.018) (-1423.343) [-1420.334] (-1422.953) -- 0:00:03
952500 -- (-1426.173) [-1419.213] (-1417.874) (-1420.591) * [-1421.349] (-1421.608) (-1420.412) (-1419.775) -- 0:00:03
953000 -- (-1420.465) (-1420.234) (-1422.294) [-1419.042] * (-1418.864) (-1421.046) [-1420.249] (-1422.830) -- 0:00:03
953500 -- (-1418.738) [-1419.554] (-1425.123) (-1417.952) * (-1420.818) (-1420.618) [-1421.216] (-1418.435) -- 0:00:03
954000 -- [-1418.699] (-1419.317) (-1419.722) (-1421.259) * (-1420.295) (-1422.545) (-1418.409) [-1418.848] -- 0:00:03
954500 -- [-1420.433] (-1420.611) (-1419.371) (-1419.162) * (-1420.031) [-1419.967] (-1418.117) (-1418.625) -- 0:00:03
955000 -- (-1422.315) [-1419.653] (-1421.223) (-1420.952) * (-1418.507) [-1419.939] (-1419.748) (-1419.946) -- 0:00:03
Average standard deviation of split frequencies: 0.006352
955500 -- (-1418.904) (-1421.376) (-1420.680) [-1419.618] * (-1420.324) (-1418.206) (-1420.273) [-1418.746] -- 0:00:03
956000 -- (-1418.009) (-1423.286) (-1421.573) [-1420.223] * (-1419.824) [-1419.536] (-1419.433) (-1419.328) -- 0:00:03
956500 -- (-1418.624) [-1421.847] (-1421.058) (-1421.470) * (-1422.534) (-1419.267) (-1422.747) [-1418.211] -- 0:00:03
957000 -- (-1425.427) (-1421.273) (-1421.163) [-1419.073] * [-1419.859] (-1419.858) (-1423.925) (-1419.828) -- 0:00:03
957500 -- (-1421.139) [-1421.456] (-1419.508) (-1420.055) * [-1420.702] (-1424.003) (-1418.909) (-1419.176) -- 0:00:03
958000 -- (-1420.300) [-1418.463] (-1419.508) (-1420.646) * (-1422.484) (-1418.287) [-1418.708] (-1418.050) -- 0:00:03
958500 -- (-1418.549) [-1418.094] (-1420.130) (-1418.997) * [-1418.616] (-1418.690) (-1419.045) (-1419.764) -- 0:00:03
959000 -- (-1418.486) [-1420.616] (-1420.047) (-1419.475) * (-1419.144) [-1419.011] (-1418.492) (-1420.941) -- 0:00:03
959500 -- [-1419.625] (-1421.006) (-1419.989) (-1419.329) * (-1419.216) (-1419.144) [-1419.120] (-1419.207) -- 0:00:03
960000 -- (-1420.925) [-1419.958] (-1419.240) (-1419.512) * (-1417.911) [-1420.050] (-1419.870) (-1422.519) -- 0:00:03
Average standard deviation of split frequencies: 0.006523
960500 -- (-1418.865) (-1421.138) (-1419.732) [-1418.004] * [-1418.585] (-1419.178) (-1421.587) (-1420.005) -- 0:00:03
961000 -- [-1420.083] (-1421.806) (-1423.301) (-1421.251) * [-1420.443] (-1418.275) (-1420.358) (-1418.593) -- 0:00:03
961500 -- (-1421.499) (-1419.774) [-1422.915] (-1418.574) * [-1421.599] (-1419.707) (-1419.348) (-1418.368) -- 0:00:03
962000 -- (-1421.462) (-1423.127) (-1419.762) [-1421.087] * [-1419.023] (-1418.594) (-1419.683) (-1418.376) -- 0:00:03
962500 -- (-1420.416) [-1418.035] (-1420.348) (-1426.641) * (-1418.596) (-1419.738) [-1426.733] (-1420.021) -- 0:00:03
963000 -- (-1424.513) (-1418.193) (-1419.540) [-1424.888] * (-1423.089) [-1419.618] (-1422.500) (-1420.269) -- 0:00:03
963500 -- (-1418.821) [-1417.888] (-1419.912) (-1421.515) * (-1420.099) (-1418.078) [-1419.559] (-1421.720) -- 0:00:02
964000 -- (-1419.561) (-1422.321) [-1421.225] (-1423.061) * (-1418.237) [-1419.280] (-1422.090) (-1419.086) -- 0:00:02
964500 -- (-1421.275) (-1419.923) [-1421.096] (-1418.796) * [-1420.617] (-1419.874) (-1426.657) (-1420.719) -- 0:00:02
965000 -- (-1417.816) (-1420.242) [-1418.847] (-1424.697) * (-1418.227) (-1422.335) [-1420.266] (-1421.363) -- 0:00:02
Average standard deviation of split frequencies: 0.006717
965500 -- (-1418.800) (-1422.733) (-1418.280) [-1420.399] * (-1418.927) (-1419.797) [-1420.433] (-1422.298) -- 0:00:02
966000 -- (-1419.269) [-1421.466] (-1419.801) (-1418.787) * (-1423.992) (-1419.207) [-1420.157] (-1418.982) -- 0:00:02
966500 -- (-1419.455) (-1418.692) (-1421.616) [-1418.476] * (-1418.714) (-1417.929) [-1419.254] (-1422.150) -- 0:00:02
967000 -- (-1419.560) [-1422.255] (-1422.735) (-1418.459) * (-1418.370) [-1422.087] (-1420.892) (-1425.021) -- 0:00:02
967500 -- (-1420.193) (-1421.181) (-1420.536) [-1420.021] * (-1418.343) [-1419.331] (-1419.069) (-1420.079) -- 0:00:02
968000 -- (-1421.663) [-1418.753] (-1420.378) (-1419.826) * (-1420.467) (-1422.301) (-1419.090) [-1425.047] -- 0:00:02
968500 -- (-1425.894) (-1418.636) [-1421.154] (-1422.952) * (-1420.370) (-1418.175) (-1422.981) [-1420.750] -- 0:00:02
969000 -- [-1423.637] (-1418.930) (-1419.005) (-1419.294) * (-1419.045) (-1425.805) (-1420.190) [-1419.112] -- 0:00:02
