--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:22:26 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0393/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1067.58 -1070.32
2 -1067.54 -1071.52
--------------------------------------
TOTAL -1067.56 -1071.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892636 0.091777 0.339368 1.486249 0.853864 1353.05 1426.62 1.000
r(A<->C){all} 0.173433 0.020838 0.000075 0.463991 0.138191 249.16 275.88 1.001
r(A<->G){all} 0.165334 0.018700 0.000004 0.436610 0.128582 134.35 171.87 1.000
r(A<->T){all} 0.156959 0.018596 0.000043 0.434186 0.119057 246.88 282.77 1.000
r(C<->G){all} 0.175916 0.020180 0.000089 0.463828 0.141326 271.23 320.94 1.000
r(C<->T){all} 0.163116 0.017928 0.000006 0.429210 0.130391 144.91 218.83 1.001
r(G<->T){all} 0.165242 0.018353 0.000031 0.432153 0.131776 232.91 251.42 1.000
pi(A){all} 0.213353 0.000214 0.186292 0.242211 0.212888 1201.92 1247.95 1.000
pi(C){all} 0.308526 0.000272 0.275808 0.340767 0.307926 1246.39 1297.15 1.000
pi(G){all} 0.298808 0.000268 0.267797 0.331617 0.298847 1192.58 1279.14 1.000
pi(T){all} 0.179313 0.000185 0.152433 0.205370 0.179076 1255.96 1359.40 1.000
alpha{1,2} 0.407032 0.221188 0.000124 1.330003 0.239379 1195.05 1281.90 1.000
alpha{3} 0.449870 0.219594 0.000142 1.383567 0.296381 1010.76 1156.45 1.000
pinvar{all} 0.998081 0.000005 0.993729 1.000000 0.998833 1103.45 1189.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1018.367946
Model 2: PositiveSelection -1018.367955
Model 0: one-ratio -1018.367957
Model 7: beta -1018.367949
Model 8: beta&w>1 -1018.367943
Model 0 vs 1 2.2000000171829015E-5
Model 2 vs 1 1.8000000181928044E-5
Model 8 vs 7 1.1999999969702912E-5
>C1
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C2
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C3
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C4
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C5
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C6
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=261
C1 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C2 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C3 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C4 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C5 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C6 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
**************************************************
C1 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C2 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C3 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C4 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C5 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C6 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
**************************************************
C1 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C2 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C3 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C4 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C5 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C6 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
**************************************************
C1 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C2 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C3 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C4 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C5 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C6 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
**************************************************
C1 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C2 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C3 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C4 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C5 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C6 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
**************************************************
C1 NVVVTDLAELL
C2 NVVVTDLAELL
C3 NVVVTDLAELL
C4 NVVVTDLAELL
C5 NVVVTDLAELL
C6 NVVVTDLAELL
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7830]--->[7830]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.496 Mb, Max= 30.816 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C2 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C3 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C4 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C5 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
C6 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
**************************************************
C1 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C2 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C3 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C4 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C5 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
C6 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
**************************************************
C1 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C2 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C3 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C4 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C5 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
C6 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
**************************************************
C1 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C2 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C3 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C4 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C5 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
C6 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
**************************************************
C1 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C2 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C3 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C4 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C5 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
C6 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
**************************************************
C1 NVVVTDLAELL
C2 NVVVTDLAELL
C3 NVVVTDLAELL
C4 NVVVTDLAELL
C5 NVVVTDLAELL
C6 NVVVTDLAELL
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
C2 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
C3 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
C4 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
C5 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
C6 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
**************************************************
C1 TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
C2 TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
C3 TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
C4 TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
C5 TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
C6 TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
**************************************************
C1 CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
C2 CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
C3 CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
C4 CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
C5 CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
C6 CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
**************************************************
C1 TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
C2 TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
C3 TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
C4 TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
C5 TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
C6 TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
**************************************************
C1 CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
C2 CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
C3 CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
C4 CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
C5 CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
C6 CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
**************************************************
C1 GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
C2 GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
C3 GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
C4 GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
C5 GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
C6 GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
**************************************************
C1 GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
C2 GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
C3 GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
C4 GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
C5 GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
C6 GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
**************************************************
C1 AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
C2 AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
C3 AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
C4 AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
C5 AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
C6 AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
**************************************************
C1 ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
C2 ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
C3 ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
C4 ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
C5 ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
C6 ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
**************************************************
C1 GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
C2 GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
C3 GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
C4 GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
C5 GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
C6 GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
**************************************************
C1 TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
C2 TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
C3 TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
C4 TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
C5 TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
C6 TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
**************************************************
C1 AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
C2 AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
C3 AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
C4 AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
C5 AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
C6 AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
**************************************************
C1 TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
C2 TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
C3 TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
C4 TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
C5 TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
C6 TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
**************************************************
C1 CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
C2 CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
C3 CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
C4 CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
C5 CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
C6 CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
**************************************************
C1 ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
C2 ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
C3 ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
C4 ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
C5 ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
C6 ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
**************************************************
C1 AATGTAGTGGTGACCGATCTCGCTGAACTACTG
C2 AATGTAGTGGTGACCGATCTCGCTGAACTACTG
C3 AATGTAGTGGTGACCGATCTCGCTGAACTACTG
C4 AATGTAGTGGTGACCGATCTCGCTGAACTACTG
C5 AATGTAGTGGTGACCGATCTCGCTGAACTACTG
C6 AATGTAGTGGTGACCGATCTCGCTGAACTACTG
*********************************
>C1
ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
AATGTAGTGGTGACCGATCTCGCTGAACTACTG
>C2
ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
AATGTAGTGGTGACCGATCTCGCTGAACTACTG
>C3
ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
AATGTAGTGGTGACCGATCTCGCTGAACTACTG
>C4
ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
AATGTAGTGGTGACCGATCTCGCTGAACTACTG
>C5
ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
AATGTAGTGGTGACCGATCTCGCTGAACTACTG
>C6
ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG
TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA
CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC
TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA
CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG
GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT
GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA
AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG
ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC
GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG
TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG
AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG
TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC
CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA
ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC
AATGTAGTGGTGACCGATCTCGCTGAACTACTG
>C1
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C2
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C3
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C4
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C5
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
>C6
MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NVVVTDLAELL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 783 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579800070