969500 -- [-1423.249] (-1418.968) (-1419.029) (-1422.744) * (-1418.512) [-1421.471] (-1419.057) (-1420.098) -- 0:00:02
970000 -- (-1419.606) (-1418.808) (-1421.142) [-1422.813] * (-1418.341) (-1418.406) [-1419.037] (-1419.964) -- 0:00:02
Average standard deviation of split frequencies: 0.006513
970500 -- (-1420.382) (-1418.136) (-1420.473) [-1420.727] * (-1418.628) (-1418.566) (-1419.610) [-1418.366] -- 0:00:02
971000 -- [-1419.179] (-1420.133) (-1419.845) (-1419.322) * (-1419.833) (-1418.219) (-1420.774) [-1418.309] -- 0:00:02
971500 -- (-1419.052) (-1420.425) (-1418.980) [-1420.635] * (-1420.480) (-1418.479) [-1418.634] (-1417.647) -- 0:00:02
972000 -- [-1420.421] (-1422.127) (-1421.108) (-1420.264) * [-1418.459] (-1418.868) (-1420.816) (-1419.914) -- 0:00:02
972500 -- [-1419.916] (-1419.549) (-1420.011) (-1419.772) * (-1419.083) [-1418.005] (-1420.530) (-1417.796) -- 0:00:02
973000 -- (-1421.929) [-1418.771] (-1419.616) (-1419.014) * (-1418.952) (-1418.253) [-1420.058] (-1419.714) -- 0:00:02
973500 -- (-1423.594) (-1421.554) [-1418.152] (-1419.212) * (-1425.989) (-1418.757) [-1418.376] (-1419.123) -- 0:00:02
974000 -- (-1419.654) [-1417.847] (-1420.203) (-1420.388) * (-1420.848) (-1421.540) (-1418.720) [-1419.112] -- 0:00:02
974500 -- (-1420.490) (-1419.249) (-1419.384) [-1419.222] * (-1420.375) (-1421.716) [-1418.162] (-1418.440) -- 0:00:02
975000 -- (-1419.206) (-1420.097) (-1420.917) [-1419.148] * [-1420.731] (-1419.577) (-1420.100) (-1419.810) -- 0:00:02
Average standard deviation of split frequencies: 0.006449
975500 -- (-1419.163) (-1419.715) [-1419.721] (-1420.088) * (-1421.805) (-1417.893) [-1419.661] (-1421.334) -- 0:00:02
976000 -- [-1419.982] (-1420.910) (-1420.241) (-1422.657) * (-1421.072) (-1421.104) [-1419.293] (-1418.092) -- 0:00:01
976500 -- (-1422.604) (-1420.725) (-1419.280) [-1417.966] * [-1418.153] (-1417.902) (-1418.153) (-1420.075) -- 0:00:01
977000 -- [-1419.464] (-1421.380) (-1417.719) (-1422.055) * (-1419.345) [-1422.259] (-1419.930) (-1420.314) -- 0:00:01
977500 -- [-1419.608] (-1419.656) (-1419.811) (-1418.930) * (-1418.982) [-1417.932] (-1418.481) (-1418.739) -- 0:00:01
978000 -- [-1418.971] (-1420.342) (-1422.383) (-1418.388) * (-1419.020) (-1418.401) (-1422.771) [-1420.571] -- 0:00:01
978500 -- [-1418.291] (-1419.731) (-1421.109) (-1422.262) * (-1419.436) (-1419.120) (-1422.824) [-1419.679] -- 0:00:01
979000 -- (-1418.723) [-1419.585] (-1423.762) (-1418.812) * (-1418.117) [-1418.652] (-1420.103) (-1418.062) -- 0:00:01
979500 -- (-1418.771) (-1421.386) [-1422.105] (-1418.020) * (-1418.270) (-1418.158) [-1418.841] (-1420.925) -- 0:00:01
980000 -- (-1419.301) (-1427.408) (-1418.907) [-1418.460] * (-1418.691) (-1418.107) (-1421.433) [-1419.582] -- 0:00:01
Average standard deviation of split frequencies: 0.006039
980500 -- [-1418.987] (-1420.273) (-1422.708) (-1419.700) * [-1418.754] (-1420.330) (-1418.986) (-1420.427) -- 0:00:01
981000 -- [-1424.069] (-1419.622) (-1420.130) (-1421.501) * (-1420.158) (-1418.155) (-1419.881) [-1419.866] -- 0:00:01
981500 -- (-1421.227) [-1419.677] (-1420.638) (-1420.962) * (-1419.233) (-1422.586) (-1420.497) [-1421.718] -- 0:00:01
982000 -- [-1422.565] (-1419.349) (-1420.445) (-1419.756) * (-1419.832) (-1419.121) [-1418.860] (-1421.051) -- 0:00:01
982500 -- (-1421.643) (-1420.650) [-1419.028] (-1418.367) * (-1421.043) (-1422.281) [-1418.417] (-1423.474) -- 0:00:01
983000 -- (-1419.355) [-1422.052] (-1418.800) (-1419.219) * (-1418.628) (-1421.867) (-1417.885) [-1423.658] -- 0:00:01
983500 -- [-1419.352] (-1420.203) (-1418.897) (-1423.200) * [-1419.570] (-1419.805) (-1417.699) (-1423.272) -- 0:00:01
984000 -- [-1418.237] (-1419.666) (-1422.684) (-1418.701) * [-1419.919] (-1422.820) (-1418.796) (-1418.968) -- 0:00:01
984500 -- (-1421.135) (-1424.212) [-1420.315] (-1418.091) * (-1421.484) (-1420.469) [-1417.636] (-1420.829) -- 0:00:01
985000 -- (-1420.168) [-1418.221] (-1418.210) (-1424.767) * (-1424.228) (-1421.167) [-1418.094] (-1418.655) -- 0:00:01
Average standard deviation of split frequencies: 0.005588
985500 -- (-1425.979) [-1417.767] (-1423.969) (-1420.372) * (-1421.339) (-1420.503) (-1418.382) [-1421.774] -- 0:00:01
986000 -- (-1427.749) (-1419.446) (-1422.259) [-1419.229] * (-1421.958) (-1419.312) (-1418.042) [-1419.847] -- 0:00:01
986500 -- (-1427.233) (-1417.712) (-1422.303) [-1421.503] * (-1420.775) [-1420.413] (-1419.678) (-1417.773) -- 0:00:01
987000 -- [-1421.547] (-1418.822) (-1419.871) (-1421.011) * (-1420.104) (-1419.072) [-1419.663] (-1422.330) -- 0:00:01
987500 -- (-1418.687) [-1419.167] (-1422.249) (-1422.858) * (-1421.057) [-1423.307] (-1418.664) (-1421.579) -- 0:00:01
988000 -- (-1424.081) (-1422.028) (-1421.005) [-1418.719] * (-1421.885) (-1421.381) [-1418.490] (-1419.599) -- 0:00:00
988500 -- (-1417.776) [-1418.297] (-1418.329) (-1420.153) * (-1423.766) (-1419.046) [-1420.436] (-1419.589) -- 0:00:00
989000 -- (-1422.229) (-1420.753) (-1419.389) [-1419.184] * [-1419.787] (-1418.209) (-1422.182) (-1418.956) -- 0:00:00
989500 -- (-1418.936) (-1425.626) [-1419.470] (-1418.035) * [-1417.933] (-1420.123) (-1421.775) (-1418.805) -- 0:00:00
990000 -- [-1418.834] (-1429.570) (-1419.635) (-1418.111) * (-1422.566) [-1417.951] (-1420.544) (-1418.138) -- 0:00:00
Average standard deviation of split frequencies: 0.005770
990500 -- (-1424.391) (-1422.428) [-1420.639] (-1418.711) * (-1421.146) (-1424.922) (-1421.574) [-1418.738] -- 0:00:00
991000 -- (-1421.098) [-1420.113] (-1420.256) (-1418.642) * (-1419.700) (-1418.280) [-1420.742] (-1420.035) -- 0:00:00
991500 -- (-1425.172) (-1423.354) [-1420.343] (-1428.364) * (-1420.060) [-1418.533] (-1420.189) (-1419.837) -- 0:00:00
992000 -- (-1421.896) (-1423.619) (-1419.913) [-1423.514] * (-1422.216) (-1418.657) (-1418.476) [-1418.668] -- 0:00:00
992500 -- (-1419.398) (-1421.387) [-1421.190] (-1423.517) * (-1420.090) (-1419.909) (-1418.045) [-1421.873] -- 0:00:00
993000 -- (-1417.733) (-1423.673) [-1420.020] (-1422.601) * [-1420.594] (-1419.211) (-1417.875) (-1420.761) -- 0:00:00
993500 -- (-1422.453) (-1419.579) (-1420.333) [-1418.679] * (-1418.426) (-1420.690) (-1418.827) [-1419.065] -- 0:00:00
994000 -- (-1422.031) (-1419.383) [-1419.973] (-1418.865) * (-1419.790) [-1418.821] (-1419.053) (-1418.544) -- 0:00:00
994500 -- (-1417.718) [-1419.901] (-1418.300) (-1429.213) * (-1423.035) (-1418.122) (-1421.872) [-1420.391] -- 0:00:00
995000 -- (-1418.694) [-1418.652] (-1417.835) (-1419.942) * (-1419.841) (-1420.710) [-1419.989] (-1421.537) -- 0:00:00
Average standard deviation of split frequencies: 0.005768
995500 -- (-1421.792) [-1418.542] (-1420.364) (-1422.411) * [-1417.958] (-1418.978) (-1420.487) (-1422.255) -- 0:00:00
996000 -- (-1423.696) (-1420.076) (-1421.427) [-1419.530] * (-1418.852) (-1421.499) [-1423.323] (-1418.474) -- 0:00:00
996500 -- (-1423.127) (-1422.302) (-1418.378) [-1418.673] * (-1419.556) (-1419.899) (-1424.141) [-1418.605] -- 0:00:00
997000 -- [-1420.245] (-1421.938) (-1420.932) (-1418.673) * (-1418.116) (-1421.292) (-1418.751) [-1419.374] -- 0:00:00
997500 -- (-1419.354) (-1419.843) [-1420.175] (-1418.794) * [-1418.254] (-1422.823) (-1422.222) (-1423.039) -- 0:00:00
998000 -- (-1419.745) (-1420.431) (-1422.517) [-1417.813] * (-1418.563) (-1420.000) [-1420.923] (-1421.754) -- 0:00:00
998500 -- (-1419.260) (-1421.222) (-1418.543) [-1419.694] * (-1419.341) (-1420.255) [-1418.538] (-1422.216) -- 0:00:00
999000 -- [-1419.848] (-1425.539) (-1420.179) (-1426.832) * (-1421.028) (-1418.215) (-1422.843) [-1421.629] -- 0:00:00
999500 -- (-1421.157) (-1421.451) (-1421.509) [-1419.583] * [-1418.129] (-1420.434) (-1420.829) (-1422.745) -- 0:00:00
1000000 -- (-1418.524) (-1420.240) [-1418.872] (-1419.123) * (-1418.990) (-1420.831) [-1418.501] (-1421.496) -- 0:00:00
Average standard deviation of split frequencies: 0.005359
Analysis completed in 1 mins 22 seconds
Analysis used 80.38 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1417.50
Likelihood of best state for "cold" chain of run 2 was -1417.50
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 57 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
25.4 % ( 22 %) Dirichlet(Pi{all})
27.4 % ( 24 %) Slider(Pi{all})
79.1 % ( 50 %) Multiplier(Alpha{1,2})
77.8 % ( 54 %) Multiplier(Alpha{3})
17.9 % ( 16 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.2 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
25.5 % ( 38 %) Dirichlet(Pi{all})
27.7 % ( 18 %) Slider(Pi{all})
78.4 % ( 57 %) Multiplier(Alpha{1,2})
77.5 % ( 47 %) Multiplier(Alpha{3})