Setting output file names to "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1077109557
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0985989244
Seed = 1891191251
Swapseed = 1579800070
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1752.391541 -- -24.965149
Chain 2 -- -1752.391541 -- -24.965149
Chain 3 -- -1752.391541 -- -24.965149
Chain 4 -- -1752.391274 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1752.391541 -- -24.965149
Chain 2 -- -1752.391441 -- -24.965149
Chain 3 -- -1752.391441 -- -24.965149
Chain 4 -- -1752.391541 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1752.392] (-1752.392) (-1752.392) (-1752.391) * [-1752.392] (-1752.391) (-1752.391) (-1752.392)
500 -- [-1085.042] (-1084.564) (-1077.577) (-1079.297) * (-1080.717) (-1089.197) [-1084.196] (-1075.242) -- 0:00:00
1000 -- (-1086.344) (-1078.310) (-1074.943) [-1075.691] * [-1075.168] (-1076.394) (-1080.929) (-1071.248) -- 0:00:00
1500 -- (-1081.243) (-1080.599) [-1074.747] (-1081.230) * [-1072.182] (-1080.623) (-1079.853) (-1071.972) -- 0:00:00
2000 -- (-1080.325) [-1075.037] (-1075.519) (-1077.873) * (-1097.567) (-1079.537) [-1074.992] (-1079.148) -- 0:00:00
2500 -- (-1081.083) [-1074.817] (-1077.491) (-1082.326) * (-1086.238) (-1078.952) [-1076.536] (-1082.250) -- 0:00:00
3000 -- (-1080.395) (-1074.604) (-1082.765) [-1080.299] * [-1074.755] (-1079.066) (-1081.315) (-1080.749) -- 0:00:00
3500 -- (-1083.353) (-1083.609) (-1077.900) [-1078.102] * (-1075.582) [-1080.784] (-1079.895) (-1083.408) -- 0:00:00
4000 -- (-1077.514) (-1072.246) (-1071.803) [-1077.981] * (-1074.960) (-1072.210) [-1075.326] (-1081.821) -- 0:00:00
4500 -- (-1076.837) (-1072.612) [-1074.511] (-1080.756) * (-1074.559) (-1078.230) (-1077.502) [-1074.660] -- 0:00:00
5000 -- [-1084.848] (-1078.243) (-1081.695) (-1079.772) * (-1079.474) (-1075.956) [-1075.031] (-1081.155) -- 0:00:00
Average standard deviation of split frequencies: 0.086424
5500 -- [-1075.319] (-1080.092) (-1086.758) (-1077.694) * [-1073.802] (-1072.729) (-1076.459) (-1083.086) -- 0:00:00
6000 -- [-1081.741] (-1079.550) (-1083.201) (-1075.262) * (-1079.083) (-1073.560) (-1083.962) [-1077.529] -- 0:00:00
6500 -- [-1074.751] (-1074.069) (-1085.662) (-1077.294) * (-1077.878) (-1080.499) (-1081.871) [-1079.092] -- 0:00:00
7000 -- (-1078.259) (-1076.175) (-1077.813) [-1070.326] * (-1075.066) (-1077.798) [-1072.673] (-1075.998) -- 0:00:00
7500 -- [-1080.597] (-1070.586) (-1084.812) (-1076.901) * (-1082.921) (-1079.266) (-1082.261) [-1073.996] -- 0:00:00
8000 -- (-1079.286) [-1075.908] (-1080.282) (-1076.571) * [-1078.694] (-1078.867) (-1076.307) (-1085.557) -- 0:00:00
8500 -- (-1074.562) (-1084.315) [-1077.469] (-1080.114) * (-1077.112) [-1074.467] (-1079.749) (-1079.089) -- 0:00:00
9000 -- [-1079.111] (-1090.730) (-1076.919) (-1073.982) * (-1073.705) [-1076.679] (-1078.555) (-1074.263) -- 0:00:00
9500 -- [-1078.215] (-1087.986) (-1074.374) (-1081.907) * (-1085.484) [-1081.995] (-1086.214) (-1076.838) -- 0:00:00
10000 -- (-1074.258) (-1081.836) [-1073.845] (-1081.378) * (-1076.581) [-1077.563] (-1073.833) (-1081.580) -- 0:00:00
Average standard deviation of split frequencies: 0.072920
10500 -- (-1079.996) [-1067.803] (-1074.704) (-1086.593) * (-1077.283) [-1081.194] (-1082.011) (-1084.476) -- 0:00:00
11000 -- (-1075.608) (-1072.137) (-1075.359) [-1081.735] * (-1076.940) [-1073.776] (-1085.909) (-1076.068) -- 0:01:29
11500 -- (-1077.238) (-1075.332) (-1077.929) [-1078.528] * (-1078.905) (-1080.611) [-1079.711] (-1076.391) -- 0:01:25
12000 -- (-1080.742) [-1066.817] (-1077.348) (-1073.644) * (-1081.001) [-1078.476] (-1076.269) (-1072.802) -- 0:01:22
12500 -- [-1072.400] (-1067.105) (-1076.851) (-1078.574) * [-1074.908] (-1082.119) (-1077.422) (-1079.407) -- 0:01:19
13000 -- (-1074.855) [-1066.916] (-1084.703) (-1077.297) * (-1088.707) (-1079.544) (-1085.891) [-1076.892] -- 0:01:15
13500 -- [-1076.700] (-1066.613) (-1078.840) (-1078.336) * (-1082.582) (-1073.660) (-1081.396) [-1076.541] -- 0:01:13
14000 -- (-1073.814) (-1066.593) [-1073.284] (-1083.905) * (-1085.275) (-1079.344) (-1077.470) [-1075.638] -- 0:01:10
14500 -- (-1074.139) (-1066.824) [-1074.403] (-1073.749) * [-1077.623] (-1088.107) (-1082.302) (-1076.684) -- 0:01:07
15000 -- (-1076.889) (-1066.758) [-1076.527] (-1075.135) * (-1082.147) [-1073.414] (-1079.921) (-1076.469) -- 0:01:05
Average standard deviation of split frequencies: 0.057452
15500 -- (-1071.783) (-1069.596) (-1080.683) [-1073.740] * (-1075.379) [-1075.414] (-1083.520) (-1077.314) -- 0:01:03
16000 -- (-1088.475) (-1068.835) [-1072.552] (-1079.280) * (-1084.929) (-1075.576) (-1080.707) [-1079.720] -- 0:01:01
16500 -- (-1076.162) (-1068.580) [-1074.615] (-1080.109) * (-1081.473) [-1076.771] (-1080.895) (-1083.530) -- 0:00:59
17000 -- (-1080.296) [-1068.183] (-1079.206) (-1076.751) * (-1087.047) [-1078.168] (-1078.417) (-1084.861) -- 0:00:57
17500 -- (-1080.834) [-1066.851] (-1073.511) (-1080.416) * [-1079.898] (-1082.557) (-1078.164) (-1089.626) -- 0:00:56
18000 -- (-1075.096) (-1069.129) (-1075.738) [-1073.555] * (-1081.276) [-1075.258] (-1082.731) (-1081.394) -- 0:00:54
18500 -- (-1081.232) (-1067.406) (-1075.818) [-1073.541] * (-1070.455) [-1077.800] (-1082.099) (-1083.079) -- 0:00:53
19000 -- (-1077.930) (-1069.123) [-1076.170] (-1084.756) * (-1074.642) (-1079.686) (-1080.353) [-1081.708] -- 0:00:51
19500 -- (-1076.418) (-1067.609) [-1070.016] (-1072.810) * (-1072.137) [-1079.342] (-1066.307) (-1084.161) -- 0:00:50
20000 -- (-1084.978) (-1067.907) [-1076.343] (-1069.623) * (-1067.893) (-1078.303) (-1066.989) [-1073.505] -- 0:00:49
Average standard deviation of split frequencies: 0.050689
20500 -- (-1081.024) (-1073.134) [-1073.083] (-1067.787) * (-1067.455) (-1079.997) (-1066.714) [-1072.770] -- 0:00:47
21000 -- (-1074.320) [-1066.814] (-1076.718) (-1068.775) * (-1068.797) [-1077.982] (-1067.050) (-1071.157) -- 0:00:46
21500 -- (-1092.115) (-1067.011) [-1072.752] (-1067.912) * [-1067.311] (-1077.249) (-1068.601) (-1076.188) -- 0:00:45
22000 -- [-1073.929] (-1070.514) (-1075.685) (-1067.365) * (-1066.597) (-1075.768) [-1067.417] (-1072.526) -- 0:00:44
22500 -- (-1077.492) (-1066.935) (-1080.360) [-1067.771] * (-1067.938) (-1072.143) (-1068.375) [-1072.573] -- 0:00:43
23000 -- (-1079.552) (-1068.842) [-1079.603] (-1067.369) * (-1067.895) (-1079.698) [-1066.633] (-1076.468) -- 0:00:42
23500 -- (-1079.833) (-1070.553) (-1084.579) [-1067.448] * (-1068.311) (-1076.849) [-1067.956] (-1073.712) -- 0:00:41
24000 -- [-1077.228] (-1067.155) (-1079.838) (-1067.730) * (-1068.496) [-1078.276] (-1069.870) (-1075.732) -- 0:00:40
24500 -- [-1069.995] (-1068.423) (-1073.962) (-1068.016) * (-1067.663) [-1071.939] (-1072.087) (-1094.624) -- 0:00:39
25000 -- (-1084.070) (-1066.980) [-1074.802] (-1068.142) * (-1070.964) (-1076.347) [-1068.985] (-1076.506) -- 0:00:39
Average standard deviation of split frequencies: 0.045327
25500 -- [-1074.153] (-1067.486) (-1081.028) (-1068.089) * [-1069.572] (-1076.274) (-1068.459) (-1083.794) -- 0:00:38
26000 -- (-1083.906) (-1067.083) [-1075.689] (-1067.096) * (-1067.657) [-1080.548] (-1070.684) (-1080.098) -- 0:00:37
26500 -- (-1079.347) [-1067.680] (-1075.905) (-1067.815) * (-1067.376) (-1080.657) (-1069.165) [-1078.742] -- 0:00:36
27000 -- (-1080.064) (-1067.235) (-1075.710) [-1070.280] * (-1066.802) [-1083.331] (-1072.364) (-1080.529) -- 0:01:12
27500 -- (-1076.595) (-1066.885) (-1072.859) [-1069.648] * (-1066.508) (-1074.890) [-1071.675] (-1078.826) -- 0:01:10
28000 -- (-1077.134) (-1067.694) [-1071.101] (-1070.249) * [-1069.224] (-1081.844) (-1067.726) (-1078.284) -- 0:01:09
28500 -- (-1076.099) (-1071.093) [-1071.623] (-1070.869) * (-1069.271) (-1080.025) [-1068.424] (-1068.404) -- 0:01:08
29000 -- (-1077.035) (-1066.894) [-1076.629] (-1071.548) * [-1069.348] (-1071.170) (-1069.637) (-1068.709) -- 0:01:06
29500 -- [-1077.256] (-1076.427) (-1075.014) (-1068.469) * (-1067.265) [-1075.813] (-1067.787) (-1070.465) -- 0:01:05
30000 -- [-1078.476] (-1070.065) (-1083.929) (-1069.475) * (-1067.040) [-1075.193] (-1070.052) (-1067.408) -- 0:01:04
Average standard deviation of split frequencies: 0.043188
30500 -- (-1075.058) [-1068.302] (-1071.541) (-1069.709) * (-1066.736) (-1076.592) [-1067.800] (-1076.128) -- 0:01:03
31000 -- (-1079.575) (-1070.241) (-1073.101) [-1067.533] * (-1067.306) (-1084.149) [-1066.334] (-1068.926) -- 0:01:02
31500 -- (-1075.024) [-1067.034] (-1067.165) (-1067.418) * (-1073.039) (-1078.519) (-1067.246) [-1070.126] -- 0:01:01
32000 -- (-1074.766) (-1068.407) (-1069.185) [-1067.389] * (-1068.203) [-1079.585] (-1067.920) (-1066.343) -- 0:01:00
32500 -- (-1085.609) (-1067.147) (-1070.300) [-1067.734] * (-1069.751) (-1075.654) [-1067.247] (-1068.040) -- 0:00:59
33000 -- (-1075.134) [-1067.842] (-1067.409) (-1072.261) * [-1068.559] (-1085.623) (-1067.210) (-1067.492) -- 0:00:58
33500 -- (-1076.369) [-1066.540] (-1067.673) (-1068.783) * (-1068.826) (-1076.619) [-1067.088] (-1068.587) -- 0:00:57
34000 -- [-1077.060] (-1070.080) (-1067.734) (-1067.311) * (-1068.883) (-1081.017) [-1068.587] (-1071.812) -- 0:00:56
34500 -- (-1073.070) (-1069.575) (-1071.103) [-1066.148] * (-1066.584) [-1074.585] (-1072.565) (-1070.735) -- 0:00:55
35000 -- (-1084.248) (-1070.640) (-1067.221) [-1067.123] * (-1067.081) [-1072.896] (-1070.248) (-1068.511) -- 0:00:55
Average standard deviation of split frequencies: 0.029635
35500 -- (-1074.917) [-1070.794] (-1068.747) (-1067.271) * (-1066.439) (-1080.669) (-1070.716) [-1068.201] -- 0:00:54
36000 -- [-1077.577] (-1070.595) (-1066.758) (-1069.639) * [-1066.423] (-1083.774) (-1069.372) (-1066.868) -- 0:00:53
36500 -- (-1075.347) (-1069.069) [-1067.359] (-1069.074) * (-1067.217) (-1087.740) (-1066.989) [-1068.490] -- 0:00:52
37000 -- (-1076.324) (-1071.959) (-1070.844) [-1072.220] * (-1067.006) [-1074.254] (-1067.984) (-1071.653) -- 0:00:52
37500 -- [-1077.550] (-1069.989) (-1066.820) (-1070.372) * [-1067.915] (-1077.001) (-1068.428) (-1067.086) -- 0:00:51
38000 -- (-1075.743) (-1069.450) (-1068.584) [-1068.274] * (-1066.735) (-1096.352) [-1068.286] (-1070.543) -- 0:00:50
38500 -- (-1071.630) [-1071.366] (-1073.017) (-1068.921) * (-1066.952) (-1076.415) [-1067.262] (-1068.751) -- 0:00:49
39000 -- [-1077.612] (-1070.032) (-1072.975) (-1070.984) * (-1068.480) (-1076.422) (-1068.539) [-1068.093] -- 0:00:49
39500 -- (-1079.189) [-1069.035] (-1071.852) (-1069.669) * (-1067.584) (-1079.571) (-1067.636) [-1070.932] -- 0:00:48
40000 -- (-1071.113) (-1067.408) (-1071.092) [-1069.733] * (-1067.971) (-1078.444) (-1067.485) [-1067.873] -- 0:00:48
Average standard deviation of split frequencies: 0.027455
40500 -- (-1073.163) [-1066.822] (-1071.138) (-1069.130) * (-1068.564) (-1084.119) (-1067.121) [-1067.073] -- 0:00:47
41000 -- (-1074.599) (-1066.397) [-1067.220] (-1069.278) * (-1067.435) (-1079.658) [-1070.942] (-1070.480) -- 0:00:46
41500 -- (-1075.104) (-1070.193) [-1068.405] (-1066.015) * [-1068.182] (-1074.077) (-1068.855) (-1074.321) -- 0:00:46
42000 -- (-1072.859) (-1067.337) [-1068.425] (-1068.236) * (-1071.475) (-1081.640) (-1068.988) [-1068.859] -- 0:00:45
42500 -- (-1076.946) [-1067.934] (-1069.950) (-1066.078) * (-1069.884) [-1081.616] (-1067.652) (-1071.836) -- 0:00:45
43000 -- [-1078.085] (-1068.362) (-1070.121) (-1067.425) * (-1070.636) [-1074.598] (-1068.615) (-1070.535) -- 0:00:44
43500 -- (-1076.262) [-1067.362] (-1067.954) (-1066.107) * (-1068.782) [-1076.576] (-1069.368) (-1070.710) -- 0:01:05
44000 -- (-1085.690) (-1069.140) [-1066.381] (-1066.617) * (-1068.052) [-1076.347] (-1070.045) (-1072.283) -- 0:01:05
44500 -- [-1079.146] (-1070.989) (-1071.888) (-1066.355) * (-1066.452) [-1066.305] (-1066.742) (-1067.598) -- 0:01:04
45000 -- (-1075.389) (-1070.788) [-1067.891] (-1068.359) * (-1068.206) (-1067.167) (-1067.776) [-1067.168] -- 0:01:03
Average standard deviation of split frequencies: 0.027949
45500 -- (-1078.403) [-1070.136] (-1070.270) (-1067.785) * [-1066.714] (-1067.928) (-1070.364) (-1075.069) -- 0:01:02
46000 -- (-1073.242) (-1067.042) (-1069.616) [-1068.155] * (-1067.047) (-1066.407) (-1067.865) [-1069.687] -- 0:01:02
46500 -- (-1076.762) [-1066.525] (-1069.051) (-1067.738) * (-1067.320) (-1066.505) (-1074.140) [-1066.883] -- 0:01:01
47000 -- [-1080.215] (-1066.409) (-1072.813) (-1068.516) * (-1070.089) (-1069.242) (-1070.174) [-1066.900] -- 0:01:00
47500 -- [-1072.792] (-1067.111) (-1068.100) (-1068.223) * (-1067.481) (-1068.662) [-1072.598] (-1068.995) -- 0:01:00
48000 -- [-1073.017] (-1066.635) (-1066.919) (-1067.974) * (-1069.681) (-1068.831) [-1066.726] (-1067.343) -- 0:00:59
48500 -- (-1076.026) (-1066.178) [-1068.396] (-1069.197) * (-1068.521) (-1067.205) (-1067.486) [-1067.549] -- 0:00:58
49000 -- (-1077.718) (-1066.251) (-1067.541) [-1067.279] * (-1069.662) (-1067.039) [-1068.785] (-1066.951) -- 0:00:58
49500 -- (-1083.512) [-1070.817] (-1068.574) (-1068.209) * (-1067.434) (-1069.059) [-1066.499] (-1066.772) -- 0:00:57
50000 -- (-1082.114) [-1071.084] (-1066.992) (-1068.794) * (-1069.600) (-1069.059) (-1067.617) [-1069.002] -- 0:00:57
Average standard deviation of split frequencies: 0.030872
50500 -- (-1078.196) [-1067.729] (-1070.144) (-1068.977) * (-1069.611) (-1067.273) (-1070.328) [-1066.314] -- 0:00:56
51000 -- [-1077.921] (-1070.665) (-1066.751) (-1067.799) * (-1067.049) [-1066.448] (-1067.552) (-1067.658) -- 0:00:55
51500 -- [-1075.943] (-1070.309) (-1067.346) (-1066.012) * (-1066.078) (-1067.519) [-1066.804] (-1071.693) -- 0:00:55
52000 -- (-1074.776) [-1069.937] (-1066.554) (-1068.322) * (-1066.917) [-1071.988] (-1066.602) (-1072.695) -- 0:00:54
52500 -- (-1071.906) (-1071.988) (-1066.546) [-1068.968] * (-1067.607) (-1068.912) (-1067.920) [-1067.407] -- 0:00:54
53000 -- (-1079.673) (-1071.442) [-1066.417] (-1067.928) * (-1068.751) (-1067.037) (-1070.261) [-1069.159] -- 0:00:53
53500 -- (-1091.772) (-1067.559) (-1066.898) [-1067.755] * [-1069.290] (-1068.913) (-1069.984) (-1068.297) -- 0:00:53
54000 -- [-1079.591] (-1068.592) (-1071.754) (-1069.388) * (-1071.522) [-1066.944] (-1067.969) (-1069.527) -- 0:00:52
54500 -- (-1078.297) (-1068.375) [-1066.686] (-1068.383) * (-1069.528) (-1071.100) [-1067.952] (-1071.164) -- 0:00:52
55000 -- (-1074.321) [-1068.984] (-1069.459) (-1071.926) * (-1071.252) [-1071.195] (-1075.293) (-1068.380) -- 0:00:51
Average standard deviation of split frequencies: 0.029042
55500 -- (-1076.911) [-1071.403] (-1068.057) (-1069.626) * (-1071.622) (-1068.878) (-1068.918) [-1067.403] -- 0:00:51
56000 -- (-1075.597) (-1069.640) [-1068.861] (-1067.083) * (-1067.161) (-1068.582) [-1068.153] (-1067.833) -- 0:00:50
56500 -- [-1076.484] (-1068.892) (-1068.320) (-1067.609) * [-1067.848] (-1068.875) (-1066.785) (-1067.856) -- 0:00:50
57000 -- (-1080.511) (-1070.354) [-1066.967] (-1067.038) * [-1068.226] (-1069.808) (-1067.378) (-1067.536) -- 0:00:49
57500 -- (-1074.319) (-1071.251) [-1067.595] (-1070.735) * (-1068.779) (-1067.058) (-1075.227) [-1068.671] -- 0:00:49
58000 -- [-1076.502] (-1069.146) (-1066.683) (-1069.359) * [-1068.422] (-1070.225) (-1072.408) (-1067.516) -- 0:00:48
58500 -- [-1075.755] (-1070.336) (-1066.412) (-1068.504) * (-1067.887) [-1070.579] (-1070.158) (-1068.661) -- 0:00:48
59000 -- [-1076.255] (-1067.877) (-1066.461) (-1068.908) * (-1067.641) [-1068.453] (-1067.894) (-1068.134) -- 0:00:47
59500 -- (-1080.670) [-1066.343] (-1070.805) (-1068.551) * (-1067.061) (-1071.222) [-1067.848] (-1067.446) -- 0:01:03
60000 -- [-1075.022] (-1066.316) (-1077.757) (-1068.865) * (-1068.702) (-1070.712) (-1067.440) [-1067.095] -- 0:01:02
Average standard deviation of split frequencies: 0.028862
60500 -- (-1086.558) (-1067.448) (-1072.098) [-1067.760] * (-1069.219) [-1071.329] (-1067.293) (-1069.656) -- 0:01:02
61000 -- (-1077.398) (-1069.328) [-1067.487] (-1073.358) * (-1069.392) [-1066.218] (-1069.635) (-1068.999) -- 0:01:01
61500 -- (-1075.276) (-1067.316) (-1066.838) [-1070.644] * [-1068.453] (-1067.664) (-1067.439) (-1068.511) -- 0:01:01
62000 -- [-1075.036] (-1066.964) (-1067.797) (-1068.419) * (-1069.698) [-1069.249] (-1066.511) (-1066.888) -- 0:01:00
62500 -- (-1086.449) [-1067.084] (-1069.102) (-1067.994) * (-1066.830) (-1067.854) [-1066.448] (-1067.221) -- 0:01:00
63000 -- [-1072.799] (-1068.362) (-1069.500) (-1068.573) * [-1066.678] (-1067.565) (-1067.272) (-1067.442) -- 0:00:59
63500 -- (-1082.244) [-1068.595] (-1068.473) (-1070.049) * (-1071.136) (-1070.982) (-1068.739) [-1066.900] -- 0:00:58
64000 -- (-1084.996) (-1068.761) (-1069.164) [-1067.294] * (-1070.802) [-1069.698] (-1067.877) (-1067.454) -- 0:00:58
64500 -- (-1078.397) (-1069.145) [-1068.232] (-1067.002) * (-1070.052) (-1068.236) [-1067.421] (-1066.557) -- 0:00:58
65000 -- (-1078.333) (-1068.001) [-1066.624] (-1068.269) * (-1069.164) (-1068.535) (-1067.719) [-1067.538] -- 0:00:57
Average standard deviation of split frequencies: 0.031167
65500 -- [-1079.962] (-1068.062) (-1066.691) (-1068.656) * (-1068.097) (-1067.579) (-1067.674) [-1068.253] -- 0:00:57
66000 -- [-1075.285] (-1067.094) (-1067.312) (-1068.238) * (-1067.189) (-1072.054) (-1069.435) [-1067.966] -- 0:00:56
66500 -- (-1076.265) [-1067.094] (-1066.460) (-1072.419) * (-1072.222) [-1066.007] (-1070.888) (-1067.497) -- 0:00:56
67000 -- (-1102.177) (-1067.121) [-1066.749] (-1070.011) * (-1072.707) [-1066.611] (-1072.518) (-1067.606) -- 0:00:55
67500 -- (-1072.794) (-1068.497) [-1067.900] (-1070.511) * (-1069.130) [-1070.831] (-1068.910) (-1067.236) -- 0:00:55
68000 -- [-1067.909] (-1067.659) (-1067.976) (-1069.610) * (-1072.624) (-1067.946) (-1069.615) [-1069.106] -- 0:00:54
68500 -- (-1069.584) (-1066.928) (-1068.484) [-1067.454] * (-1069.907) (-1068.513) [-1072.866] (-1068.428) -- 0:00:54
69000 -- [-1066.807] (-1067.178) (-1067.713) (-1069.998) * [-1068.564] (-1068.440) (-1069.304) (-1068.119) -- 0:00:53
69500 -- [-1066.966] (-1066.534) (-1069.512) (-1071.594) * (-1069.408) (-1068.612) (-1068.026) [-1072.289] -- 0:00:53
70000 -- (-1070.722) [-1068.767] (-1068.664) (-1066.485) * (-1070.673) [-1068.449] (-1067.478) (-1068.276) -- 0:00:53
Average standard deviation of split frequencies: 0.032401
70500 -- [-1066.832] (-1067.967) (-1067.017) (-1067.071) * (-1073.364) [-1069.713] (-1070.827) (-1068.970) -- 0:00:52
71000 -- (-1071.165) [-1067.109] (-1068.217) (-1066.560) * (-1071.871) [-1067.642] (-1072.545) (-1070.442) -- 0:00:52
71500 -- (-1069.687) [-1067.033] (-1069.172) (-1067.175) * [-1068.722] (-1068.331) (-1070.510) (-1072.549) -- 0:00:51
72000 -- (-1071.822) (-1069.907) [-1067.884] (-1067.198) * (-1070.815) (-1067.424) (-1070.327) [-1069.165] -- 0:00:51
72500 -- (-1070.058) (-1069.705) (-1068.538) [-1068.230] * (-1067.299) (-1066.593) [-1069.408] (-1072.693) -- 0:00:51
73000 -- (-1068.042) (-1070.435) (-1069.221) [-1067.273] * (-1066.575) (-1067.140) [-1067.776] (-1068.628) -- 0:00:50
73500 -- (-1067.629) (-1071.337) [-1068.122] (-1066.796) * [-1066.713] (-1069.489) (-1066.790) (-1069.157) -- 0:00:50
74000 -- (-1066.777) (-1073.980) (-1069.776) [-1066.238] * (-1068.570) (-1070.237) [-1067.595] (-1067.469) -- 0:00:50
74500 -- (-1066.263) (-1072.751) (-1066.907) [-1066.566] * (-1070.663) [-1067.359] (-1067.308) (-1067.679) -- 0:00:49
75000 -- (-1068.668) (-1069.458) [-1069.361] (-1070.445) * (-1066.954) [-1066.673] (-1068.561) (-1067.529) -- 0:00:49
Average standard deviation of split frequencies: 0.028946
75500 -- [-1071.126] (-1068.864) (-1067.800) (-1068.202) * [-1070.757] (-1072.518) (-1068.838) (-1067.888) -- 0:00:48
76000 -- (-1071.498) (-1069.748) (-1070.721) [-1068.540] * [-1066.873] (-1069.165) (-1069.098) (-1070.523) -- 0:01:00
76500 -- [-1068.147] (-1067.997) (-1070.199) (-1070.090) * (-1070.406) (-1069.002) [-1068.695] (-1068.466) -- 0:01:00
77000 -- (-1071.241) (-1067.428) (-1066.686) [-1066.679] * (-1071.150) [-1068.109] (-1070.187) (-1067.376) -- 0:00:59
77500 -- (-1070.142) (-1068.978) (-1067.983) [-1067.468] * (-1068.498) (-1067.441) (-1069.269) [-1067.008] -- 0:00:59
78000 -- [-1067.640] (-1067.481) (-1068.902) (-1066.823) * [-1066.502] (-1074.893) (-1068.679) (-1066.991) -- 0:00:59
78500 -- [-1068.169] (-1066.678) (-1069.921) (-1066.908) * [-1066.725] (-1070.552) (-1069.542) (-1070.924) -- 0:00:58
79000 -- (-1069.506) [-1067.039] (-1067.194) (-1067.187) * (-1066.151) [-1073.516] (-1071.817) (-1068.874) -- 0:00:58
79500 -- (-1066.716) (-1066.775) [-1066.968] (-1068.527) * (-1068.579) (-1069.351) [-1069.859] (-1068.720) -- 0:00:57
80000 -- [-1068.153] (-1066.586) (-1071.465) (-1070.174) * (-1071.006) (-1067.543) [-1072.254] (-1068.042) -- 0:00:57
Average standard deviation of split frequencies: 0.029751
80500 -- (-1068.628) (-1066.502) (-1069.551) [-1067.030] * [-1070.718] (-1068.847) (-1071.400) (-1068.079) -- 0:00:57
81000 -- (-1068.035) (-1068.344) (-1069.887) [-1067.353] * (-1068.702) (-1066.333) (-1066.147) [-1068.458] -- 0:00:56
81500 -- (-1071.467) [-1066.064] (-1071.079) (-1071.209) * [-1067.548] (-1067.620) (-1066.147) (-1066.727) -- 0:00:56
82000 -- (-1070.868) (-1066.876) (-1071.760) [-1068.930] * [-1066.594] (-1067.030) (-1068.139) (-1070.172) -- 0:00:55
82500 -- (-1070.292) [-1068.133] (-1070.156) (-1068.932) * (-1070.330) (-1066.187) [-1068.700] (-1068.705) -- 0:00:55
83000 -- (-1071.597) [-1069.149] (-1070.610) (-1069.313) * (-1070.192) (-1066.646) (-1068.143) [-1068.226] -- 0:00:55
83500 -- (-1068.690) [-1067.056] (-1069.622) (-1069.843) * (-1069.980) (-1068.086) (-1069.876) [-1067.070] -- 0:00:54
84000 -- (-1070.642) (-1066.847) [-1070.195] (-1068.574) * (-1071.699) (-1069.405) [-1067.363] (-1071.303) -- 0:00:54
84500 -- (-1067.016) (-1068.283) [-1068.905] (-1069.057) * (-1068.837) (-1070.584) (-1069.049) [-1067.628] -- 0:00:54
85000 -- (-1069.059) (-1067.701) (-1069.025) [-1066.446] * (-1069.100) (-1069.376) (-1069.538) [-1066.863] -- 0:00:53
Average standard deviation of split frequencies: 0.030148
85500 -- (-1066.332) (-1068.572) (-1074.432) [-1066.507] * (-1069.505) (-1067.079) [-1067.779] (-1069.479) -- 0:00:53
86000 -- (-1066.292) [-1069.393] (-1066.831) (-1068.542) * (-1072.127) (-1068.456) (-1069.629) [-1066.334] -- 0:00:53
86500 -- [-1066.451] (-1067.894) (-1067.128) (-1067.064) * [-1067.271] (-1068.231) (-1068.737) (-1072.718) -- 0:00:52
87000 -- (-1066.766) [-1068.778] (-1066.153) (-1068.843) * (-1068.268) [-1067.632] (-1068.282) (-1067.725) -- 0:00:52
87500 -- [-1068.506] (-1068.041) (-1068.082) (-1067.743) * (-1067.338) (-1067.291) [-1068.015] (-1068.868) -- 0:00:52
88000 -- (-1067.293) [-1068.626] (-1069.780) (-1066.752) * [-1068.733] (-1072.770) (-1068.332) (-1069.347) -- 0:00:51
88500 -- (-1068.556) (-1070.607) (-1070.755) [-1068.055] * (-1067.224) (-1073.861) [-1067.481] (-1070.108) -- 0:00:51
89000 -- (-1067.550) (-1067.094) (-1068.550) [-1067.434] * (-1070.272) (-1072.215) [-1068.364] (-1068.256) -- 0:00:51
89500 -- (-1069.585) [-1066.699] (-1070.410) (-1069.487) * (-1066.943) [-1068.284] (-1069.020) (-1067.065) -- 0:00:50
90000 -- (-1066.409) (-1068.335) [-1068.028] (-1065.915) * (-1069.129) (-1068.278) (-1070.490) [-1066.757] -- 0:00:50
Average standard deviation of split frequencies: 0.028124
90500 -- (-1067.851) [-1069.805] (-1069.351) (-1065.896) * (-1073.055) (-1069.406) (-1069.880) [-1066.340] -- 0:00:50
91000 -- [-1068.355] (-1068.460) (-1068.970) (-1066.621) * [-1067.828] (-1069.899) (-1069.925) (-1066.462) -- 0:00:49
91500 -- (-1069.390) (-1068.866) [-1070.637] (-1074.868) * [-1072.668] (-1068.899) (-1069.577) (-1069.141) -- 0:00:49
92000 -- [-1068.877] (-1069.030) (-1070.686) (-1067.730) * (-1067.384) (-1072.697) [-1067.678] (-1068.362) -- 0:00:49
92500 -- (-1066.899) (-1070.453) [-1068.718] (-1068.539) * (-1067.897) (-1068.590) (-1070.280) [-1070.230] -- 0:00:58
93000 -- (-1070.640) (-1071.177) (-1071.165) [-1068.356] * (-1069.558) (-1069.368) (-1070.827) [-1066.695] -- 0:00:58
93500 -- (-1070.517) [-1068.440] (-1068.206) (-1068.672) * (-1070.031) (-1067.496) (-1068.390) [-1069.209] -- 0:00:58
94000 -- (-1071.542) [-1068.048] (-1069.339) (-1067.070) * (-1068.292) (-1068.287) [-1070.186] (-1067.626) -- 0:00:57
94500 -- [-1067.880] (-1068.626) (-1068.336) (-1066.042) * (-1068.114) [-1070.383] (-1069.415) (-1067.671) -- 0:00:57
95000 -- (-1072.821) (-1069.161) (-1070.955) [-1067.639] * (-1067.095) (-1071.938) [-1068.850] (-1066.884) -- 0:00:57
Average standard deviation of split frequencies: 0.026561
95500 -- (-1069.046) (-1067.292) (-1066.980) [-1066.768] * (-1067.616) (-1071.789) (-1072.031) [-1067.093] -- 0:00:56
96000 -- (-1066.427) [-1068.393] (-1067.094) (-1069.073) * (-1066.918) [-1072.099] (-1068.930) (-1067.191) -- 0:00:56
96500 -- (-1067.829) (-1068.875) [-1067.111] (-1070.043) * (-1069.751) (-1068.876) (-1068.000) [-1069.019] -- 0:00:56
97000 -- [-1066.662] (-1070.054) (-1067.116) (-1070.394) * (-1069.882) [-1069.856] (-1067.282) (-1070.821) -- 0:00:55
97500 -- [-1066.722] (-1069.681) (-1070.128) (-1069.072) * (-1069.381) [-1068.653] (-1067.895) (-1068.704) -- 0:00:55
98000 -- (-1066.991) (-1068.781) [-1067.618] (-1066.433) * (-1072.493) (-1071.688) [-1066.701] (-1068.188) -- 0:00:55
98500 -- (-1066.314) (-1070.404) [-1068.345] (-1068.241) * (-1069.702) [-1068.688] (-1071.770) (-1071.209) -- 0:00:54
99000 -- (-1066.251) [-1071.066] (-1069.143) (-1077.039) * (-1073.094) [-1066.895] (-1076.700) (-1073.274) -- 0:00:54
99500 -- [-1067.304] (-1068.185) (-1069.322) (-1067.991) * (-1066.751) [-1066.442] (-1069.855) (-1072.301) -- 0:00:54
100000 -- [-1068.462] (-1068.758) (-1067.563) (-1071.586) * (-1070.454) [-1066.626] (-1066.736) (-1070.206) -- 0:00:54
Average standard deviation of split frequencies: 0.024585
100500 -- (-1066.975) (-1068.935) (-1069.442) [-1069.019] * (-1069.333) (-1068.985) (-1067.358) [-1072.611] -- 0:00:53
101000 -- (-1067.692) (-1068.540) (-1070.873) [-1066.465] * (-1070.222) (-1066.816) (-1070.108) [-1072.742] -- 0:00:53
101500 -- [-1066.955] (-1067.975) (-1068.493) (-1069.163) * (-1067.574) [-1066.449] (-1072.015) (-1068.505) -- 0:00:53
102000 -- (-1070.989) (-1066.888) [-1067.142] (-1067.795) * (-1066.829) (-1067.351) (-1067.284) [-1069.736] -- 0:00:52
102500 -- (-1067.590) (-1067.895) [-1066.586] (-1071.015) * (-1067.328) [-1067.119] (-1068.264) (-1069.606) -- 0:00:52
103000 -- (-1072.856) (-1067.386) (-1070.653) [-1068.594] * (-1067.320) (-1067.599) (-1069.777) [-1067.854] -- 0:00:52
103500 -- (-1073.478) (-1071.612) [-1068.013] (-1067.374) * (-1067.162) (-1070.477) [-1069.343] (-1072.540) -- 0:00:51
104000 -- (-1068.409) (-1069.839) (-1066.510) [-1068.674] * [-1066.204] (-1067.928) (-1067.221) (-1068.374) -- 0:00:51
104500 -- (-1068.309) (-1066.643) (-1072.924) [-1067.835] * (-1066.476) (-1068.529) (-1068.002) [-1068.563] -- 0:00:51
105000 -- (-1068.669) (-1067.844) (-1067.776) [-1069.091] * (-1066.220) (-1070.156) (-1069.616) [-1068.236] -- 0:00:51
Average standard deviation of split frequencies: 0.019483
105500 -- (-1069.127) (-1067.928) [-1066.725] (-1069.377) * (-1067.008) (-1071.162) (-1067.704) [-1069.394] -- 0:00:50
106000 -- (-1069.878) (-1067.656) [-1066.954] (-1070.824) * (-1066.405) (-1072.960) [-1067.599] (-1071.015) -- 0:00:50
106500 -- (-1070.264) (-1070.848) [-1069.677] (-1070.358) * (-1066.023) (-1072.784) (-1068.791) [-1067.203] -- 0:00:50
107000 -- [-1066.541] (-1067.604) (-1070.805) (-1071.391) * (-1068.828) (-1066.500) (-1067.888) [-1068.718] -- 0:00:50
107500 -- (-1068.748) (-1068.147) [-1070.455] (-1067.980) * (-1069.002) (-1067.748) (-1068.078) [-1069.725] -- 0:00:49
108000 -- (-1067.404) (-1069.746) (-1074.120) [-1069.479] * [-1068.465] (-1066.379) (-1069.106) (-1066.856) -- 0:00:49
108500 -- (-1069.024) [-1067.950] (-1073.726) (-1069.137) * (-1067.968) (-1067.254) [-1069.495] (-1070.249) -- 0:00:49
109000 -- [-1069.369] (-1069.016) (-1071.513) (-1068.020) * (-1067.702) (-1067.826) (-1069.659) [-1069.750] -- 0:00:57
109500 -- (-1068.168) (-1068.956) (-1067.894) [-1070.843] * (-1067.786) [-1067.542] (-1070.171) (-1066.766) -- 0:00:56
110000 -- [-1067.034] (-1069.557) (-1068.257) (-1066.499) * (-1068.153) (-1068.562) (-1068.962) [-1067.067] -- 0:00:56
Average standard deviation of split frequencies: 0.021085
110500 -- (-1067.271) (-1067.220) [-1068.134] (-1071.513) * (-1069.888) (-1073.556) [-1067.709] (-1067.379) -- 0:00:56
111000 -- (-1069.079) (-1066.680) (-1070.175) [-1069.689] * (-1066.847) (-1068.895) [-1068.363] (-1067.513) -- 0:00:56
111500 -- (-1070.460) (-1070.108) (-1067.722) [-1067.174] * (-1073.627) (-1069.026) (-1070.390) [-1067.283] -- 0:00:55
112000 -- [-1070.587] (-1075.015) (-1069.946) (-1071.314) * (-1066.408) (-1068.276) [-1067.818] (-1067.500) -- 0:00:55
112500 -- [-1067.998] (-1070.095) (-1067.415) (-1072.180) * [-1068.601] (-1067.911) (-1068.523) (-1067.928) -- 0:00:55