17.2 % ( 18 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.4 % ( 18 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167263 0.82 0.67
3 | 166526 165907 0.84
4 | 166619 166714 166971
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166833 0.82 0.66
3 | 166983 166488 0.84
4 | 166692 166557 166447
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1419.14
| 1 |
| |
| 12 2 1 2 1 1 2 1 |
| 1 1 2 22 1 *2 1 1 2 2 2 2 1 *|
|111 2 2 2 1 1 1 2 1 1 2 2 12 1 2 * |
| *1 1 1 11 2 121 22 |
| 2 22 1 * 2 2 11 12 1 21212 1 1 |
| 1 2 1 2 1 1 1 1 |
|2221 2 * 1 2 1 |
| 2 11 1 2 2 2 222 1 2 2 |
| 2 1 2 |
| 2 |
| 2 |
| 21 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1421.36
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1419.22 -1422.50
2 -1419.28 -1423.88
--------------------------------------
TOTAL -1419.25 -1423.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.906904 0.094326 0.371062 1.543757 0.868542 1501.00 1501.00 1.000
r(A<->C){all} 0.161862 0.020877 0.000049 0.463260 0.120635 52.29 79.84 1.000
r(A<->G){all} 0.157008 0.017452 0.000069 0.414592 0.121605 312.59 314.23 1.000
r(A<->T){all} 0.183698 0.021949 0.000004 0.485344 0.148110 165.13 247.39 1.001
r(C<->G){all} 0.166332 0.021804 0.000042 0.474846 0.122711 274.79 326.95 1.000
r(C<->T){all} 0.161098 0.019938 0.000069 0.455381 0.120884 241.05 263.63 1.005
r(G<->T){all} 0.170002 0.020613 0.000014 0.452959 0.131604 163.08 259.63 1.000
pi(A){all} 0.173670 0.000137 0.151167 0.197407 0.173448 1183.24 1342.12 1.000
pi(C){all} 0.277585 0.000182 0.250384 0.303173 0.277677 1166.06 1333.53 1.000
pi(G){all} 0.346165 0.000210 0.318045 0.374338 0.345764 1115.64 1189.51 1.000
pi(T){all} 0.202580 0.000158 0.178098 0.226182 0.202560 1340.00 1356.11 1.000
alpha{1,2} 0.422023 0.221271 0.000117 1.362955 0.252491 1104.83 1126.63 1.001
alpha{3} 0.450493 0.236367 0.000204 1.432836 0.290139 1317.30 1322.65 1.000
pinvar{all} 0.998468 0.000004 0.994862 0.999999 0.999054 1007.11 1149.43 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- ....**
9 -- .**.**
10 -- ...**.
11 -- ..****
12 -- .*...*
13 -- .***.*
14 -- ..**..
15 -- .**...
16 -- .*.*..
17 -- .*.***
18 -- ..*.*.
19 -- .*..*.
20 -- .****.
21 -- ...*.*
22 -- ..*.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.000000 0.152565 0.152565 2
8 458 0.152565 0.006595 0.147901 0.157229 2
9 455 0.151566 0.011777 0.143238 0.159893 2
10 452 0.150566 0.001884 0.149234 0.151899 2
11 451 0.150233 0.006124 0.145903 0.154564 2
12 450 0.149900 0.003769 0.147235 0.152565 2
13 449 0.149567 0.020257 0.135243 0.163891 2
14 443 0.147568 0.002355 0.145903 0.149234 2
15 426 0.141905 0.002827 0.139907 0.143904 2
16 423 0.140906 0.015546 0.129913 0.151899 2
17 405 0.134910 0.004240 0.131912 0.137908 2
18 403 0.134244 0.000471 0.133911 0.134577 2
19 402 0.133911 0.000000 0.133911 0.133911 2
20 383 0.127582 0.000471 0.127249 0.127915 2
21 377 0.125583 0.000471 0.125250 0.125916 2
22 291 0.096935 0.008951 0.090606 0.103264 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0348/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101943 0.010823 0.000007 0.310877 0.069019 1.000 2
length{all}[2] 0.100433 0.010226 0.000028 0.301218 0.069599 1.000 2
length{all}[3] 0.099473 0.010335 0.000027 0.310236 0.065923 1.000 2
length{all}[4] 0.104512 0.011700 0.000107 0.328980 0.069190 1.000 2
length{all}[5] 0.099300 0.009928 0.000034 0.296832 0.069847 1.000 2
length{all}[6] 0.098018 0.010089 0.000067 0.304596 0.066174 1.000 2
length{all}[7] 0.102636 0.011820 0.000187 0.308398 0.066612 1.002 2
length{all}[8] 0.108052 0.011844 0.000062 0.313416 0.070752 0.998 2
length{all}[9] 0.099906 0.008099 0.000040 0.284085 0.073486 0.998 2
length{all}[10] 0.099531 0.009201 0.000065 0.260346 0.069077 0.999 2
length{all}[11] 0.100432 0.010330 0.000110 0.289813 0.065553 0.999 2
length{all}[12] 0.113162 0.013447 0.000273 0.354310 0.073885 1.001 2
length{all}[13] 0.108645 0.011565 0.000097 0.307645 0.073512 1.003 2
length{all}[14] 0.092204 0.008582 0.000143 0.275612 0.062273 1.004 2
length{all}[15] 0.091031 0.009626 0.000261 0.272756 0.061908 0.999 2
length{all}[16] 0.100340 0.010966 0.000214 0.307914 0.065907 1.003 2
length{all}[17] 0.104375 0.009824 0.000212 0.300003 0.077771 0.998 2
length{all}[18] 0.094695 0.009742 0.000392 0.283834 0.058721 1.001 2