113000 -- (-1067.094) (-1069.242) (-1071.805) [-1068.667] * (-1070.332) [-1068.346] (-1067.821) (-1070.746) -- 0:00:54
113500 -- [-1067.673] (-1067.309) (-1071.092) (-1071.277) * (-1069.922) (-1073.237) [-1070.286] (-1071.833) -- 0:00:54
114000 -- (-1066.633) (-1066.941) (-1069.261) [-1066.600] * (-1071.515) (-1080.331) [-1070.031] (-1067.570) -- 0:00:54
114500 -- (-1067.853) [-1066.803] (-1069.341) (-1068.311) * (-1068.903) [-1070.217] (-1071.067) (-1070.982) -- 0:00:54
115000 -- (-1067.283) [-1067.432] (-1068.828) (-1069.843) * [-1070.940] (-1071.168) (-1069.308) (-1066.839) -- 0:00:53
Average standard deviation of split frequencies: 0.023977
115500 -- (-1067.686) (-1067.912) [-1068.575] (-1069.096) * (-1070.191) [-1067.577] (-1067.080) (-1066.727) -- 0:00:53
116000 -- (-1070.142) (-1067.713) [-1070.167] (-1068.643) * (-1069.658) (-1067.506) [-1067.518] (-1068.101) -- 0:00:53
116500 -- (-1069.589) (-1067.553) (-1070.809) [-1066.920] * [-1069.397] (-1068.417) (-1067.427) (-1069.284) -- 0:00:53
117000 -- (-1069.123) [-1071.610] (-1066.854) (-1067.444) * (-1070.077) [-1071.062] (-1070.541) (-1068.332) -- 0:00:52
117500 -- (-1069.872) (-1072.271) (-1068.272) [-1067.090] * (-1067.563) (-1071.266) [-1067.401] (-1069.127) -- 0:00:52
118000 -- (-1066.579) (-1068.822) (-1065.919) [-1071.499] * [-1068.526] (-1066.845) (-1066.772) (-1068.669) -- 0:00:52
118500 -- [-1066.587] (-1070.406) (-1065.967) (-1069.427) * (-1068.090) (-1067.010) [-1068.370] (-1069.456) -- 0:00:52
119000 -- (-1068.687) (-1068.516) (-1069.761) [-1069.083] * (-1068.385) [-1068.192] (-1068.544) (-1070.365) -- 0:00:51
119500 -- (-1067.254) (-1068.211) [-1068.731] (-1068.077) * (-1069.182) [-1068.450] (-1066.638) (-1068.938) -- 0:00:51
120000 -- (-1066.500) (-1066.441) [-1068.731] (-1067.408) * (-1067.847) [-1071.348] (-1068.176) (-1068.480) -- 0:00:51
Average standard deviation of split frequencies: 0.018014
120500 -- [-1066.310] (-1066.450) (-1070.242) (-1070.406) * [-1069.403] (-1068.236) (-1066.770) (-1068.834) -- 0:00:51
121000 -- (-1066.716) (-1067.127) (-1072.159) [-1069.633] * (-1067.731) (-1069.020) (-1070.915) [-1067.440] -- 0:00:50
121500 -- [-1066.593] (-1067.006) (-1069.712) (-1069.299) * (-1066.596) (-1069.449) [-1070.586] (-1070.813) -- 0:00:50
122000 -- (-1066.562) (-1066.303) (-1067.926) [-1068.846] * (-1069.355) [-1066.917] (-1069.147) (-1072.028) -- 0:00:50
122500 -- [-1066.399] (-1067.387) (-1069.922) (-1069.132) * (-1067.086) [-1067.224] (-1068.702) (-1066.626) -- 0:00:50
123000 -- (-1067.936) [-1066.278] (-1066.526) (-1067.704) * (-1066.565) (-1068.186) (-1067.660) [-1069.785] -- 0:00:49
123500 -- (-1067.236) (-1066.389) (-1066.867) [-1071.724] * (-1069.163) (-1068.013) (-1068.226) [-1068.427] -- 0:00:49
124000 -- [-1066.871] (-1066.455) (-1066.835) (-1067.166) * (-1071.928) (-1068.339) [-1068.203] (-1070.903) -- 0:00:49
124500 -- (-1066.099) [-1071.443] (-1067.822) (-1066.902) * (-1067.050) (-1070.155) [-1067.620] (-1067.503) -- 0:00:49
125000 -- (-1069.856) (-1066.629) [-1066.501] (-1068.276) * (-1068.700) [-1071.321] (-1070.144) (-1071.845) -- 0:00:49
Average standard deviation of split frequencies: 0.021069
125500 -- (-1067.192) [-1066.874] (-1066.660) (-1070.008) * (-1069.501) (-1067.777) [-1069.715] (-1068.629) -- 0:00:55
126000 -- (-1066.362) (-1066.046) [-1067.397] (-1072.200) * (-1069.874) [-1067.848] (-1067.299) (-1069.588) -- 0:00:55
126500 -- (-1070.576) (-1066.527) (-1071.778) [-1071.536] * (-1068.251) (-1067.468) (-1069.101) [-1068.727] -- 0:00:55
127000 -- [-1068.437] (-1073.096) (-1070.241) (-1069.015) * (-1067.488) [-1067.254] (-1070.111) (-1067.926) -- 0:00:54
127500 -- (-1070.154) [-1068.101] (-1070.828) (-1066.550) * [-1067.335] (-1067.268) (-1066.594) (-1068.548) -- 0:00:54
128000 -- (-1068.920) (-1069.362) [-1066.775] (-1067.397) * (-1067.413) (-1069.044) (-1068.706) [-1068.679] -- 0:00:54
128500 -- [-1069.758] (-1069.196) (-1066.227) (-1068.728) * (-1068.555) [-1067.665] (-1066.835) (-1068.454) -- 0:00:54
129000 -- (-1068.341) (-1069.730) [-1068.369] (-1072.738) * (-1069.475) (-1069.008) [-1066.942] (-1066.902) -- 0:00:54
129500 -- [-1068.784] (-1066.721) (-1068.071) (-1068.690) * (-1069.395) (-1070.154) (-1069.365) [-1070.608] -- 0:00:53
130000 -- (-1070.375) (-1071.336) (-1071.426) [-1068.047] * (-1073.288) (-1068.425) [-1067.746] (-1072.827) -- 0:00:53
Average standard deviation of split frequencies: 0.022216
130500 -- (-1070.667) (-1070.036) (-1068.904) [-1067.201] * (-1071.110) (-1066.774) [-1067.253] (-1070.948) -- 0:00:53
131000 -- (-1074.368) (-1068.849) [-1070.767] (-1067.516) * (-1068.550) (-1074.002) (-1066.909) [-1072.062] -- 0:00:53
131500 -- [-1067.290] (-1067.585) (-1074.226) (-1068.603) * (-1066.494) [-1069.279] (-1069.177) (-1069.669) -- 0:00:52
132000 -- (-1069.701) (-1068.398) (-1070.739) [-1068.146] * (-1070.002) [-1068.174] (-1069.788) (-1068.742) -- 0:00:52
132500 -- (-1069.731) (-1067.435) (-1067.158) [-1070.586] * (-1069.955) (-1067.755) [-1069.154] (-1069.705) -- 0:00:52
133000 -- (-1071.362) (-1067.902) [-1068.089] (-1067.377) * (-1068.151) [-1067.013] (-1068.289) (-1070.841) -- 0:00:52
133500 -- (-1068.034) (-1068.089) [-1066.709] (-1066.523) * (-1069.544) [-1069.751] (-1067.350) (-1070.327) -- 0:00:51
134000 -- (-1070.947) [-1068.678] (-1066.710) (-1066.652) * (-1068.890) (-1071.768) (-1067.162) [-1068.249] -- 0:00:51
134500 -- [-1068.041] (-1068.002) (-1067.322) (-1071.773) * [-1068.588] (-1067.197) (-1071.882) (-1070.208) -- 0:00:51
135000 -- [-1067.602] (-1068.508) (-1067.431) (-1066.499) * [-1069.129] (-1067.000) (-1069.897) (-1072.115) -- 0:00:51
Average standard deviation of split frequencies: 0.021709
135500 -- (-1068.727) [-1068.782] (-1067.542) (-1069.909) * (-1067.779) [-1068.270] (-1070.177) (-1073.098) -- 0:00:51
136000 -- [-1070.600] (-1069.679) (-1067.838) (-1073.078) * (-1067.427) [-1066.676] (-1069.158) (-1071.576) -- 0:00:50
136500 -- (-1070.612) [-1067.118] (-1070.508) (-1067.973) * (-1069.866) (-1068.960) [-1068.655] (-1071.847) -- 0:00:50
137000 -- (-1068.635) (-1070.624) (-1071.856) [-1068.248] * [-1067.839] (-1067.627) (-1068.464) (-1067.159) -- 0:00:50
137500 -- (-1067.852) [-1068.705] (-1070.275) (-1066.548) * [-1067.314] (-1069.148) (-1070.996) (-1067.722) -- 0:00:50
138000 -- [-1066.672] (-1067.887) (-1070.908) (-1067.079) * [-1069.682] (-1066.880) (-1073.785) (-1068.796) -- 0:00:49
138500 -- (-1066.853) (-1068.951) (-1073.652) [-1066.877] * (-1071.241) (-1067.362) [-1067.808] (-1067.920) -- 0:00:49
139000 -- (-1068.165) [-1067.271] (-1068.480) (-1068.078) * (-1069.435) [-1068.916] (-1067.653) (-1069.900) -- 0:00:49
139500 -- (-1068.305) (-1067.609) [-1070.997] (-1067.470) * (-1071.302) [-1068.246] (-1069.665) (-1067.618) -- 0:00:49
140000 -- (-1068.960) (-1067.815) [-1069.694] (-1066.476) * (-1067.859) [-1068.624] (-1070.363) (-1067.408) -- 0:00:49
Average standard deviation of split frequencies: 0.023459
140500 -- (-1067.867) (-1067.149) (-1067.723) [-1067.243] * (-1067.837) (-1069.178) [-1070.834] (-1067.748) -- 0:00:48
141000 -- (-1068.270) [-1068.169] (-1066.670) (-1067.971) * (-1068.101) [-1068.362] (-1070.908) (-1068.351) -- 0:00:48
141500 -- (-1070.946) (-1069.271) (-1066.308) [-1067.783] * [-1067.329] (-1069.245) (-1067.802) (-1069.286) -- 0:00:48
142000 -- (-1068.222) [-1071.163] (-1069.129) (-1071.210) * [-1066.095] (-1068.961) (-1068.199) (-1069.163) -- 0:00:54
142500 -- (-1069.512) (-1069.002) (-1069.079) [-1066.588] * [-1069.445] (-1066.572) (-1066.841) (-1069.520) -- 0:00:54
143000 -- (-1069.015) (-1067.264) [-1067.924] (-1069.047) * (-1067.780) [-1068.281] (-1070.860) (-1068.082) -- 0:00:53
143500 -- [-1070.424] (-1067.574) (-1067.538) (-1067.908) * (-1071.686) (-1066.955) [-1071.403] (-1066.800) -- 0:00:53
144000 -- (-1070.044) (-1066.289) [-1069.130] (-1072.419) * (-1069.444) (-1067.258) (-1068.958) [-1068.493] -- 0:00:53
144500 -- [-1071.590] (-1066.156) (-1068.901) (-1071.349) * [-1071.527] (-1068.733) (-1066.370) (-1068.516) -- 0:00:53
145000 -- (-1070.509) (-1066.331) [-1066.532] (-1069.360) * (-1069.778) (-1068.410) (-1067.747) [-1068.920] -- 0:00:53
Average standard deviation of split frequencies: 0.023247
145500 -- (-1070.206) (-1066.309) (-1068.306) [-1068.704] * (-1069.017) [-1067.530] (-1072.580) (-1067.960) -- 0:00:52
146000 -- (-1073.714) (-1068.033) (-1068.065) [-1067.569] * (-1068.446) (-1067.808) (-1068.697) [-1068.362] -- 0:00:52
146500 -- (-1071.394) (-1070.215) (-1071.163) [-1067.226] * [-1073.032] (-1067.047) (-1066.898) (-1073.455) -- 0:00:52
147000 -- [-1075.085] (-1072.446) (-1071.433) (-1070.024) * (-1067.913) (-1067.671) [-1066.722] (-1073.252) -- 0:00:52
147500 -- [-1070.275] (-1071.340) (-1069.641) (-1069.763) * (-1068.632) [-1066.296] (-1067.423) (-1068.974) -- 0:00:52
148000 -- [-1069.619] (-1069.105) (-1069.566) (-1070.793) * (-1068.647) (-1068.259) [-1070.262] (-1068.384) -- 0:00:51
148500 -- (-1068.320) (-1069.670) [-1068.731] (-1068.285) * (-1067.384) (-1071.107) (-1068.899) [-1070.726] -- 0:00:51
149000 -- [-1066.533] (-1071.672) (-1067.596) (-1072.492) * [-1068.545] (-1068.359) (-1068.130) (-1070.698) -- 0:00:51
149500 -- (-1066.499) (-1069.124) [-1071.332] (-1066.946) * (-1069.004) (-1067.763) (-1068.006) [-1068.864] -- 0:00:51
150000 -- (-1066.659) (-1068.904) (-1068.619) [-1071.950] * (-1068.028) (-1069.954) (-1069.225) [-1067.858] -- 0:00:51
Average standard deviation of split frequencies: 0.024042
150500 -- (-1069.430) (-1073.553) (-1069.258) [-1069.856] * (-1070.113) (-1070.141) [-1070.012] (-1068.280) -- 0:00:50
151000 -- [-1067.202] (-1066.918) (-1069.419) (-1067.964) * [-1070.322] (-1071.902) (-1067.126) (-1066.967) -- 0:00:50
151500 -- (-1067.791) (-1069.728) (-1072.938) [-1066.303] * (-1069.792) (-1069.772) (-1068.579) [-1066.177] -- 0:00:50
152000 -- (-1066.471) (-1068.481) (-1068.394) [-1068.924] * (-1069.868) (-1067.719) [-1066.970] (-1066.425) -- 0:00:50
152500 -- [-1067.217] (-1067.897) (-1068.493) (-1074.869) * (-1069.560) (-1068.025) (-1066.702) [-1066.274] -- 0:00:50
153000 -- (-1067.313) (-1070.258) [-1068.216] (-1068.345) * (-1068.690) (-1068.275) (-1068.938) [-1066.993] -- 0:00:49
153500 -- (-1067.270) [-1068.723] (-1067.331) (-1068.246) * (-1073.445) (-1067.994) [-1068.393] (-1070.727) -- 0:00:49
154000 -- [-1069.881] (-1071.572) (-1068.900) (-1069.218) * (-1066.658) [-1070.458] (-1070.140) (-1073.063) -- 0:00:49
154500 -- (-1067.859) (-1073.276) (-1066.673) [-1067.668] * (-1069.278) (-1070.136) (-1073.043) [-1068.021] -- 0:00:49
155000 -- (-1066.806) (-1072.601) (-1067.397) [-1066.858] * (-1068.682) (-1069.700) [-1071.232] (-1069.879) -- 0:00:49
Average standard deviation of split frequencies: 0.022902
155500 -- (-1067.095) [-1067.759] (-1067.168) (-1068.787) * (-1067.495) [-1067.394] (-1069.987) (-1067.555) -- 0:00:48
156000 -- (-1068.705) [-1068.105] (-1066.397) (-1068.434) * (-1071.631) (-1067.648) [-1073.049] (-1066.132) -- 0:00:48
156500 -- [-1069.675] (-1070.219) (-1068.705) (-1068.628) * [-1069.691] (-1068.108) (-1069.606) (-1068.122) -- 0:00:48
157000 -- [-1068.959] (-1073.652) (-1069.060) (-1068.473) * (-1069.783) (-1066.013) [-1069.606] (-1068.340) -- 0:00:48
157500 -- [-1067.632] (-1072.941) (-1070.904) (-1067.404) * (-1068.770) (-1066.944) [-1070.102] (-1068.784) -- 0:00:48
158000 -- (-1070.272) (-1069.801) [-1069.328] (-1069.552) * (-1067.748) (-1066.997) (-1067.909) [-1066.675] -- 0:00:47
158500 -- (-1066.597) (-1068.375) (-1069.488) [-1068.851] * [-1068.730] (-1066.911) (-1067.792) (-1066.675) -- 0:00:53
159000 -- [-1067.851] (-1067.490) (-1069.539) (-1068.138) * (-1067.237) [-1068.956] (-1067.793) (-1067.130) -- 0:00:52
159500 -- [-1069.343] (-1066.096) (-1068.429) (-1067.436) * [-1066.250] (-1067.045) (-1071.007) (-1068.178) -- 0:00:52
160000 -- (-1068.078) [-1070.399] (-1066.285) (-1069.783) * (-1071.475) (-1068.756) (-1068.777) [-1068.603] -- 0:00:52
Average standard deviation of split frequencies: 0.021619
160500 -- (-1072.312) (-1067.632) [-1067.334] (-1073.883) * [-1067.665] (-1068.529) (-1067.568) (-1070.281) -- 0:00:52
161000 -- (-1069.555) (-1067.617) (-1070.261) [-1067.322] * (-1069.525) [-1069.120] (-1067.824) (-1067.658) -- 0:00:52
161500 -- (-1069.997) (-1070.567) (-1067.809) [-1068.175] * [-1070.107] (-1067.377) (-1069.165) (-1076.860) -- 0:00:51
162000 -- (-1072.158) (-1072.983) [-1069.024] (-1067.406) * [-1069.593] (-1067.355) (-1067.187) (-1073.795) -- 0:00:51
162500 -- (-1067.089) (-1072.647) [-1068.685] (-1069.138) * [-1067.562] (-1070.405) (-1066.936) (-1066.864) -- 0:00:51
163000 -- [-1067.594] (-1071.055) (-1067.950) (-1069.441) * (-1068.287) (-1067.784) (-1067.099) [-1067.325] -- 0:00:51
163500 -- (-1072.058) (-1069.165) (-1067.631) [-1068.888] * (-1069.436) (-1066.381) [-1070.228] (-1068.933) -- 0:00:51
164000 -- (-1073.109) [-1069.130] (-1066.310) (-1069.440) * (-1068.547) [-1075.175] (-1070.080) (-1066.974) -- 0:00:50
164500 -- [-1070.454] (-1068.104) (-1068.298) (-1068.348) * (-1068.509) (-1071.066) (-1069.949) [-1069.413] -- 0:00:50
165000 -- (-1072.168) [-1068.047] (-1068.368) (-1069.232) * [-1070.765] (-1067.914) (-1069.718) (-1069.914) -- 0:00:50
Average standard deviation of split frequencies: 0.018175
165500 -- [-1068.156] (-1067.129) (-1069.387) (-1068.499) * (-1067.858) [-1068.421] (-1074.027) (-1071.877) -- 0:00:50
166000 -- (-1067.039) (-1068.054) [-1070.443] (-1068.156) * [-1067.462] (-1068.081) (-1067.979) (-1070.703) -- 0:00:50
166500 -- (-1068.001) (-1070.244) [-1068.423] (-1067.819) * (-1069.232) (-1069.331) [-1066.851] (-1071.151) -- 0:00:50
167000 -- (-1068.359) (-1069.874) [-1068.580] (-1069.226) * (-1069.463) [-1066.800] (-1067.160) (-1071.379) -- 0:00:49
167500 -- (-1069.008) (-1073.379) [-1071.018] (-1070.266) * [-1069.602] (-1066.077) (-1067.532) (-1069.771) -- 0:00:49
168000 -- (-1069.949) (-1069.635) (-1068.964) [-1069.031] * (-1067.958) (-1066.822) [-1070.103] (-1070.900) -- 0:00:49
168500 -- [-1070.544] (-1072.084) (-1066.974) (-1068.839) * [-1069.476] (-1069.608) (-1066.357) (-1069.012) -- 0:00:49
169000 -- (-1066.914) (-1067.050) [-1066.721] (-1067.110) * (-1068.873) (-1068.748) (-1067.457) [-1070.815] -- 0:00:49
169500 -- (-1068.306) [-1067.482] (-1066.135) (-1068.413) * [-1072.030] (-1066.401) (-1069.430) (-1067.840) -- 0:00:48
170000 -- (-1066.782) (-1066.677) [-1066.419] (-1073.652) * (-1071.154) (-1071.531) [-1066.441] (-1068.107) -- 0:00:48
Average standard deviation of split frequencies: 0.019197
170500 -- (-1066.869) [-1068.638] (-1068.283) (-1068.269) * [-1068.552] (-1069.698) (-1067.590) (-1069.030) -- 0:00:48
171000 -- [-1066.349] (-1067.898) (-1068.281) (-1068.282) * (-1067.882) (-1067.344) (-1068.775) [-1067.138] -- 0:00:48
171500 -- (-1070.567) [-1066.612] (-1067.288) (-1069.749) * (-1068.469) (-1070.482) (-1068.560) [-1067.268] -- 0:00:48
172000 -- (-1070.587) (-1070.668) [-1069.745] (-1067.938) * (-1067.399) (-1069.136) [-1067.582] (-1067.032) -- 0:00:48
172500 -- (-1067.902) (-1074.498) [-1066.769] (-1068.728) * [-1069.509] (-1066.822) (-1066.703) (-1068.826) -- 0:00:47
173000 -- (-1071.744) [-1069.719] (-1067.286) (-1070.141) * (-1072.690) (-1068.424) (-1074.662) [-1067.801] -- 0:00:47
173500 -- (-1070.098) (-1070.351) [-1067.505] (-1067.328) * [-1068.880] (-1067.205) (-1066.507) (-1071.222) -- 0:00:47
174000 -- (-1067.904) (-1067.202) (-1067.389) [-1068.303] * (-1067.606) (-1068.677) [-1066.501] (-1066.614) -- 0:00:47
174500 -- [-1067.897] (-1067.249) (-1067.361) (-1067.698) * (-1066.987) [-1068.174] (-1066.230) (-1066.894) -- 0:00:47
175000 -- [-1067.688] (-1066.353) (-1068.289) (-1066.918) * (-1072.872) [-1066.459] (-1069.098) (-1068.696) -- 0:00:51
Average standard deviation of split frequencies: 0.018347
175500 -- (-1068.572) (-1069.785) [-1069.069] (-1068.580) * [-1069.972] (-1067.758) (-1068.109) (-1070.214) -- 0:00:51
176000 -- (-1067.927) (-1070.862) [-1068.893] (-1070.309) * (-1067.493) [-1067.751] (-1070.562) (-1069.145) -- 0:00:51
176500 -- [-1068.805] (-1071.377) (-1071.194) (-1070.890) * (-1067.554) (-1069.453) (-1069.521) [-1067.112] -- 0:00:51
177000 -- [-1068.168] (-1067.642) (-1067.809) (-1068.197) * (-1067.427) (-1068.592) (-1072.308) [-1066.881] -- 0:00:51
177500 -- (-1070.468) (-1067.129) [-1070.034] (-1067.551) * (-1069.962) (-1066.524) (-1069.970) [-1066.286] -- 0:00:50
178000 -- (-1070.334) (-1067.658) [-1067.727] (-1067.660) * (-1068.373) [-1066.461] (-1066.739) (-1068.173) -- 0:00:50
178500 -- (-1070.278) (-1067.799) [-1071.924] (-1067.665) * [-1067.533] (-1066.375) (-1067.000) (-1067.147) -- 0:00:50
179000 -- [-1068.903] (-1067.284) (-1067.362) (-1070.615) * [-1068.409] (-1067.475) (-1067.750) (-1070.837) -- 0:00:50
179500 -- [-1068.230] (-1067.765) (-1068.209) (-1068.580) * (-1071.270) (-1069.638) (-1068.176) [-1069.760] -- 0:00:50
180000 -- [-1067.280] (-1067.240) (-1068.398) (-1067.437) * (-1066.507) [-1067.996] (-1066.849) (-1068.431) -- 0:00:50
Average standard deviation of split frequencies: 0.019439
180500 -- (-1066.814) [-1067.323] (-1069.328) (-1067.713) * (-1068.002) [-1068.422] (-1068.221) (-1068.441) -- 0:00:49
181000 -- (-1068.126) (-1073.296) [-1066.885] (-1069.305) * [-1066.192] (-1068.180) (-1068.334) (-1067.335) -- 0:00:49
181500 -- (-1068.127) (-1070.492) (-1069.668) [-1067.415] * [-1068.444] (-1067.105) (-1067.232) (-1067.782) -- 0:00:49
182000 -- (-1068.334) (-1070.148) [-1067.566] (-1068.979) * [-1067.373] (-1069.146) (-1069.998) (-1071.371) -- 0:00:49
182500 -- (-1067.728) [-1068.462] (-1066.528) (-1071.040) * (-1077.044) [-1069.552] (-1067.466) (-1068.279) -- 0:00:49
183000 -- (-1068.097) [-1069.789] (-1069.394) (-1069.063) * (-1074.768) (-1069.834) [-1068.036] (-1066.898) -- 0:00:49
183500 -- [-1067.342] (-1069.439) (-1071.432) (-1070.805) * (-1067.785) (-1069.565) (-1067.864) [-1067.507] -- 0:00:48
184000 -- (-1067.019) [-1069.586] (-1067.353) (-1072.732) * (-1067.848) [-1067.298] (-1068.326) (-1067.507) -- 0:00:48
184500 -- (-1071.570) (-1068.258) [-1069.350] (-1066.751) * (-1067.890) (-1066.832) (-1069.844) [-1068.067] -- 0:00:48
185000 -- (-1068.916) (-1068.670) (-1070.138) [-1066.750] * (-1067.006) [-1071.238] (-1067.448) (-1069.803) -- 0:00:48
Average standard deviation of split frequencies: 0.019913
185500 -- (-1071.087) [-1068.547] (-1067.676) (-1072.019) * (-1069.413) [-1068.897] (-1067.666) (-1069.557) -- 0:00:48
186000 -- (-1069.689) (-1071.367) [-1066.260] (-1068.514) * [-1067.725] (-1069.659) (-1067.832) (-1068.404) -- 0:00:48
186500 -- (-1068.447) (-1068.458) [-1066.333] (-1066.578) * (-1068.316) (-1067.468) [-1069.808] (-1069.467) -- 0:00:47
187000 -- [-1068.732] (-1066.518) (-1074.189) (-1066.906) * (-1068.838) [-1068.093] (-1071.134) (-1068.155) -- 0:00:47
187500 -- (-1068.519) (-1067.408) (-1070.770) [-1068.208] * (-1067.679) [-1068.460] (-1068.147) (-1068.146) -- 0:00:47
188000 -- [-1067.679] (-1066.471) (-1069.555) (-1068.971) * (-1067.243) (-1073.022) (-1074.054) [-1068.243] -- 0:00:47
188500 -- (-1070.435) [-1066.476] (-1069.399) (-1068.874) * [-1069.068] (-1067.022) (-1069.456) (-1068.280) -- 0:00:47
189000 -- (-1066.378) (-1066.577) (-1066.474) [-1066.155] * (-1069.736) (-1067.100) [-1068.829] (-1068.416) -- 0:00:47
189500 -- (-1067.123) (-1067.668) (-1068.274) [-1066.635] * (-1070.769) [-1066.225] (-1072.075) (-1072.790) -- 0:00:47
190000 -- [-1067.142] (-1066.404) (-1068.473) (-1067.708) * (-1072.286) (-1066.503) [-1069.044] (-1070.583) -- 0:00:46
Average standard deviation of split frequencies: 0.019779
190500 -- (-1067.436) (-1067.643) (-1072.773) [-1066.538] * (-1067.429) (-1066.235) [-1068.123] (-1068.319) -- 0:00:46
191000 -- (-1069.204) (-1067.900) (-1071.418) [-1068.936] * [-1066.790] (-1068.368) (-1070.087) (-1067.981) -- 0:00:50
191500 -- (-1071.973) (-1069.502) [-1069.252] (-1068.335) * (-1067.665) (-1068.035) (-1070.250) [-1066.431] -- 0:00:50
192000 -- [-1068.598] (-1070.610) (-1067.505) (-1067.100) * (-1066.853) (-1069.417) [-1068.390] (-1070.026) -- 0:00:50
192500 -- (-1068.628) (-1069.638) [-1070.395] (-1068.449) * (-1066.097) [-1067.605] (-1068.724) (-1069.552) -- 0:00:50
193000 -- [-1070.513] (-1069.498) (-1067.571) (-1069.332) * (-1066.186) (-1067.613) [-1067.299] (-1069.359) -- 0:00:50
193500 -- (-1066.899) [-1068.296] (-1066.945) (-1067.057) * (-1067.741) (-1068.052) [-1067.429] (-1067.601) -- 0:00:50
194000 -- [-1068.569] (-1067.400) (-1069.767) (-1067.682) * (-1067.204) [-1068.519] (-1069.225) (-1070.912) -- 0:00:49
194500 -- (-1068.181) (-1067.037) (-1070.308) [-1072.234] * (-1071.529) [-1067.182] (-1066.980) (-1068.575) -- 0:00:49
195000 -- (-1066.949) [-1067.597] (-1067.153) (-1067.014) * (-1070.805) (-1067.793) (-1066.887) [-1067.735] -- 0:00:49
Average standard deviation of split frequencies: 0.018988
195500 -- [-1069.785] (-1067.726) (-1068.858) (-1067.469) * (-1066.494) [-1072.218] (-1067.476) (-1067.501) -- 0:00:49
196000 -- [-1070.142] (-1071.319) (-1070.140) (-1068.568) * (-1066.127) [-1071.447] (-1066.338) (-1068.761) -- 0:00:49
196500 -- (-1070.519) (-1067.683) (-1069.485) [-1067.273] * [-1066.982] (-1069.102) (-1068.334) (-1068.872) -- 0:00:49
197000 -- (-1067.270) [-1067.587] (-1067.430) (-1069.275) * (-1070.627) (-1071.290) (-1068.280) [-1068.268] -- 0:00:48
197500 -- [-1066.948] (-1067.823) (-1067.864) (-1067.539) * (-1066.877) (-1069.335) (-1068.061) [-1071.823] -- 0:00:48
198000 -- (-1066.321) (-1067.887) [-1066.944] (-1069.612) * (-1068.161) [-1068.224] (-1068.271) (-1070.119) -- 0:00:48
198500 -- (-1066.370) (-1068.157) [-1066.901] (-1066.845) * [-1068.402] (-1068.765) (-1070.042) (-1069.364) -- 0:00:48
199000 -- (-1066.233) [-1071.525] (-1067.193) (-1066.442) * (-1070.577) [-1067.773] (-1071.178) (-1067.735) -- 0:00:48
199500 -- (-1067.893) (-1069.306) (-1067.547) [-1066.373] * [-1069.885] (-1067.579) (-1069.169) (-1066.645) -- 0:00:48
200000 -- (-1071.558) (-1066.248) [-1067.757] (-1067.470) * (-1069.066) (-1066.136) [-1067.303] (-1067.555) -- 0:00:48
Average standard deviation of split frequencies: 0.018917
200500 -- (-1073.531) [-1066.249] (-1068.822) (-1069.761) * (-1067.223) [-1067.427] (-1066.382) (-1068.430) -- 0:00:47
201000 -- (-1068.226) [-1066.888] (-1068.697) (-1067.801) * (-1071.984) (-1067.387) (-1066.579) [-1069.267] -- 0:00:47
201500 -- [-1066.452] (-1068.619) (-1069.816) (-1067.120) * (-1068.117) [-1066.602] (-1066.704) (-1069.330) -- 0:00:47
202000 -- [-1067.036] (-1068.860) (-1069.544) (-1070.148) * (-1071.872) (-1066.817) (-1070.537) [-1066.985] -- 0:00:47
202500 -- (-1066.249) (-1071.304) (-1070.018) [-1071.015] * (-1066.869) (-1069.916) [-1066.750] (-1070.105) -- 0:00:47
203000 -- (-1066.823) [-1067.643] (-1071.031) (-1066.335) * (-1067.170) (-1074.246) (-1071.127) [-1069.256] -- 0:00:47
203500 -- (-1068.310) [-1069.821] (-1074.689) (-1066.335) * (-1072.286) (-1067.960) [-1068.716] (-1071.892) -- 0:00:46
204000 -- (-1070.345) (-1070.179) (-1069.653) [-1069.277] * [-1072.403] (-1067.571) (-1067.721) (-1070.842) -- 0:00:46
204500 -- [-1068.129] (-1069.754) (-1067.092) (-1070.318) * (-1071.229) (-1066.578) [-1068.477] (-1067.256) -- 0:00:46
205000 -- [-1068.654] (-1071.595) (-1067.253) (-1069.816) * [-1070.166] (-1066.891) (-1069.826) (-1066.731) -- 0:00:46
Average standard deviation of split frequencies: 0.016019
205500 -- (-1069.552) (-1071.940) [-1067.736] (-1068.261) * [-1070.588] (-1067.673) (-1068.077) (-1066.430) -- 0:00:46
206000 -- (-1068.350) [-1070.668] (-1067.867) (-1069.047) * [-1070.825] (-1066.559) (-1068.816) (-1068.337) -- 0:00:46
206500 -- [-1067.595] (-1072.868) (-1068.026) (-1066.689) * (-1067.097) (-1066.774) (-1068.203) [-1067.197] -- 0:00:46
207000 -- [-1068.114] (-1070.321) (-1071.580) (-1066.447) * (-1069.542) [-1068.005] (-1067.434) (-1068.347) -- 0:00:45
207500 -- (-1068.969) (-1070.103) [-1071.607] (-1068.692) * (-1069.067) (-1068.131) (-1067.764) [-1071.205] -- 0:00:49
208000 -- (-1068.437) (-1069.999) (-1072.332) [-1068.901] * (-1066.901) (-1069.181) (-1068.112) [-1069.877] -- 0:00:49
208500 -- [-1067.400] (-1066.045) (-1070.071) (-1069.572) * (-1066.765) (-1069.176) [-1068.553] (-1069.782) -- 0:00:49
209000 -- [-1071.097] (-1067.082) (-1067.210) (-1066.669) * (-1067.804) (-1069.147) (-1075.600) [-1067.522] -- 0:00:49
209500 -- (-1074.393) (-1067.496) [-1067.551] (-1068.728) * (-1077.299) (-1069.729) (-1074.548) [-1066.034] -- 0:00:49
210000 -- [-1070.654] (-1069.209) (-1066.324) (-1067.903) * (-1068.558) (-1069.969) (-1070.375) [-1067.361] -- 0:00:48
Average standard deviation of split frequencies: 0.017901
210500 -- (-1071.868) (-1066.871) [-1066.423] (-1066.653) * (-1069.476) (-1066.372) (-1066.888) [-1067.628] -- 0:00:48
211000 -- (-1073.027) [-1067.088] (-1066.397) (-1069.875) * (-1068.713) (-1069.174) (-1066.295) [-1066.159] -- 0:00:48
211500 -- (-1072.586) (-1068.547) (-1067.449) [-1066.336] * (-1068.383) (-1068.484) (-1066.660) [-1066.621] -- 0:00:48
212000 -- [-1072.293] (-1068.560) (-1068.551) (-1068.064) * (-1069.376) (-1066.280) [-1067.929] (-1068.963) -- 0:00:48
212500 -- (-1074.417) (-1068.534) [-1073.762] (-1068.884) * [-1068.877] (-1069.013) (-1069.241) (-1067.006) -- 0:00:48
213000 -- (-1068.630) [-1068.384] (-1067.043) (-1070.340) * [-1067.569] (-1070.179) (-1069.664) (-1068.323) -- 0:00:48
213500 -- (-1067.386) (-1070.395) (-1069.411) [-1068.983] * (-1067.982) (-1068.781) [-1067.625] (-1069.161) -- 0:00:47
214000 -- (-1067.562) (-1069.731) [-1067.732] (-1067.370) * (-1076.661) (-1069.393) [-1067.530] (-1066.292) -- 0:00:47
214500 -- (-1071.508) (-1070.152) [-1066.911] (-1068.102) * (-1075.852) (-1066.883) (-1072.437) [-1069.172] -- 0:00:47
215000 -- (-1072.036) [-1068.470] (-1069.798) (-1067.070) * (-1071.851) (-1066.053) (-1071.013) [-1071.232] -- 0:00:47
Average standard deviation of split frequencies: 0.016853
215500 -- (-1073.619) (-1071.308) (-1067.224) [-1067.070] * (-1069.113) (-1068.269) [-1066.671] (-1068.513) -- 0:00:47
216000 -- (-1070.528) (-1071.317) [-1066.973] (-1067.888) * (-1067.182) (-1067.108) (-1069.407) [-1069.270] -- 0:00:47
216500 -- [-1068.166] (-1070.431) (-1067.199) (-1070.479) * (-1066.858) (-1066.698) (-1069.759) [-1066.945] -- 0:00:47
217000 -- (-1068.691) [-1068.645] (-1067.207) (-1071.773) * [-1069.858] (-1066.293) (-1069.017) (-1067.681) -- 0:00:46
217500 -- (-1067.822) [-1068.363] (-1067.441) (-1070.607) * (-1071.998) [-1067.437] (-1067.849) (-1070.463) -- 0:00:46
218000 -- (-1067.733) [-1066.496] (-1067.254) (-1068.366) * (-1072.022) [-1067.871] (-1068.198) (-1068.892) -- 0:00:46
218500 -- [-1068.990] (-1066.519) (-1068.092) (-1071.258) * (-1071.102) (-1068.287) (-1067.368) [-1069.217] -- 0:00:46
219000 -- [-1070.819] (-1071.083) (-1071.224) (-1067.476) * (-1069.725) (-1068.523) (-1069.750) [-1067.858] -- 0:00:46
219500 -- [-1070.224] (-1070.063) (-1075.024) (-1067.653) * (-1068.648) [-1069.463] (-1069.591) (-1067.270) -- 0:00:46
220000 -- (-1068.240) [-1070.237] (-1074.595) (-1072.289) * (-1068.685) (-1069.011) [-1068.440] (-1070.863) -- 0:00:46
Average standard deviation of split frequencies: 0.014828
220500 -- (-1068.743) (-1068.754) (-1069.400) [-1067.176] * (-1070.808) [-1067.063] (-1069.681) (-1069.152) -- 0:00:45
221000 -- [-1068.726] (-1067.836) (-1069.876) (-1069.112) * (-1069.239) (-1068.097) [-1068.853] (-1070.141) -- 0:00:45
221500 -- (-1068.368) (-1071.946) [-1066.057] (-1068.012) * (-1071.901) (-1073.202) (-1068.133) [-1068.829] -- 0:00:45
222000 -- (-1069.355) [-1067.934] (-1066.179) (-1066.406) * (-1069.230) [-1067.864] (-1068.181) (-1069.364) -- 0:00:45
222500 -- (-1069.229) (-1071.095) [-1067.652] (-1066.333) * (-1072.720) [-1066.313] (-1067.558) (-1068.224) -- 0:00:45
223000 -- (-1072.855) [-1068.426] (-1068.645) (-1068.103) * (-1076.426) (-1071.773) [-1069.695] (-1068.133) -- 0:00:45
223500 -- (-1070.167) (-1069.941) [-1067.971] (-1076.676) * (-1072.276) (-1068.879) (-1069.525) [-1069.036] -- 0:00:48
224000 -- [-1070.065] (-1067.431) (-1066.591) (-1071.258) * (-1068.250) (-1070.685) [-1068.270] (-1068.357) -- 0:00:48
224500 -- (-1067.884) (-1072.607) [-1070.196] (-1069.395) * (-1075.485) (-1066.904) [-1069.564] (-1070.660) -- 0:00:48
225000 -- (-1069.026) (-1071.786) (-1070.740) [-1068.163] * (-1067.810) [-1066.811] (-1068.250) (-1067.449) -- 0:00:48
Average standard deviation of split frequencies: 0.013497
225500 -- (-1067.601) (-1072.733) [-1067.774] (-1069.316) * (-1069.914) [-1067.221] (-1067.601) (-1068.219) -- 0:00:48
226000 -- (-1071.060) (-1073.909) [-1067.752] (-1068.267) * (-1071.205) (-1066.869) [-1066.671] (-1069.722) -- 0:00:47
226500 -- [-1067.980] (-1074.509) (-1073.015) (-1068.840) * (-1070.706) [-1067.847] (-1071.299) (-1067.504) -- 0:00:47