length{all}[19] 0.099836 0.010042 0.000118 0.324161 0.068702 1.002 2
length{all}[20] 0.097669 0.010766 0.000071 0.318772 0.061055 0.998 2
length{all}[21] 0.092396 0.009314 0.000102 0.273698 0.063467 0.999 2
length{all}[22] 0.108730 0.011585 0.000111 0.296260 0.075900 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005359
Maximum standard deviation of split frequencies = 0.020257
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1071
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
21 ambiguity characters in seq. 1
21 ambiguity characters in seq. 2
21 ambiguity characters in seq. 3
21 ambiguity characters in seq. 4
42 ambiguity characters in seq. 5
42 ambiguity characters in seq. 6
14 sites are removed. 1 2 3 4 5 6 7 351 352 353 354 355 356 357
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 343 / 343 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 343 / 343 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.051246 0.024556 0.101218 0.037943 0.026631 0.016703 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1434.325510
Iterating by ming2
Initial: fx= 1434.325510
x= 0.05125 0.02456 0.10122 0.03794 0.02663 0.01670 0.30000 1.30000
1 h-m-p 0.0000 0.0000 826.5913 ++ 1400.626082 m 0.0000 13 | 1/8
2 h-m-p 0.0005 0.0171 69.3874 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 756.1571 ++ 1387.356202 m 0.0000 44 | 2/8
4 h-m-p 0.0003 0.0231 57.4537 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 676.5617 ++ 1384.549641 m 0.0000 74 | 3/8
6 h-m-p 0.0001 0.0289 46.0634 ---------.. | 3/8
7 h-m-p 0.0000 0.0000 585.1418 ++ 1373.071014 m 0.0000 103 | 4/8
8 h-m-p 0.0005 0.0388 34.7280 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 477.6301 ++ 1364.053181 m 0.0000 134 | 5/8
10 h-m-p 0.0006 0.0584 23.1074 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 336.9905 ++ 1346.972499 m 0.0001 165 | 6/8
12 h-m-p 0.7491 8.0000 0.0000 ++ 1346.972499 m 8.0000 176 | 6/8
13 h-m-p 0.0160 8.0000 0.0158 +++++ 1346.972497 m 8.0000 192 | 6/8
14 h-m-p 0.1223 8.0000 1.0359 ++Y 1346.972477 0 3.7461 207 | 6/8
15 h-m-p 1.6000 8.0000 0.0439 ++ 1346.972476 m 8.0000 218 | 6/8
16 h-m-p 0.4087 8.0000 0.8591 --------C 1346.972476 0 0.0000 239 | 6/8
17 h-m-p 0.0160 8.0000 0.0001 +++++ 1346.972476 m 8.0000 255 | 6/8
18 h-m-p 0.0160 8.0000 0.1792 ----C 1346.972476 0 0.0000 272 | 6/8
19 h-m-p 0.0160 8.0000 0.0010 -----Y 1346.972476 0 0.0000 290 | 6/8
20 h-m-p 0.0160 8.0000 0.0000 ------------N 1346.972476 0 0.0000 315
Out..
lnL = -1346.972476
316 lfun, 316 eigenQcodon, 1896 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010289 0.043919 0.039103 0.104429 0.048213 0.034233 3.933317 0.805920 0.561044
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 3.938835
np = 9
lnL0 = -1440.845181
Iterating by ming2
Initial: fx= 1440.845181
x= 0.01029 0.04392 0.03910 0.10443 0.04821 0.03423 3.93332 0.80592 0.56104
1 h-m-p 0.0000 0.0000 814.3253 ++ 1420.462759 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0005 299.1968 ++ 1379.993486 m 0.0005 26 | 2/9
3 h-m-p 0.0000 0.0000 7273.8933 ++ 1373.805068 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 1781.2338 ++ 1368.264277 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 13932.1045 ++ 1364.959525 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 2598138.2497 ++ 1346.972475 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 ++ 1346.972475 m 8.0000 86 | 6/9
8 h-m-p 0.0206 8.0000 0.0033 +++++ 1346.972475 m 8.0000 104 | 6/9
9 h-m-p 0.0780 3.1552 0.3383 ---------Y 1346.972475 0 0.0000 128 | 6/9
10 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 1346.972475 m 8.0000 172 | 6/9
12 h-m-p 0.0160 8.0000 0.1313 -------C 1346.972475 0 0.0000 194 | 6/9
13 h-m-p 0.0160 8.0000 0.0008 +++++ 1346.972475 m 8.0000 212 | 6/9
14 h-m-p 0.0213 5.9139 0.2894 --------C 1346.972475 0 0.0000 235 | 6/9
15 h-m-p 0.0160 8.0000 0.0001 -Y 1346.972475 0 0.0010 251 | 6/9
16 h-m-p 0.0160 8.0000 0.0086 -----------Y 1346.972475 0 0.0000 277 | 6/9
17 h-m-p 0.0160 8.0000 0.0009 +++++ 1346.972475 m 8.0000 295 | 6/9
18 h-m-p 0.0242 4.9102 0.3073 -----------C 1346.972475 0 0.0000 321 | 6/9
19 h-m-p 0.0160 8.0000 0.0001 ----C 1346.972475 0 0.0000 340 | 6/9
20 h-m-p 0.0160 8.0000 0.0000 --Y 1346.972475 0 0.0003 357
Out..