227000 -- (-1066.771) (-1070.119) [-1069.301] (-1067.660) * (-1067.010) (-1068.102) (-1066.445) [-1066.832] -- 0:00:47
227500 -- [-1071.627] (-1071.982) (-1071.571) (-1067.589) * (-1068.095) (-1068.148) (-1068.149) [-1067.402] -- 0:00:47
228000 -- [-1067.822] (-1068.220) (-1067.997) (-1067.737) * (-1068.121) [-1066.436] (-1068.643) (-1066.565) -- 0:00:47
228500 -- (-1068.247) (-1067.754) [-1067.471] (-1067.122) * (-1067.117) (-1066.353) [-1066.643] (-1066.716) -- 0:00:47
229000 -- [-1066.890] (-1067.916) (-1071.397) (-1068.497) * (-1067.039) [-1067.065] (-1066.815) (-1071.729) -- 0:00:47
229500 -- (-1068.815) [-1068.383] (-1072.467) (-1070.729) * [-1068.316] (-1069.429) (-1067.032) (-1067.672) -- 0:00:47
230000 -- [-1069.491] (-1069.027) (-1067.057) (-1070.320) * (-1068.775) [-1066.629] (-1067.684) (-1068.508) -- 0:00:46
Average standard deviation of split frequencies: 0.011180
230500 -- (-1066.465) [-1067.361] (-1067.368) (-1068.868) * (-1069.552) (-1067.040) [-1068.313] (-1068.974) -- 0:00:46
231000 -- [-1067.089] (-1068.506) (-1067.368) (-1070.334) * (-1068.277) (-1071.269) [-1067.489] (-1068.264) -- 0:00:46
231500 -- (-1067.463) [-1071.233] (-1067.468) (-1069.523) * (-1068.277) [-1073.125] (-1067.478) (-1068.718) -- 0:00:46
232000 -- (-1067.662) [-1066.476] (-1070.528) (-1066.997) * (-1066.496) (-1069.521) (-1066.951) [-1066.826] -- 0:00:46
232500 -- (-1067.041) [-1067.500] (-1068.670) (-1070.179) * (-1068.137) (-1069.328) [-1070.604] (-1067.417) -- 0:00:46
233000 -- (-1069.677) (-1067.132) [-1068.658] (-1072.776) * [-1068.032] (-1069.980) (-1075.742) (-1069.035) -- 0:00:46
233500 -- (-1070.121) (-1068.365) [-1068.128] (-1066.593) * (-1066.669) (-1068.642) (-1070.706) [-1074.960] -- 0:00:45
234000 -- (-1069.887) (-1067.816) (-1068.176) [-1066.647] * (-1072.681) (-1067.840) [-1068.877] (-1078.417) -- 0:00:45
234500 -- [-1067.290] (-1068.500) (-1068.930) (-1071.121) * (-1069.513) [-1066.793] (-1066.817) (-1069.320) -- 0:00:45
235000 -- (-1069.779) [-1069.908] (-1067.102) (-1076.734) * (-1067.291) [-1067.291] (-1070.513) (-1071.284) -- 0:00:45
Average standard deviation of split frequencies: 0.010986
235500 -- (-1067.460) [-1068.746] (-1067.684) (-1070.769) * (-1069.453) [-1068.579] (-1067.895) (-1067.682) -- 0:00:45
236000 -- (-1068.409) [-1067.340] (-1068.425) (-1066.802) * (-1067.208) [-1068.477] (-1067.867) (-1066.438) -- 0:00:45
236500 -- (-1071.980) (-1070.550) [-1069.387] (-1067.818) * (-1068.503) (-1066.292) (-1068.622) [-1066.873] -- 0:00:45
237000 -- (-1068.680) (-1067.064) (-1067.660) [-1067.336] * [-1071.149] (-1066.104) (-1066.906) (-1067.440) -- 0:00:45
237500 -- (-1067.954) [-1067.032] (-1066.485) (-1067.706) * (-1067.906) (-1069.138) [-1066.845] (-1070.602) -- 0:00:44
238000 -- (-1068.276) (-1066.829) [-1067.367] (-1069.763) * [-1071.113] (-1067.909) (-1066.819) (-1068.090) -- 0:00:44
238500 -- (-1066.811) [-1067.210] (-1066.959) (-1068.448) * (-1071.270) (-1068.444) (-1067.271) [-1068.693] -- 0:00:44
239000 -- (-1068.945) (-1068.403) [-1066.803] (-1070.410) * (-1067.483) (-1068.187) [-1067.031] (-1069.479) -- 0:00:44
239500 -- (-1072.984) (-1067.205) [-1067.152] (-1067.668) * (-1068.066) [-1069.868] (-1071.187) (-1068.250) -- 0:00:47
240000 -- (-1073.950) (-1067.650) [-1067.064] (-1067.202) * (-1070.263) (-1069.154) [-1070.733] (-1067.960) -- 0:00:47
Average standard deviation of split frequencies: 0.011630
240500 -- (-1071.599) (-1066.476) (-1066.929) [-1068.828] * (-1067.264) [-1067.941] (-1074.646) (-1066.874) -- 0:00:47
241000 -- (-1069.246) (-1068.294) [-1069.123] (-1068.580) * [-1067.680] (-1067.801) (-1068.508) (-1068.981) -- 0:00:47
241500 -- (-1067.388) (-1069.574) [-1069.359] (-1068.049) * (-1069.094) (-1067.862) [-1067.012] (-1069.262) -- 0:00:47
242000 -- (-1072.755) (-1071.416) [-1070.006] (-1070.273) * (-1069.069) [-1070.640] (-1067.244) (-1069.695) -- 0:00:46
242500 -- [-1068.556] (-1068.277) (-1067.597) (-1069.157) * [-1069.643] (-1067.003) (-1069.510) (-1069.985) -- 0:00:46
243000 -- (-1071.886) (-1066.887) (-1069.993) [-1068.105] * [-1072.108] (-1068.152) (-1068.525) (-1070.261) -- 0:00:46
243500 -- (-1068.752) (-1067.504) (-1067.809) [-1067.698] * (-1071.627) (-1066.873) (-1067.055) [-1076.423] -- 0:00:46
244000 -- (-1071.518) [-1066.454] (-1068.220) (-1068.691) * (-1070.628) (-1066.680) (-1066.945) [-1068.798] -- 0:00:46
244500 -- (-1071.575) [-1068.213] (-1066.987) (-1068.213) * (-1067.713) [-1066.760] (-1070.737) (-1068.916) -- 0:00:46
245000 -- (-1067.886) (-1069.412) [-1067.210] (-1068.705) * (-1068.804) (-1066.886) (-1067.571) [-1068.356] -- 0:00:46
Average standard deviation of split frequencies: 0.011977
245500 -- [-1068.220] (-1068.751) (-1066.474) (-1068.008) * (-1067.805) (-1067.508) [-1066.622] (-1067.738) -- 0:00:46
246000 -- (-1067.209) (-1068.138) [-1066.554] (-1066.985) * (-1067.893) [-1067.525] (-1067.911) (-1067.868) -- 0:00:45
246500 -- (-1066.753) (-1068.312) (-1067.059) [-1069.580] * [-1068.011] (-1067.537) (-1070.622) (-1067.335) -- 0:00:45
247000 -- (-1068.082) (-1068.002) (-1072.339) [-1068.254] * (-1069.103) (-1066.651) (-1068.943) [-1070.405] -- 0:00:45
247500 -- (-1066.686) (-1068.136) [-1066.904] (-1069.585) * [-1067.567] (-1067.627) (-1068.407) (-1073.639) -- 0:00:45
248000 -- (-1069.781) (-1068.067) [-1066.876] (-1069.722) * (-1067.273) [-1069.039] (-1066.393) (-1071.338) -- 0:00:45
248500 -- (-1070.631) (-1070.551) [-1069.295] (-1068.528) * (-1067.293) (-1067.546) (-1066.219) [-1071.162] -- 0:00:45
249000 -- (-1068.627) (-1067.003) (-1068.679) [-1068.615] * [-1066.106] (-1066.982) (-1067.018) (-1067.383) -- 0:00:45
249500 -- (-1066.826) [-1067.226] (-1071.863) (-1068.745) * (-1066.105) (-1069.346) [-1067.990] (-1067.383) -- 0:00:45
250000 -- [-1066.890] (-1067.408) (-1070.362) (-1068.089) * (-1067.356) (-1067.496) (-1068.306) [-1067.284] -- 0:00:45
Average standard deviation of split frequencies: 0.011173
250500 -- [-1067.993] (-1066.613) (-1067.102) (-1069.024) * [-1071.443] (-1067.930) (-1067.802) (-1071.536) -- 0:00:44
251000 -- (-1072.335) [-1066.307] (-1067.288) (-1071.754) * (-1070.092) (-1067.633) [-1068.336] (-1072.122) -- 0:00:44
251500 -- (-1070.486) (-1066.230) (-1069.159) [-1067.130] * (-1069.606) [-1066.708] (-1068.737) (-1074.911) -- 0:00:44
252000 -- [-1070.134] (-1067.630) (-1068.304) (-1067.250) * (-1069.958) (-1067.888) [-1070.428] (-1070.253) -- 0:00:44
252500 -- [-1069.226] (-1071.487) (-1068.625) (-1068.637) * (-1069.725) (-1071.308) (-1070.625) [-1066.245] -- 0:00:44
253000 -- (-1067.730) [-1066.985] (-1069.547) (-1068.200) * [-1067.654] (-1068.953) (-1068.169) (-1068.299) -- 0:00:44
253500 -- (-1068.075) (-1073.856) (-1070.986) [-1066.433] * [-1068.986] (-1067.656) (-1069.724) (-1070.211) -- 0:00:44
254000 -- (-1069.141) (-1068.726) [-1067.788] (-1067.785) * (-1069.152) (-1067.101) [-1067.229] (-1067.450) -- 0:00:44
254500 -- (-1069.451) (-1068.595) [-1068.890] (-1067.677) * (-1066.938) [-1067.300] (-1068.522) (-1067.118) -- 0:00:43
255000 -- (-1069.787) [-1067.895] (-1069.195) (-1068.920) * (-1068.391) (-1067.961) (-1067.486) [-1067.006] -- 0:00:43
Average standard deviation of split frequencies: 0.010615
255500 -- (-1069.715) (-1068.346) (-1067.365) [-1068.428] * (-1068.203) (-1066.858) [-1066.401] (-1073.517) -- 0:00:46
256000 -- (-1067.096) [-1067.738] (-1068.107) (-1069.853) * (-1069.414) [-1068.245] (-1068.119) (-1069.530) -- 0:00:46
256500 -- [-1067.897] (-1067.285) (-1068.129) (-1066.609) * [-1070.415] (-1070.180) (-1069.760) (-1069.187) -- 0:00:46
257000 -- (-1069.457) (-1067.628) [-1067.466] (-1066.832) * (-1068.145) [-1067.508] (-1067.100) (-1071.001) -- 0:00:46
257500 -- (-1068.117) (-1068.954) (-1066.318) [-1067.948] * (-1067.219) (-1069.607) (-1068.110) [-1070.542] -- 0:00:46
258000 -- (-1067.744) [-1068.250] (-1067.229) (-1067.017) * (-1069.297) (-1070.047) [-1067.991] (-1071.271) -- 0:00:46
258500 -- (-1067.661) [-1069.590] (-1069.156) (-1067.897) * (-1068.176) [-1066.498] (-1074.819) (-1071.656) -- 0:00:45
259000 -- (-1067.107) (-1070.067) [-1068.591] (-1070.901) * (-1066.808) [-1070.342] (-1071.016) (-1070.964) -- 0:00:45
259500 -- (-1066.428) [-1070.109] (-1069.673) (-1069.873) * (-1068.600) [-1070.010] (-1068.180) (-1068.756) -- 0:00:45
260000 -- (-1070.210) [-1072.947] (-1068.671) (-1067.795) * [-1067.658] (-1070.709) (-1069.870) (-1068.429) -- 0:00:45
Average standard deviation of split frequencies: 0.010449
260500 -- (-1073.112) [-1071.014] (-1069.163) (-1068.747) * (-1067.153) [-1070.363] (-1071.175) (-1069.696) -- 0:00:45
261000 -- (-1067.622) (-1067.843) (-1071.491) [-1067.528] * (-1067.156) (-1069.026) [-1066.410] (-1066.072) -- 0:00:45
261500 -- (-1068.340) (-1067.931) [-1067.669] (-1067.725) * (-1067.636) (-1066.975) [-1071.222] (-1066.822) -- 0:00:45
262000 -- (-1069.909) (-1075.997) (-1067.491) [-1067.247] * (-1066.441) [-1066.677] (-1069.858) (-1066.722) -- 0:00:45
262500 -- [-1069.484] (-1069.493) (-1067.696) (-1069.993) * (-1067.009) [-1070.406] (-1071.161) (-1069.939) -- 0:00:44
263000 -- [-1067.273] (-1066.458) (-1068.356) (-1069.000) * (-1069.035) (-1071.202) (-1067.891) [-1069.917] -- 0:00:44
263500 -- (-1066.313) (-1066.545) [-1067.206] (-1067.240) * (-1070.352) [-1067.296] (-1069.316) (-1068.637) -- 0:00:44
264000 -- (-1069.711) (-1068.453) [-1069.317] (-1067.743) * (-1066.887) (-1067.049) (-1070.712) [-1068.193] -- 0:00:44
264500 -- (-1069.862) (-1066.821) (-1075.253) [-1067.773] * (-1070.890) (-1068.353) [-1067.648] (-1069.599) -- 0:00:44
265000 -- (-1067.930) [-1067.024] (-1069.095) (-1067.979) * (-1069.965) (-1067.478) (-1068.104) [-1070.312] -- 0:00:44
Average standard deviation of split frequencies: 0.009887
265500 -- (-1070.881) [-1067.946] (-1068.636) (-1073.447) * (-1067.700) (-1071.392) (-1066.934) [-1068.931] -- 0:00:44
266000 -- (-1073.015) (-1070.250) [-1067.853] (-1072.545) * (-1067.566) [-1069.888] (-1070.461) (-1067.147) -- 0:00:44
266500 -- (-1071.198) [-1069.246] (-1068.769) (-1071.303) * (-1068.674) (-1070.703) [-1069.865] (-1067.724) -- 0:00:44
267000 -- [-1067.468] (-1067.683) (-1067.574) (-1068.488) * [-1067.546] (-1069.809) (-1069.760) (-1069.095) -- 0:00:43
267500 -- (-1069.661) (-1070.234) [-1070.599] (-1066.239) * (-1068.551) (-1070.447) [-1067.361] (-1068.399) -- 0:00:43
268000 -- (-1069.221) [-1067.855] (-1068.352) (-1069.779) * (-1069.597) [-1070.764] (-1070.175) (-1073.463) -- 0:00:43
268500 -- [-1068.910] (-1069.533) (-1067.231) (-1069.768) * (-1067.450) [-1070.284] (-1067.781) (-1073.196) -- 0:00:43
269000 -- (-1072.325) (-1067.603) (-1068.327) [-1068.115] * (-1071.301) (-1067.773) (-1070.708) [-1069.101] -- 0:00:43
269500 -- (-1066.605) (-1067.342) [-1067.825] (-1069.081) * (-1071.842) (-1067.868) (-1066.249) [-1067.816] -- 0:00:43
270000 -- (-1067.740) (-1068.253) [-1069.847] (-1069.091) * (-1071.163) (-1069.719) [-1069.518] (-1068.238) -- 0:00:43
Average standard deviation of split frequencies: 0.009192
270500 -- (-1068.651) (-1069.549) (-1069.731) [-1067.015] * (-1069.517) (-1068.638) (-1068.366) [-1065.965] -- 0:00:43
271000 -- [-1068.542] (-1067.972) (-1069.687) (-1067.000) * (-1067.661) (-1069.828) (-1068.564) [-1067.302] -- 0:00:45
271500 -- (-1069.744) (-1068.931) [-1068.376] (-1068.409) * (-1067.890) (-1071.233) (-1067.836) [-1068.309] -- 0:00:45
272000 -- (-1067.592) (-1069.091) (-1067.441) [-1068.709] * (-1068.741) (-1067.679) [-1069.299] (-1071.126) -- 0:00:45
272500 -- (-1070.441) (-1068.405) (-1068.153) [-1066.459] * (-1069.112) (-1067.108) (-1068.107) [-1069.461] -- 0:00:45
273000 -- (-1069.028) [-1066.790] (-1068.272) (-1072.209) * (-1068.948) [-1069.349] (-1066.967) (-1068.717) -- 0:00:45
273500 -- (-1072.223) (-1068.139) [-1069.236] (-1072.818) * (-1066.728) (-1069.855) [-1067.109] (-1073.263) -- 0:00:45
274000 -- [-1068.336] (-1068.020) (-1072.121) (-1066.290) * (-1071.882) (-1071.028) [-1067.746] (-1071.102) -- 0:00:45
274500 -- (-1066.474) (-1068.474) [-1072.956] (-1066.961) * [-1071.809] (-1071.478) (-1071.384) (-1067.592) -- 0:00:44
275000 -- (-1066.800) (-1068.360) (-1068.578) [-1068.672] * [-1072.840] (-1073.072) (-1069.431) (-1067.501) -- 0:00:44
Average standard deviation of split frequencies: 0.008433
275500 -- (-1068.716) (-1069.523) (-1068.589) [-1066.934] * [-1068.644] (-1069.436) (-1067.700) (-1066.287) -- 0:00:44
276000 -- [-1067.242] (-1068.863) (-1066.506) (-1070.284) * (-1067.987) (-1069.360) [-1068.488] (-1066.740) -- 0:00:44
276500 -- (-1068.644) (-1069.320) (-1066.315) [-1069.144] * (-1068.762) (-1071.127) [-1069.170] (-1067.410) -- 0:00:44
277000 -- (-1067.359) (-1068.638) [-1069.079] (-1072.801) * (-1066.571) (-1074.006) [-1077.424] (-1067.006) -- 0:00:44
277500 -- (-1067.485) (-1071.306) [-1071.149] (-1067.097) * (-1069.270) [-1066.970] (-1071.882) (-1070.484) -- 0:00:44
278000 -- (-1067.699) (-1069.071) (-1073.005) [-1066.703] * (-1068.192) (-1068.007) (-1071.777) [-1068.566] -- 0:00:44
278500 -- (-1069.276) (-1071.099) [-1069.615] (-1067.709) * (-1067.207) (-1069.341) (-1067.765) [-1067.976] -- 0:00:44
279000 -- (-1069.000) (-1070.482) [-1066.778] (-1066.483) * (-1066.962) (-1069.204) [-1067.449] (-1068.157) -- 0:00:43
279500 -- (-1068.712) (-1066.944) [-1067.813] (-1076.496) * (-1067.352) (-1067.665) [-1070.049] (-1067.603) -- 0:00:43
280000 -- (-1069.060) (-1070.380) (-1068.455) [-1067.567] * (-1071.507) (-1067.992) (-1067.142) [-1066.952] -- 0:00:43
Average standard deviation of split frequencies: 0.009238
280500 -- (-1067.671) (-1070.372) [-1068.695] (-1070.826) * (-1068.681) (-1069.230) (-1067.192) [-1068.832] -- 0:00:43
281000 -- [-1067.934] (-1067.675) (-1067.649) (-1066.888) * [-1066.891] (-1066.910) (-1068.076) (-1066.808) -- 0:00:43
281500 -- (-1068.670) (-1074.897) [-1067.477] (-1068.735) * [-1067.680] (-1067.801) (-1066.302) (-1066.815) -- 0:00:43
282000 -- [-1066.582] (-1066.395) (-1067.301) (-1069.361) * (-1067.378) [-1067.294] (-1066.537) (-1068.170) -- 0:00:43
282500 -- [-1066.833] (-1066.994) (-1067.359) (-1068.941) * (-1070.636) [-1068.285] (-1069.781) (-1067.643) -- 0:00:43
283000 -- (-1067.689) [-1067.781] (-1068.986) (-1069.034) * [-1070.083] (-1067.708) (-1070.212) (-1066.827) -- 0:00:43
283500 -- (-1066.535) (-1070.494) (-1068.231) [-1067.686] * [-1071.439] (-1066.761) (-1071.263) (-1067.455) -- 0:00:42