lnL = -1346.972475
358 lfun, 1074 eigenQcodon, 4296 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.078055 0.020972 0.023762 0.012495 0.066785 0.085261 3.903830 1.784073 0.584827 0.139845 2.155999
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.393361
np = 11
lnL0 = -1435.752277
Iterating by ming2
Initial: fx= 1435.752277
x= 0.07806 0.02097 0.02376 0.01250 0.06678 0.08526 3.90383 1.78407 0.58483 0.13985 2.15600
1 h-m-p 0.0000 0.0000 698.9339 ++ 1414.204529 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0003 258.5438 ++ 1399.731102 m 0.0003 30 | 2/11
3 h-m-p 0.0000 0.0000 815.6063 ++ 1396.806931 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 1990.9633 ++ 1383.004492 m 0.0000 58 | 4/11
5 h-m-p 0.0005 0.0024 54.6655 ++ 1378.007928 m 0.0024 72 | 5/11
6 h-m-p 0.0000 0.0001 962.4405 ++ 1358.903601 m 0.0001 86 | 6/11
7 h-m-p 0.0031 0.0391 41.7020 ++ 1346.972475 m 0.0391 100 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 1346.972475 m 8.0000 114 | 7/11
9 h-m-p 0.1360 8.0000 0.0006 +++ 1346.972475 m 8.0000 133 | 7/11
10 h-m-p 0.0101 5.0302 1.7151 ----------C 1346.972475 0 0.0000 161 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
12 h-m-p 0.0160 8.0000 0.0000 ------------- | 7/11
13 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -1346.972475
245 lfun, 980 eigenQcodon, 4410 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1346.993204 S = -1346.968480 -0.009493
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:03
did 20 / 55 patterns 0:03
did 30 / 55 patterns 0:03
did 40 / 55 patterns 0:03
did 50 / 55 patterns 0:03
did 55 / 55 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078758 0.045620 0.056800 0.060676 0.039148 0.102046 3.921235 1.162769 1.509114
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 5.000395
np = 9
lnL0 = -1472.717094
Iterating by ming2
Initial: fx= 1472.717094
x= 0.07876 0.04562 0.05680 0.06068 0.03915 0.10205 3.92124 1.16277 1.50911
1 h-m-p 0.0000 0.0001 779.9093 ++ 1397.022950 m 0.0001 23 | 1/9
2 h-m-p 0.0018 0.0237 49.0782 ++ 1380.725549 m 0.0237 44 | 2/9
3 h-m-p 0.0000 0.0001 1434.7661 ++ 1366.631013 m 0.0001 64 | 3/9
4 h-m-p 0.0001 0.0005 409.1395 ++ 1354.830532 m 0.0005 83 | 4/9
5 h-m-p 0.0001 0.0006 81.5979 ----------.. | 4/9
6 h-m-p 0.0000 0.0000 583.6010 ++ 1349.879854 m 0.0000 126 | 5/9
7 h-m-p 0.0017 0.8422 4.9827 ------------.. | 5/9
8 h-m-p 0.0000 0.0000 477.7929 ++ 1348.830149 m 0.0000 169 | 6/9
9 h-m-p 0.0024 1.2179 3.4556 ------------.. | 6/9
10 h-m-p 0.0000 0.0000 337.5360 ++ 1346.972471 m 0.0000 210 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 N 1346.972471 0 0.4000 225 | 6/9
12 h-m-p 0.0006 0.3173 5.0044 ++++C 1346.972461 0 0.1648 243 | 6/9
13 h-m-p 0.0203 0.1017 8.1121 ----------C 1346.972461 0 0.0000 268 | 6/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 1346.972461 m 8.0000 286 | 6/9
15 h-m-p 0.0009 0.4358 1.8446 ++++C 1346.972454 0 0.2231 305 | 6/9
16 h-m-p 0.0305 0.1524 9.1576 --------------.. | 6/9
17 h-m-p 0.0160 8.0000 0.0001 +++++ 1346.972454 m 8.0000 350 | 6/9
18 h-m-p 0.1628 0.8140 0.0021 ++ 1346.972454 m 0.8140 365
QuantileBeta(0.15, 0.00494, 0.35126) = 5.279876e-161 2000 rounds
| 7/9
19 h-m-p 0.0160 8.0000 0.6952 ---------N 1346.972454 0 0.0000 389 | 7/9
20 h-m-p 0.0160 8.0000 0.0002 +++++ 1346.972454 m 8.0000 406 | 7/9
21 h-m-p 0.0014 0.7209 3.2192 -----------.. | 7/9
22 h-m-p 0.0160 8.0000 0.0000 +++++ 1346.972454 m 8.0000 446 | 7/9
23 h-m-p 0.0160 8.0000 1.2769 ----------N 1346.972454 0 0.0000 470 | 7/9
24 h-m-p 0.0160 8.0000 0.0000 ----N 1346.972454 0 0.0000 488 | 7/9
25 h-m-p 0.0160 8.0000 0.0002 +++++ 1346.972454 m 8.0000 505 | 7/9
26 h-m-p 0.0160 8.0000 3.0670 -----------Y 1346.972454 0 0.0000 530 | 7/9
27 h-m-p 0.0160 8.0000 0.0001 +++++ 1346.972454 m 8.0000 547 | 7/9
28 h-m-p 0.0160 8.0000 6.4993 -------------.. | 7/9
29 h-m-p 0.0160 8.0000 0.0000 +++++ 1346.972454 m 8.0000 589 | 7/9
30 h-m-p 0.0160 8.0000 1.5245 ----------Y 1346.972454 0 0.0000 613 | 7/9
31 h-m-p 0.0001 0.0579 59.1182 +++++ 1346.972070 m 0.0579 630 | 8/9
32 h-m-p 0.9413 8.0000 0.0000 ---Y 1346.972070 0 0.0020 647 | 8/9
33 h-m-p 0.0160 8.0000 0.0000 -N 1346.972070 0 0.0010 661 | 8/9
34 h-m-p 0.0160 8.0000 0.0000 ---------N 1346.972070 0 0.0000 683
Out..
lnL = -1346.972070
684 lfun, 7524 eigenQcodon, 41040 P(t)
Time used: 0:13
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.107091 0.059116 0.033956 0.103851 0.015077 0.077914 0.000100 0.900000 1.064071 1.543677 2.197307
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.171563
np = 11
lnL0 = -1468.125801
Iterating by ming2
Initial: fx= 1468.125801
x= 0.10709 0.05912 0.03396 0.10385 0.01508 0.07791 0.00011 0.90000 1.06407 1.54368 2.19731
1 h-m-p 0.0000 0.0000 689.9312 ++ 1467.412817 m 0.0000 27 | 1/11
2 h-m-p 0.0000 0.0001 737.1417 ++ 1441.215007 m 0.0001 52 | 2/11
3 h-m-p 0.0000 0.0002 255.6322 ++ 1413.546624 m 0.0002 76 | 3/11
4 h-m-p 0.0005 0.0061 95.9718 ++ 1359.649258 m 0.0061 99 | 4/11
5 h-m-p 0.0000 0.0001 2361.6548 ++ 1351.567231 m 0.0001 121 | 5/11
6 h-m-p 0.0003 0.0014 527.2128 ++ 1347.480724 m 0.0014 142 | 6/11
7 h-m-p 0.0000 0.0000 26360.7199 +
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
+ 1347.454672 m 0.0000 162
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16283) = 1.220051e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16259) = 1.220223e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
| 7/11
8 h-m-p 0.0005 0.0718 34.0544
QuantileBeta(0.15, 0.00500, 2.15317) = 1.226979e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16033) = 1.221840e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16211) = 1.220562e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16256) = 1.220243e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16267) = 1.220163e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16270) = 1.220144e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220139e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16283) = 1.220051e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16259) = 1.220223e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
| 7/11
9 h-m-p 0.0000 0.0000 337.7553
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
+ 1346.972469 m 0.0000 208
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16283) = 1.220051e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16259) = 1.220223e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
| 8/11
10 h-m-p 0.0216 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
+ 1346.972469 m 8.0000 229
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16283) = 1.220051e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16259) = 1.220223e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
| 8/11
11 h-m-p 0.0160 8.0000 0.0445
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
Y 1346.972469 0 0.0000 254
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16283) = 1.220051e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16259) = 1.220223e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
| 8/11
12 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
Y 1346.972469 0 0.0000 275
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16283) = 1.220051e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16259) = 1.220223e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
| 8/11
13 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
Y 1346.972469 0 0.0003 294
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
Out..
lnL = -1346.972469
295 lfun, 3540 eigenQcodon, 19470 P(t)
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1346.988639 S = -1346.966673 -0.009665
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:18
did 20 / 55 patterns 0:18
did 30 / 55 patterns 0:19
did 40 / 55 patterns 0:19
did 50 / 55 patterns 0:19
did 55 / 55 patterns 0:19
QuantileBeta(0.15, 0.00500, 2.16271) = 1.220137e-160 2000 rounds
Time used: 0:19
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0348/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 343
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 4 4 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 2 2 2 2 2 2
TTC 8 8 8 8 8 8 | TCC 7 7 7 7 7 7 | TAC 5 5 5 5 5 5 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 3 3 3 3 3 3
CTC 4 4 4 4 4 4 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 6 6 6 6 6 6
CTA 1 1 1 1 1 1 | CCA 5 5 5 5 5 5 | Gln CAA 3 3 3 3 3 3 | CGA 2 2 2 2 2 2
CTG 15 15 15 15 15 15 | CCG 11 11 11 11 11 11 | CAG 9 9 9 9 9 9 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 7 7 7 7 7 7 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 8 8 8 8 8 8 | ACC 8 8 8 8 8 8 | AAC 6 6 6 6 6 6 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 12 12 12 12 12 12 | ACG 7 7 7 7 7 7 | AAG 7 7 7 7 7 7 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 13 13 13 13 13 13 | Asp GAT 1 1 1 1 1 1 | Gly GGT 11 11 11 11 11 11
GTC 8 8 8 8 8 8 | GCC 13 13 13 13 13 13 | GAC 17 17 17 17 17 17 | GGC 11 11 11 11 11 11
GTA 2 2 2 2 2 2 | GCA 5 5 5 5 5 5 | Glu GAA 6 6 6 6 6 6 | GGA 6 6 6 6 6 6
GTG 13 13 13 13 13 13 | GCG 18 18 18 18 18 18 | GAG 13 13 13 13 13 13 | GGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907681_1_359_MLBR_RS01725
position 1: T:0.15743 C:0.22449 A:0.18659 G:0.43149
position 2: T:0.27405 C:0.28863 A:0.23032 G:0.20700
position 3: T:0.17784 C:0.32653 A:0.09913 G:0.39650
Average T:0.20311 C:0.27988 A:0.17201 G:0.34500
#2: NC_002677_1_NP_301357_1_229_ML0348
position 1: T:0.15743 C:0.22449 A:0.18659 G:0.43149
position 2: T:0.27405 C:0.28863 A:0.23032 G:0.20700
position 3: T:0.17784 C:0.32653 A:0.09913 G:0.39650
Average T:0.20311 C:0.27988 A:0.17201 G:0.34500
#3: NZ_LVXE01000013_1_WP_010907681_1_476_A3216_RS05890
position 1: T:0.15743 C:0.22449 A:0.18659 G:0.43149
position 2: T:0.27405 C:0.28863 A:0.23032 G:0.20700
position 3: T:0.17784 C:0.32653 A:0.09913 G:0.39650
Average T:0.20311 C:0.27988 A:0.17201 G:0.34500
#4: NZ_LYPH01000014_1_WP_010907681_1_442_A8144_RS02105
position 1: T:0.15743 C:0.22449 A:0.18659 G:0.43149
position 2: T:0.27405 C:0.28863 A:0.23032 G:0.20700
position 3: T:0.17784 C:0.32653 A:0.09913 G:0.39650
Average T:0.20311 C:0.27988 A:0.17201 G:0.34500
#5: NZ_CP029543_1_WP_041322380_1_362_DIJ64_RS01860
position 1: T:0.15743 C:0.22449 A:0.18659 G:0.43149
position 2: T:0.27405 C:0.28863 A:0.23032 G:0.20700
position 3: T:0.17784 C:0.32653 A:0.09913 G:0.39650
Average T:0.20311 C:0.27988 A:0.17201 G:0.34500
#6: NZ_AP014567_1_WP_041322380_1_377_JK2ML_RS01935
position 1: T:0.15743 C:0.22449 A:0.18659 G:0.43149
position 2: T:0.27405 C:0.28863 A:0.23032 G:0.20700
position 3: T:0.17784 C:0.32653 A:0.09913 G:0.39650
Average T:0.20311 C:0.27988 A:0.17201 G:0.34500
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 24 | Ser S TCT 18 | Tyr Y TAT 30 | Cys C TGT 12
TTC 48 | TCC 42 | TAC 30 | TGC 12
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 54
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 18
CTC 24 | CCC 18 | CAC 12 | CGC 36
CTA 6 | CCA 30 | Gln Q CAA 18 | CGA 12
CTG 90 | CCG 66 | CAG 54 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 42 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 0
ATC 48 | ACC 48 | AAC 36 | AGC 24
ATA 0 | ACA 0 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 72 | ACG 42 | AAG 42 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 78 | Asp D GAT 6 | Gly G GGT 66
GTC 48 | GCC 78 | GAC 102 | GGC 66
GTA 12 | GCA 30 | Glu E GAA 36 | GGA 36
GTG 78 | GCG 108 | GAG 78 | GGG 42
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15743 C:0.22449 A:0.18659 G:0.43149
position 2: T:0.27405 C:0.28863 A:0.23032 G:0.20700
position 3: T:0.17784 C:0.32653 A:0.09913 G:0.39650
Average T:0.20311 C:0.27988 A:0.17201 G:0.34500
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1346.972476 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 3.933317 0.901362
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907681_1_359_MLBR_RS01725: 0.000004, NC_002677_1_NP_301357_1_229_ML0348: 0.000004, NZ_LVXE01000013_1_WP_010907681_1_476_A3216_RS05890: 0.000004, NZ_LYPH01000014_1_WP_010907681_1_442_A8144_RS02105: 0.000004, NZ_CP029543_1_WP_041322380_1_362_DIJ64_RS01860: 0.000004, NZ_AP014567_1_WP_041322380_1_377_JK2ML_RS01935: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 3.93332
omega (dN/dS) = 0.90136
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 757.4 271.6 0.9014 0.0000 0.0000 0.0 0.0