284000 -- (-1066.865) [-1069.528] (-1072.380) (-1066.555) * (-1069.551) (-1067.448) (-1068.280) [-1068.289] -- 0:00:42
284500 -- [-1069.995] (-1071.174) (-1069.726) (-1067.786) * (-1067.765) (-1068.837) [-1068.315] (-1070.730) -- 0:00:42
285000 -- (-1067.905) (-1070.201) (-1069.092) [-1067.292] * [-1070.757] (-1067.404) (-1065.939) (-1069.261) -- 0:00:42
Average standard deviation of split frequencies: 0.009168
285500 -- (-1069.305) [-1068.046] (-1067.588) (-1069.081) * (-1071.100) (-1074.182) [-1066.172] (-1070.081) -- 0:00:42
286000 -- (-1070.178) (-1067.081) (-1068.703) [-1067.161] * [-1070.071] (-1071.272) (-1069.082) (-1069.798) -- 0:00:42
286500 -- (-1068.069) (-1067.504) [-1069.896] (-1067.733) * [-1068.268] (-1070.008) (-1068.201) (-1071.130) -- 0:00:42
287000 -- (-1071.044) (-1069.115) (-1074.667) [-1068.829] * (-1069.617) [-1069.196] (-1067.106) (-1067.134) -- 0:00:42
287500 -- [-1068.717] (-1070.541) (-1070.968) (-1069.042) * (-1068.693) (-1070.925) (-1070.795) [-1067.221] -- 0:00:44
288000 -- (-1067.396) (-1070.574) [-1067.140] (-1069.083) * (-1068.958) (-1069.336) (-1068.911) [-1068.434] -- 0:00:44
288500 -- (-1068.207) (-1068.243) (-1068.566) [-1069.857] * [-1067.237] (-1066.426) (-1068.496) (-1069.113) -- 0:00:44
289000 -- (-1067.406) [-1067.777] (-1068.169) (-1069.502) * (-1070.187) (-1066.907) [-1068.048] (-1069.920) -- 0:00:44
289500 -- (-1066.891) (-1067.198) (-1067.199) [-1068.161] * (-1071.638) (-1067.057) (-1070.250) [-1067.090] -- 0:00:44
290000 -- (-1067.872) (-1068.052) [-1067.389] (-1067.198) * (-1067.741) (-1067.826) (-1068.139) [-1067.319] -- 0:00:44
Average standard deviation of split frequencies: 0.010238
290500 -- (-1067.198) (-1066.487) [-1068.028] (-1067.754) * [-1066.877] (-1068.612) (-1067.579) (-1067.238) -- 0:00:43
291000 -- (-1070.758) [-1066.456] (-1067.284) (-1067.644) * [-1068.475] (-1067.349) (-1068.395) (-1067.265) -- 0:00:43
291500 -- (-1067.610) (-1068.936) [-1067.399] (-1068.728) * (-1067.821) (-1069.150) [-1068.147] (-1070.861) -- 0:00:43
292000 -- (-1070.495) (-1066.854) [-1069.203] (-1067.808) * (-1070.722) (-1068.955) [-1068.419] (-1069.891) -- 0:00:43
292500 -- (-1068.915) (-1067.059) (-1072.270) [-1070.370] * (-1071.165) [-1067.320] (-1071.469) (-1070.036) -- 0:00:43
293000 -- [-1066.964] (-1071.271) (-1072.500) (-1069.357) * (-1068.714) (-1070.508) [-1068.738] (-1066.898) -- 0:00:43
293500 -- (-1067.235) [-1070.315] (-1069.765) (-1068.050) * [-1068.962] (-1069.733) (-1067.859) (-1067.722) -- 0:00:43
294000 -- [-1067.233] (-1068.809) (-1068.961) (-1066.912) * (-1070.539) [-1067.903] (-1066.304) (-1067.858) -- 0:00:43
294500 -- (-1068.287) (-1069.770) (-1067.244) [-1066.881] * [-1068.515] (-1067.738) (-1068.137) (-1066.609) -- 0:00:43
295000 -- (-1069.758) (-1068.799) [-1066.802] (-1069.001) * (-1067.812) [-1067.971] (-1070.049) (-1067.288) -- 0:00:43
Average standard deviation of split frequencies: 0.011546
295500 -- [-1066.698] (-1066.809) (-1068.757) (-1068.320) * [-1067.832] (-1069.799) (-1070.579) (-1066.403) -- 0:00:42
296000 -- (-1066.770) [-1067.272] (-1067.022) (-1067.155) * (-1067.653) (-1070.359) [-1068.064] (-1068.442) -- 0:00:42
296500 -- [-1066.314] (-1066.140) (-1067.849) (-1071.598) * (-1067.827) (-1068.975) (-1068.727) [-1067.462] -- 0:00:42
297000 -- (-1068.641) [-1066.852] (-1067.600) (-1070.558) * (-1067.134) (-1066.794) [-1068.568] (-1067.220) -- 0:00:42
297500 -- (-1069.520) [-1072.866] (-1067.600) (-1074.235) * (-1071.273) [-1066.795] (-1067.850) (-1066.876) -- 0:00:42
298000 -- (-1069.015) (-1067.816) [-1067.556] (-1066.768) * (-1067.358) (-1066.779) [-1066.876] (-1068.502) -- 0:00:42
298500 -- (-1067.573) (-1067.224) (-1068.160) [-1068.968] * [-1069.516] (-1067.711) (-1067.167) (-1070.064) -- 0:00:42
299000 -- (-1066.346) (-1069.819) [-1068.968] (-1070.606) * (-1069.044) (-1067.349) [-1069.280] (-1067.259) -- 0:00:42
299500 -- (-1067.094) [-1067.964] (-1071.313) (-1068.310) * (-1072.419) (-1067.594) (-1068.928) [-1069.051] -- 0:00:42
300000 -- (-1066.355) (-1068.474) [-1067.944] (-1068.331) * (-1069.287) [-1066.275] (-1072.232) (-1067.341) -- 0:00:42
Average standard deviation of split frequencies: 0.013131
300500 -- (-1070.184) [-1068.082] (-1067.190) (-1066.359) * (-1073.209) (-1067.026) [-1068.985] (-1068.214) -- 0:00:41
301000 -- (-1071.388) (-1068.166) (-1068.718) [-1066.345] * (-1071.004) (-1068.659) [-1066.946] (-1071.121) -- 0:00:41
301500 -- (-1067.194) [-1069.272] (-1068.892) (-1068.818) * [-1066.862] (-1068.282) (-1069.040) (-1067.528) -- 0:00:41
302000 -- (-1066.851) [-1069.477] (-1070.881) (-1072.853) * (-1071.199) (-1070.246) (-1068.782) [-1068.290] -- 0:00:41
302500 -- (-1067.525) (-1066.700) [-1067.421] (-1072.940) * (-1066.881) [-1070.081] (-1069.311) (-1068.474) -- 0:00:41
303000 -- (-1067.255) (-1070.206) (-1068.415) [-1068.877] * (-1070.336) [-1068.956] (-1066.541) (-1067.630) -- 0:00:41
303500 -- (-1066.118) (-1068.010) [-1067.102] (-1069.148) * [-1074.978] (-1067.982) (-1066.936) (-1068.799) -- 0:00:43
304000 -- [-1067.467] (-1068.631) (-1067.199) (-1068.229) * (-1069.051) (-1067.836) [-1066.155] (-1068.717) -- 0:00:43
304500 -- (-1067.843) [-1069.395] (-1068.485) (-1066.763) * (-1066.415) (-1068.619) [-1069.420] (-1067.823) -- 0:00:43
305000 -- (-1067.690) [-1067.444] (-1068.798) (-1066.334) * [-1067.939] (-1068.395) (-1069.019) (-1069.988) -- 0:00:43
Average standard deviation of split frequencies: 0.012613
305500 -- (-1068.599) (-1067.303) [-1068.035] (-1069.455) * (-1070.909) (-1070.585) (-1066.470) [-1068.675] -- 0:00:43
306000 -- (-1066.467) (-1067.877) (-1066.833) [-1068.471] * (-1067.547) [-1067.688] (-1070.506) (-1068.972) -- 0:00:43
306500 -- (-1067.031) (-1070.075) [-1066.655] (-1066.676) * (-1070.537) (-1068.020) (-1067.334) [-1067.806] -- 0:00:42
307000 -- (-1067.172) (-1072.371) [-1066.700] (-1070.984) * (-1069.480) [-1068.238] (-1067.443) (-1069.343) -- 0:00:42
307500 -- [-1067.233] (-1068.502) (-1066.813) (-1067.627) * (-1067.349) [-1067.897] (-1066.869) (-1068.876) -- 0:00:42
308000 -- (-1067.932) [-1068.939] (-1066.685) (-1066.315) * [-1066.934] (-1068.819) (-1067.580) (-1071.350) -- 0:00:42
308500 -- [-1070.441] (-1069.100) (-1068.308) (-1066.225) * (-1068.967) [-1066.407] (-1071.523) (-1069.235) -- 0:00:42
309000 -- (-1067.007) [-1070.652] (-1074.716) (-1066.671) * (-1066.634) (-1066.883) (-1068.773) [-1070.979] -- 0:00:42
309500 -- [-1066.941] (-1073.559) (-1069.805) (-1066.671) * (-1065.969) [-1069.006] (-1072.241) (-1069.164) -- 0:00:42
310000 -- [-1066.951] (-1069.094) (-1069.428) (-1066.812) * (-1066.397) (-1069.200) (-1067.840) [-1067.723] -- 0:00:42
Average standard deviation of split frequencies: 0.011191
310500 -- [-1067.010] (-1067.264) (-1066.405) (-1066.266) * (-1067.433) [-1068.854] (-1071.151) (-1068.271) -- 0:00:42
311000 -- [-1068.007] (-1069.075) (-1070.631) (-1066.787) * (-1067.301) (-1067.682) (-1068.772) [-1067.014] -- 0:00:42
311500 -- (-1068.242) [-1069.028] (-1074.189) (-1066.776) * (-1066.843) (-1070.184) [-1067.452] (-1070.833) -- 0:00:41
312000 -- [-1067.488] (-1067.824) (-1069.251) (-1066.422) * (-1066.688) (-1071.406) [-1066.900] (-1067.370) -- 0:00:41
312500 -- (-1067.059) (-1066.552) (-1067.790) [-1067.237] * [-1067.761] (-1074.732) (-1068.410) (-1071.358) -- 0:00:41
313000 -- (-1068.799) [-1067.137] (-1069.728) (-1068.955) * (-1071.593) (-1069.158) (-1067.415) [-1069.097] -- 0:00:41
313500 -- (-1070.240) (-1067.067) (-1067.001) [-1066.755] * (-1074.199) [-1069.845] (-1067.267) (-1067.836) -- 0:00:41
314000 -- (-1068.699) [-1066.998] (-1066.801) (-1071.899) * [-1069.341] (-1074.920) (-1069.768) (-1066.339) -- 0:00:41
314500 -- [-1067.372] (-1068.900) (-1066.886) (-1070.309) * (-1067.818) (-1068.671) (-1073.529) [-1068.862] -- 0:00:41
315000 -- (-1066.594) (-1069.602) (-1068.589) [-1067.295] * (-1066.497) (-1068.899) [-1076.060] (-1067.421) -- 0:00:41
Average standard deviation of split frequencies: 0.011188
315500 -- [-1068.010] (-1074.070) (-1067.937) (-1069.236) * [-1066.349] (-1078.438) (-1070.193) (-1071.162) -- 0:00:41
316000 -- (-1070.629) (-1070.782) (-1067.885) [-1069.069] * (-1068.508) (-1071.941) (-1069.254) [-1068.658] -- 0:00:41
316500 -- (-1069.081) (-1073.205) (-1068.934) [-1068.300] * [-1073.112] (-1069.381) (-1073.442) (-1070.592) -- 0:00:41
317000 -- (-1067.419) (-1069.033) [-1070.784] (-1068.198) * [-1067.857] (-1070.749) (-1069.004) (-1069.385) -- 0:00:40
317500 -- [-1066.608] (-1067.702) (-1066.976) (-1068.790) * [-1069.940] (-1070.836) (-1067.459) (-1068.893) -- 0:00:40
318000 -- [-1067.423] (-1073.435) (-1072.552) (-1067.168) * (-1067.532) [-1067.821] (-1066.702) (-1068.697) -- 0:00:40
318500 -- (-1069.903) (-1069.815) (-1068.532) [-1066.733] * [-1068.302] (-1070.865) (-1069.535) (-1066.890) -- 0:00:40
319000 -- (-1066.148) (-1068.651) [-1068.433] (-1067.433) * [-1068.302] (-1069.143) (-1071.646) (-1067.937) -- 0:00:40
319500 -- (-1066.568) [-1067.783] (-1069.081) (-1068.702) * [-1068.409] (-1068.558) (-1068.947) (-1072.570) -- 0:00:40
320000 -- [-1066.951] (-1068.830) (-1067.709) (-1067.441) * (-1069.895) (-1066.548) (-1068.920) [-1067.098] -- 0:00:40
Average standard deviation of split frequencies: 0.010566
320500 -- (-1066.690) (-1068.368) (-1067.553) [-1067.424] * [-1071.079] (-1067.530) (-1067.132) (-1065.913) -- 0:00:42
321000 -- [-1069.483] (-1072.315) (-1068.394) (-1069.403) * (-1069.326) (-1066.814) [-1067.035] (-1066.047) -- 0:00:42
321500 -- (-1068.293) (-1069.899) [-1071.726] (-1068.810) * (-1067.536) (-1066.247) (-1071.024) [-1069.182] -- 0:00:42
322000 -- (-1067.047) (-1069.477) (-1067.838) [-1071.121] * (-1069.943) [-1068.532] (-1069.894) (-1069.905) -- 0:00:42
322500 -- (-1065.914) (-1068.455) [-1067.337] (-1070.749) * [-1067.899] (-1067.910) (-1067.681) (-1067.474) -- 0:00:42
323000 -- (-1066.966) [-1068.542] (-1069.988) (-1069.155) * [-1069.649] (-1072.942) (-1072.307) (-1066.246) -- 0:00:41
323500 -- [-1066.903] (-1068.374) (-1072.775) (-1069.731) * (-1070.067) (-1067.257) [-1067.331] (-1066.477) -- 0:00:41
324000 -- [-1066.902] (-1068.902) (-1068.805) (-1067.256) * (-1069.498) (-1068.107) [-1070.912] (-1068.222) -- 0:00:41
324500 -- (-1066.283) (-1068.634) (-1068.338) [-1067.143] * [-1067.077] (-1067.670) (-1069.953) (-1071.789) -- 0:00:41
325000 -- (-1066.685) (-1070.494) (-1067.993) [-1067.114] * (-1067.437) (-1068.718) [-1070.441] (-1068.748) -- 0:00:41
Average standard deviation of split frequencies: 0.010122
325500 -- (-1067.094) [-1066.646] (-1068.020) (-1068.443) * [-1066.878] (-1066.614) (-1068.093) (-1069.634) -- 0:00:41
326000 -- [-1066.471] (-1069.622) (-1070.095) (-1067.550) * [-1069.982] (-1066.782) (-1068.054) (-1068.710) -- 0:00:41
326500 -- (-1070.467) (-1066.475) [-1067.336] (-1068.973) * (-1070.496) (-1068.033) (-1067.474) [-1067.350] -- 0:00:41
327000 -- (-1072.224) (-1067.152) [-1067.793] (-1068.010) * (-1070.483) (-1066.619) [-1067.233] (-1071.243) -- 0:00:41
327500 -- (-1068.021) (-1067.894) (-1068.194) [-1066.736] * (-1066.515) [-1068.511] (-1067.542) (-1070.755) -- 0:00:41
328000 -- (-1069.551) (-1066.583) [-1067.959] (-1066.877) * (-1068.758) (-1069.592) [-1068.842] (-1068.816) -- 0:00:40
328500 -- (-1068.960) (-1069.120) (-1066.958) [-1066.832] * [-1068.197] (-1069.920) (-1065.963) (-1070.580) -- 0:00:40
329000 -- [-1068.684] (-1072.332) (-1066.482) (-1068.935) * (-1068.821) [-1070.148] (-1066.081) (-1069.048) -- 0:00:40
329500 -- (-1066.821) (-1072.679) [-1068.998] (-1067.339) * [-1073.559] (-1067.315) (-1067.728) (-1069.458) -- 0:00:40
330000 -- (-1067.538) (-1076.762) (-1068.320) [-1069.664] * [-1070.734] (-1071.339) (-1068.425) (-1069.688) -- 0:00:40
Average standard deviation of split frequencies: 0.011227
330500 -- (-1069.175) (-1074.856) (-1067.950) [-1068.482] * [-1067.606] (-1068.191) (-1067.020) (-1066.391) -- 0:00:40
331000 -- [-1066.513] (-1067.040) (-1070.963) (-1066.175) * (-1068.509) (-1070.148) (-1067.318) [-1066.437] -- 0:00:40
331500 -- (-1067.563) (-1066.015) [-1069.300] (-1072.775) * (-1067.753) (-1069.175) (-1070.795) [-1066.718] -- 0:00:40
332000 -- (-1065.999) (-1069.027) [-1066.702] (-1074.039) * (-1066.544) (-1066.599) [-1067.678] (-1068.588) -- 0:00:40
332500 -- (-1067.942) [-1068.938] (-1066.410) (-1068.378) * (-1068.784) [-1066.961] (-1069.116) (-1069.589) -- 0:00:40
333000 -- (-1067.378) (-1069.765) (-1067.706) [-1067.370] * [-1068.534] (-1068.941) (-1071.290) (-1066.482) -- 0:00:40
333500 -- [-1067.378] (-1068.208) (-1070.153) (-1068.941) * (-1069.427) (-1066.995) [-1071.059] (-1067.455) -- 0:00:39
334000 -- [-1066.421] (-1068.017) (-1067.212) (-1068.622) * (-1067.022) (-1070.299) (-1068.349) [-1067.603] -- 0:00:39
334500 -- (-1066.563) (-1066.346) [-1067.706] (-1067.242) * (-1069.283) [-1069.052] (-1067.153) (-1070.659) -- 0:00:39
335000 -- (-1067.087) (-1066.989) (-1066.950) [-1066.817] * (-1070.016) [-1069.349] (-1067.707) (-1070.790) -- 0:00:39
Average standard deviation of split frequencies: 0.010698
335500 -- (-1067.086) (-1067.176) (-1066.974) [-1066.993] * (-1069.245) (-1068.395) (-1069.465) [-1069.937] -- 0:00:39
336000 -- (-1067.082) [-1068.764] (-1067.881) (-1067.857) * (-1068.880) (-1068.953) [-1068.374] (-1067.760) -- 0:00:39
336500 -- (-1066.831) (-1068.758) [-1067.557] (-1071.649) * (-1069.391) [-1070.957] (-1069.787) (-1069.479) -- 0:00:39
337000 -- (-1071.125) (-1067.336) (-1071.935) [-1072.166] * (-1066.684) (-1072.117) [-1067.084] (-1073.671) -- 0:00:41
337500 -- (-1068.670) [-1066.776] (-1067.375) (-1068.258) * [-1067.340] (-1068.986) (-1074.228) (-1070.486) -- 0:00:41
338000 -- (-1067.757) (-1067.225) (-1073.750) [-1068.166] * [-1071.370] (-1067.702) (-1069.840) (-1068.399) -- 0:00:41
338500 -- [-1067.909] (-1068.868) (-1069.798) (-1070.016) * [-1066.610] (-1072.004) (-1067.382) (-1069.052) -- 0:00:41
339000 -- (-1070.428) (-1067.481) (-1072.132) [-1071.956] * [-1068.297] (-1068.331) (-1067.452) (-1067.754) -- 0:00:40
339500 -- (-1068.448) [-1068.436] (-1069.403) (-1067.908) * (-1068.042) (-1067.124) [-1068.916] (-1067.040) -- 0:00:40
340000 -- (-1067.116) [-1068.019] (-1068.949) (-1066.207) * (-1067.232) (-1067.974) [-1066.601] (-1066.702) -- 0:00:40
Average standard deviation of split frequencies: 0.011589
340500 -- [-1066.586] (-1068.056) (-1069.460) (-1070.909) * (-1069.544) (-1072.919) [-1067.289] (-1067.016) -- 0:00:40