7..2 0.000 757.4 271.6 0.9014 0.0000 0.0000 0.0 0.0
7..3 0.000 757.4 271.6 0.9014 0.0000 0.0000 0.0 0.0
7..4 0.000 757.4 271.6 0.9014 0.0000 0.0000 0.0 0.0
7..5 0.000 757.4 271.6 0.9014 0.0000 0.0000 0.0 0.0
7..6 0.000 757.4 271.6 0.9014 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1346.972475 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 3.903830 0.616963 0.074547
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907681_1_359_MLBR_RS01725: 0.000004, NC_002677_1_NP_301357_1_229_ML0348: 0.000004, NZ_LVXE01000013_1_WP_010907681_1_476_A3216_RS05890: 0.000004, NZ_LYPH01000014_1_WP_010907681_1_442_A8144_RS02105: 0.000004, NZ_CP029543_1_WP_041322380_1_362_DIJ64_RS01860: 0.000004, NZ_AP014567_1_WP_041322380_1_377_JK2ML_RS01935: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 3.90383
MLEs of dN/dS (w) for site classes (K=2)
p: 0.61696 0.38304
w: 0.07455 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 757.5 271.5 0.4290 0.0000 0.0000 0.0 0.0
7..2 0.000 757.5 271.5 0.4290 0.0000 0.0000 0.0 0.0
7..3 0.000 757.5 271.5 0.4290 0.0000 0.0000 0.0 0.0
7..4 0.000 757.5 271.5 0.4290 0.0000 0.0000 0.0 0.0
7..5 0.000 757.5 271.5 0.4290 0.0000 0.0000 0.0 0.0
7..6 0.000 757.5 271.5 0.4290 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 11): -1346.972475 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 3.921235 0.816149 0.082760 0.000001 3.569000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907681_1_359_MLBR_RS01725: 0.000004, NC_002677_1_NP_301357_1_229_ML0348: 0.000004, NZ_LVXE01000013_1_WP_010907681_1_476_A3216_RS05890: 0.000004, NZ_LYPH01000014_1_WP_010907681_1_442_A8144_RS02105: 0.000004, NZ_CP029543_1_WP_041322380_1_362_DIJ64_RS01860: 0.000004, NZ_AP014567_1_WP_041322380_1_377_JK2ML_RS01935: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 3.92124
MLEs of dN/dS (w) for site classes (K=3)
p: 0.81615 0.08276 0.10109
w: 0.00000 1.00000 3.56900
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 757.5 271.5 0.4436 0.0000 0.0000 0.0 0.0
7..2 0.000 757.5 271.5 0.4436 0.0000 0.0000 0.0 0.0
7..3 0.000 757.5 271.5 0.4436 0.0000 0.0000 0.0 0.0
7..4 0.000 757.5 271.5 0.4436 0.0000 0.0000 0.0 0.0
7..5 0.000 757.5 271.5 0.4436 0.0000 0.0000 0.0 0.0
7..6 0.000 757.5 271.5 0.4436 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907681_1_359_MLBR_RS01725)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907681_1_359_MLBR_RS01725)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.100 0.100 0.100 0.099 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1346.972070 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.349969
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907681_1_359_MLBR_RS01725: 0.000004, NC_002677_1_NP_301357_1_229_ML0348: 0.000004, NZ_LVXE01000013_1_WP_010907681_1_476_A3216_RS05890: 0.000004, NZ_LYPH01000014_1_WP_010907681_1_442_A8144_RS02105: 0.000004, NZ_CP029543_1_WP_041322380_1_362_DIJ64_RS01860: 0.000004, NZ_AP014567_1_WP_041322380_1_377_JK2ML_RS01935: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.34997
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00038
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 786.3 242.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 786.3 242.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 786.3 242.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 786.3 242.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 786.3 242.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 786.3 242.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:13
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1346.972469 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.720342 0.005000 2.162711 3.181025
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907681_1_359_MLBR_RS01725: 0.000004, NC_002677_1_NP_301357_1_229_ML0348: 0.000004, NZ_LVXE01000013_1_WP_010907681_1_476_A3216_RS05890: 0.000004, NZ_LYPH01000014_1_WP_010907681_1_442_A8144_RS02105: 0.000004, NZ_CP029543_1_WP_041322380_1_362_DIJ64_RS01860: 0.000004, NZ_AP014567_1_WP_041322380_1_377_JK2ML_RS01935: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.72034 p = 0.00500 q = 2.16271
(p1 = 0.27966) w = 3.18102
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07203 0.07203 0.07203 0.07203 0.07203 0.07203 0.07203 0.07203 0.07203 0.07203 0.27966
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.18102
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 786.3 242.7 0.8896 0.0000 0.0000 0.0 0.0
7..2 0.000 786.3 242.7 0.8896 0.0000 0.0000 0.0 0.0
7..3 0.000 786.3 242.7 0.8896 0.0000 0.0000 0.0 0.0
7..4 0.000 786.3 242.7 0.8896 0.0000 0.0000 0.0 0.0
7..5 0.000 786.3 242.7 0.8896 0.0000 0.0000 0.0 0.0
7..6 0.000 786.3 242.7 0.8896 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907681_1_359_MLBR_RS01725)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907681_1_359_MLBR_RS01725)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:19