341000 -- (-1066.639) (-1070.505) (-1070.734) [-1069.382] * (-1067.778) (-1071.376) (-1067.015) [-1067.464] -- 0:00:40
341500 -- [-1067.037] (-1066.654) (-1069.885) (-1069.992) * [-1066.838] (-1071.263) (-1067.095) (-1067.535) -- 0:00:40
342000 -- (-1067.618) [-1066.619] (-1067.816) (-1066.203) * (-1066.952) (-1068.110) (-1067.626) [-1066.128] -- 0:00:40
342500 -- [-1067.280] (-1068.481) (-1071.706) (-1067.359) * (-1066.952) [-1068.775] (-1068.849) (-1066.063) -- 0:00:40
343000 -- [-1068.176] (-1069.105) (-1069.881) (-1067.610) * (-1066.674) (-1066.461) (-1068.256) [-1066.371] -- 0:00:40
343500 -- (-1067.527) (-1073.298) [-1069.059] (-1069.035) * (-1069.485) [-1066.875] (-1068.657) (-1067.992) -- 0:00:40
344000 -- (-1074.013) (-1070.147) (-1072.193) [-1069.853] * (-1067.785) (-1066.301) (-1069.462) [-1066.990] -- 0:00:40
344500 -- (-1077.317) (-1067.517) (-1075.704) [-1067.054] * [-1068.432] (-1069.879) (-1072.383) (-1067.772) -- 0:00:39
345000 -- (-1072.425) (-1067.427) [-1069.189] (-1067.585) * (-1067.926) (-1071.802) [-1070.821] (-1066.832) -- 0:00:39
Average standard deviation of split frequencies: 0.010389
345500 -- (-1070.770) (-1067.060) [-1069.742] (-1070.660) * [-1067.409] (-1072.504) (-1070.959) (-1068.277) -- 0:00:39
346000 -- (-1068.530) [-1067.394] (-1068.391) (-1068.827) * (-1067.587) [-1068.871] (-1069.724) (-1068.323) -- 0:00:39
346500 -- (-1067.485) (-1067.395) [-1071.676] (-1069.308) * (-1068.002) (-1068.128) [-1067.171] (-1068.487) -- 0:00:39
347000 -- (-1073.627) (-1066.783) (-1068.601) [-1067.320] * (-1067.045) (-1069.808) (-1067.260) [-1068.773] -- 0:00:39
347500 -- (-1071.698) (-1068.117) (-1069.576) [-1066.151] * (-1067.444) [-1068.663] (-1068.371) (-1069.554) -- 0:00:39
348000 -- (-1068.311) (-1068.316) (-1071.547) [-1066.817] * [-1070.349] (-1068.470) (-1067.198) (-1069.226) -- 0:00:39
348500 -- (-1070.364) [-1068.105] (-1068.493) (-1067.439) * [-1069.214] (-1067.596) (-1067.531) (-1069.135) -- 0:00:39
349000 -- (-1069.619) (-1069.033) [-1067.844] (-1067.323) * (-1068.313) [-1068.946] (-1066.883) (-1067.268) -- 0:00:39
349500 -- (-1068.879) [-1066.667] (-1069.165) (-1067.790) * [-1067.212] (-1070.298) (-1067.788) (-1072.516) -- 0:00:39
350000 -- (-1067.475) [-1067.001] (-1069.252) (-1067.718) * (-1073.075) (-1067.572) [-1067.117] (-1070.058) -- 0:00:39
Average standard deviation of split frequencies: 0.009410
350500 -- [-1066.540] (-1067.738) (-1068.221) (-1068.521) * (-1072.549) (-1068.014) [-1065.976] (-1070.145) -- 0:00:38
351000 -- (-1071.383) [-1068.134] (-1067.921) (-1069.359) * (-1067.732) (-1067.782) (-1066.535) [-1071.577] -- 0:00:38
351500 -- (-1067.822) (-1067.379) [-1068.970] (-1069.688) * (-1066.673) (-1068.547) (-1067.812) [-1067.351] -- 0:00:38
352000 -- (-1067.822) [-1066.974] (-1069.288) (-1068.666) * [-1066.708] (-1068.812) (-1070.059) (-1066.580) -- 0:00:38
352500 -- (-1069.506) [-1070.486] (-1070.707) (-1066.674) * (-1066.913) (-1068.072) (-1068.818) [-1067.074] -- 0:00:38
353000 -- (-1066.415) [-1069.022] (-1068.627) (-1067.796) * (-1067.135) (-1066.885) (-1075.699) [-1067.944] -- 0:00:38
353500 -- [-1066.323] (-1068.196) (-1067.809) (-1067.685) * (-1067.338) (-1067.044) (-1069.300) [-1069.107] -- 0:00:40
354000 -- (-1066.208) (-1070.237) (-1067.895) [-1066.582] * (-1071.857) (-1071.551) (-1070.659) [-1068.426] -- 0:00:40
354500 -- (-1066.691) (-1068.765) (-1069.251) [-1067.329] * (-1071.497) (-1066.068) [-1069.165] (-1068.758) -- 0:00:40
355000 -- (-1076.177) (-1067.379) (-1068.503) [-1069.049] * (-1068.652) (-1066.463) (-1068.423) [-1069.532] -- 0:00:39
Average standard deviation of split frequencies: 0.010428
355500 -- (-1068.154) (-1068.753) (-1066.229) [-1067.557] * (-1069.100) [-1067.582] (-1068.011) (-1067.042) -- 0:00:39
356000 -- (-1068.966) (-1068.882) (-1068.852) [-1067.103] * (-1072.887) (-1067.315) [-1068.794] (-1067.527) -- 0:00:39
356500 -- [-1067.149] (-1068.651) (-1069.076) (-1067.577) * (-1069.132) (-1067.994) (-1067.186) [-1067.337] -- 0:00:39
357000 -- [-1067.453] (-1068.249) (-1068.241) (-1069.044) * (-1070.073) (-1066.839) (-1070.877) [-1068.941] -- 0:00:39
357500 -- [-1067.868] (-1067.643) (-1067.557) (-1067.422) * (-1071.413) (-1067.398) [-1068.837] (-1068.292) -- 0:00:39
358000 -- [-1067.983] (-1072.213) (-1067.695) (-1069.139) * (-1068.645) (-1072.511) (-1068.535) [-1067.888] -- 0:00:39
358500 -- (-1070.160) [-1067.360] (-1067.890) (-1067.646) * (-1069.796) [-1071.653] (-1067.592) (-1070.966) -- 0:00:39
359000 -- (-1068.956) [-1067.571] (-1067.977) (-1067.491) * (-1071.059) (-1067.414) (-1069.364) [-1067.559] -- 0:00:39
359500 -- (-1068.839) (-1066.630) (-1074.029) [-1067.268] * [-1066.394] (-1067.476) (-1070.575) (-1068.211) -- 0:00:39
360000 -- (-1068.563) (-1071.616) [-1069.075] (-1068.228) * (-1066.360) [-1067.204] (-1076.040) (-1067.039) -- 0:00:39
Average standard deviation of split frequencies: 0.010211
360500 -- (-1069.347) (-1070.437) [-1068.912] (-1068.186) * (-1067.127) (-1068.070) [-1069.304] (-1066.391) -- 0:00:39
361000 -- [-1068.383] (-1069.766) (-1068.200) (-1066.975) * (-1068.876) (-1066.805) [-1067.233] (-1069.210) -- 0:00:38
361500 -- (-1067.036) (-1071.297) [-1069.639] (-1066.746) * (-1070.438) [-1066.525] (-1066.924) (-1072.136) -- 0:00:38
362000 -- (-1067.136) [-1068.341] (-1071.195) (-1068.185) * (-1070.228) [-1068.446] (-1068.019) (-1072.135) -- 0:00:38
362500 -- (-1066.977) (-1070.819) (-1072.813) [-1072.241] * (-1068.686) (-1068.444) (-1069.678) [-1070.474] -- 0:00:38
363000 -- [-1068.959] (-1067.055) (-1071.015) (-1067.823) * (-1074.139) [-1068.151] (-1068.579) (-1068.189) -- 0:00:38
363500 -- [-1069.866] (-1068.604) (-1066.929) (-1066.490) * (-1067.321) (-1067.948) (-1069.192) [-1069.316] -- 0:00:38
364000 -- [-1069.921] (-1075.126) (-1066.370) (-1067.730) * (-1069.623) [-1067.743] (-1071.684) (-1068.527) -- 0:00:38
364500 -- (-1067.458) (-1069.358) (-1070.754) [-1068.916] * (-1067.356) (-1071.737) [-1069.815] (-1069.004) -- 0:00:38
365000 -- (-1072.702) (-1067.515) (-1070.696) [-1068.067] * [-1068.517] (-1067.643) (-1069.668) (-1068.355) -- 0:00:38
Average standard deviation of split frequencies: 0.009395
365500 -- (-1069.087) (-1067.245) [-1067.327] (-1068.065) * (-1068.635) (-1068.229) (-1066.949) [-1069.536] -- 0:00:38
366000 -- (-1067.795) (-1069.739) [-1068.379] (-1066.842) * (-1068.423) (-1067.846) [-1067.155] (-1069.941) -- 0:00:38
366500 -- (-1067.683) [-1067.414] (-1067.217) (-1070.502) * (-1069.130) (-1072.833) (-1067.528) [-1071.859] -- 0:00:38
367000 -- (-1066.707) [-1066.658] (-1068.564) (-1069.204) * (-1068.228) (-1066.877) (-1066.876) [-1067.011] -- 0:00:37
367500 -- (-1066.911) (-1066.706) (-1069.535) [-1066.963] * (-1074.224) (-1066.632) (-1066.869) [-1067.353] -- 0:00:37
368000 -- (-1067.013) [-1066.758] (-1068.670) (-1067.250) * (-1068.359) (-1067.003) [-1066.450] (-1069.118) -- 0:00:37
368500 -- (-1070.759) (-1069.142) (-1067.997) [-1069.018] * (-1068.937) (-1066.695) (-1067.778) [-1069.583] -- 0:00:37
369000 -- (-1068.841) (-1068.767) (-1069.676) [-1067.846] * [-1072.869] (-1067.828) (-1068.107) (-1068.630) -- 0:00:37
369500 -- (-1068.321) [-1067.519] (-1068.545) (-1066.475) * (-1069.423) (-1066.824) (-1067.601) [-1067.032] -- 0:00:37
370000 -- (-1069.541) [-1069.013] (-1067.792) (-1066.520) * (-1068.270) (-1068.967) [-1067.602] (-1066.314) -- 0:00:39
Average standard deviation of split frequencies: 0.009501
370500 -- (-1069.691) (-1073.821) [-1067.831] (-1068.289) * [-1068.577] (-1069.074) (-1067.963) (-1066.417) -- 0:00:39
371000 -- (-1068.085) (-1072.027) [-1066.688] (-1067.451) * [-1068.170] (-1068.315) (-1066.346) (-1067.702) -- 0:00:38
371500 -- (-1066.871) [-1067.430] (-1068.400) (-1066.740) * (-1069.386) (-1068.787) (-1067.204) [-1065.974] -- 0:00:38
372000 -- (-1067.606) (-1067.358) [-1068.048] (-1069.525) * (-1070.048) [-1068.777] (-1067.343) (-1067.730) -- 0:00:38
372500 -- (-1067.688) (-1067.113) [-1067.891] (-1069.212) * [-1067.958] (-1071.820) (-1067.928) (-1066.964) -- 0:00:38
373000 -- (-1070.646) (-1073.556) [-1067.935] (-1069.614) * (-1067.684) (-1070.070) [-1066.686] (-1067.869) -- 0:00:38
373500 -- (-1068.354) (-1067.897) (-1068.914) [-1069.490] * (-1070.165) [-1067.395] (-1068.083) (-1068.377) -- 0:00:38
374000 -- (-1067.401) [-1068.180] (-1069.488) (-1068.906) * [-1067.201] (-1070.453) (-1066.261) (-1068.236) -- 0:00:38
374500 -- (-1068.542) [-1068.017] (-1067.585) (-1069.232) * (-1069.318) (-1068.253) (-1066.261) [-1068.496] -- 0:00:38
375000 -- (-1069.906) (-1066.860) [-1067.580] (-1068.368) * (-1067.253) (-1068.518) (-1066.968) [-1068.799] -- 0:00:38
Average standard deviation of split frequencies: 0.008619
375500 -- (-1066.691) (-1067.727) (-1070.041) [-1068.407] * (-1070.585) (-1068.282) [-1068.322] (-1067.097) -- 0:00:38
376000 -- [-1068.210] (-1068.306) (-1068.977) (-1067.959) * (-1069.888) [-1067.062] (-1068.667) (-1070.902) -- 0:00:38
376500 -- (-1067.925) (-1067.681) [-1071.187] (-1071.283) * (-1067.258) (-1069.332) [-1069.390] (-1071.233) -- 0:00:38
377000 -- (-1067.764) (-1070.983) (-1066.837) [-1067.297] * (-1069.019) (-1069.517) (-1069.349) [-1070.654] -- 0:00:38
377500 -- (-1068.291) [-1066.531] (-1066.972) (-1066.369) * (-1068.748) (-1068.211) [-1067.165] (-1070.124) -- 0:00:37
378000 -- [-1068.820] (-1066.768) (-1067.559) (-1069.458) * (-1068.154) [-1066.358] (-1069.633) (-1072.735) -- 0:00:37
378500 -- [-1068.821] (-1067.239) (-1066.932) (-1068.505) * (-1066.861) (-1066.653) [-1069.243] (-1071.945) -- 0:00:37
379000 -- [-1070.506] (-1066.002) (-1068.586) (-1068.055) * (-1067.552) (-1068.836) (-1068.002) [-1071.271] -- 0:00:37
379500 -- (-1067.166) (-1066.992) [-1066.323] (-1068.112) * [-1070.100] (-1066.543) (-1068.972) (-1073.726) -- 0:00:37
380000 -- (-1068.085) [-1066.829] (-1068.852) (-1069.803) * [-1071.677] (-1067.932) (-1073.500) (-1067.861) -- 0:00:37
Average standard deviation of split frequencies: 0.008204
380500 -- (-1066.974) [-1066.828] (-1070.201) (-1070.801) * (-1070.513) (-1067.882) [-1066.395] (-1070.156) -- 0:00:37
381000 -- (-1066.547) (-1067.271) [-1072.083] (-1068.370) * (-1070.892) [-1067.399] (-1066.464) (-1073.134) -- 0:00:37
381500 -- [-1068.984] (-1069.068) (-1067.919) (-1066.897) * (-1069.588) (-1070.723) [-1067.181] (-1070.717) -- 0:00:37
382000 -- (-1069.386) [-1069.743] (-1071.718) (-1067.139) * (-1067.064) (-1070.708) (-1066.625) [-1067.369] -- 0:00:37
382500 -- (-1067.834) (-1068.191) [-1070.100] (-1072.248) * (-1067.487) (-1070.000) (-1068.463) [-1066.669] -- 0:00:37
383000 -- (-1070.533) (-1066.631) (-1067.016) [-1072.457] * (-1073.920) (-1067.983) (-1068.902) [-1067.327] -- 0:00:37
383500 -- (-1069.320) (-1070.465) [-1067.664] (-1068.608) * (-1069.859) (-1065.919) (-1069.854) [-1067.665] -- 0:00:36
384000 -- (-1068.923) (-1076.782) [-1067.851] (-1072.753) * (-1068.846) [-1065.932] (-1068.592) (-1070.871) -- 0:00:36
384500 -- (-1067.966) [-1069.675] (-1066.793) (-1072.565) * (-1068.992) [-1069.419] (-1068.275) (-1067.829) -- 0:00:36
385000 -- [-1067.991] (-1071.987) (-1070.408) (-1067.758) * (-1067.960) [-1070.990] (-1069.116) (-1067.327) -- 0:00:36
Average standard deviation of split frequencies: 0.008167
385500 -- [-1068.014] (-1067.936) (-1068.461) (-1070.297) * (-1067.408) [-1071.027] (-1069.839) (-1068.368) -- 0:00:36
386000 -- (-1067.976) (-1068.081) [-1069.347] (-1068.042) * (-1071.255) (-1068.579) (-1066.135) [-1067.491] -- 0:00:36
386500 -- (-1066.620) (-1066.534) (-1074.567) [-1068.861] * [-1070.897] (-1071.125) (-1066.820) (-1067.399) -- 0:00:38
387000 -- (-1066.735) (-1068.242) [-1066.294] (-1068.117) * (-1070.269) (-1069.090) (-1066.761) [-1068.590] -- 0:00:38
387500 -- (-1066.508) [-1067.076] (-1066.552) (-1067.624) * (-1068.689) (-1066.702) (-1071.348) [-1067.435] -- 0:00:37
388000 -- (-1069.111) (-1066.945) [-1066.833] (-1068.102) * [-1070.969] (-1070.441) (-1069.933) (-1067.424) -- 0:00:37
388500 -- (-1068.307) (-1069.211) (-1067.969) [-1067.795] * (-1072.306) [-1067.025] (-1069.236) (-1066.930) -- 0:00:37
389000 -- [-1069.882] (-1069.005) (-1069.091) (-1066.386) * (-1066.672) (-1066.859) [-1069.810] (-1069.041) -- 0:00:37
389500 -- (-1070.510) (-1068.252) [-1070.382] (-1067.999) * [-1069.160] (-1068.175) (-1068.372) (-1069.711) -- 0:00:37
390000 -- (-1071.900) (-1067.814) [-1067.843] (-1067.909) * (-1069.054) (-1073.595) [-1069.107] (-1068.697) -- 0:00:37
Average standard deviation of split frequencies: 0.008163
390500 -- (-1067.652) (-1067.825) (-1070.815) [-1069.928] * (-1071.194) (-1067.386) [-1068.212] (-1069.971) -- 0:00:37
391000 -- [-1067.246] (-1067.368) (-1067.191) (-1066.995) * [-1068.391] (-1066.845) (-1068.855) (-1068.347) -- 0:00:37
391500 -- (-1067.299) (-1067.392) (-1070.038) [-1066.964] * [-1071.222] (-1066.845) (-1066.872) (-1068.059) -- 0:00:37
392000 -- (-1067.048) (-1067.520) [-1067.297] (-1067.399) * (-1066.607) (-1068.334) [-1068.793] (-1067.534) -- 0:00:37
392500 -- (-1067.469) [-1067.625] (-1068.441) (-1069.555) * (-1067.411) [-1066.921] (-1068.039) (-1070.492) -- 0:00:37
393000 -- [-1067.524] (-1067.789) (-1066.271) (-1070.506) * [-1071.276] (-1067.861) (-1070.406) (-1067.052) -- 0:00:37
393500 -- (-1069.210) (-1068.074) [-1066.065] (-1068.690) * (-1073.735) [-1067.162] (-1067.440) (-1066.531) -- 0:00:36
394000 -- (-1068.206) (-1069.344) (-1066.229) [-1069.999] * (-1069.208) (-1068.240) [-1066.553] (-1069.777) -- 0:00:36
394500 -- (-1068.407) (-1066.621) [-1068.178] (-1067.084) * (-1069.322) (-1067.931) [-1066.561] (-1068.372) -- 0:00:36
395000 -- (-1067.512) (-1066.658) [-1070.777] (-1067.568) * (-1069.543) (-1066.750) (-1067.024) [-1068.027] -- 0:00:36
Average standard deviation of split frequencies: 0.007843
395500 -- (-1069.238) [-1067.227] (-1070.776) (-1067.334) * (-1068.210) (-1066.383) [-1067.258] (-1068.661) -- 0:00:36
396000 -- (-1068.983) [-1067.911] (-1072.163) (-1067.820) * (-1069.513) (-1066.426) [-1067.601] (-1068.148) -- 0:00:36
396500 -- (-1068.296) (-1067.874) [-1067.981] (-1068.221) * (-1071.478) (-1067.005) (-1068.430) [-1069.415] -- 0:00:36
397000 -- [-1067.015] (-1071.894) (-1069.453) (-1068.251) * [-1070.541] (-1068.681) (-1071.117) (-1068.265) -- 0:00:36
397500 -- (-1066.825) [-1068.974] (-1074.759) (-1070.255) * (-1068.459) [-1069.327] (-1070.224) (-1069.450) -- 0:00:36
398000 -- (-1071.876) (-1070.252) (-1075.185) [-1073.080] * (-1069.517) [-1067.425] (-1070.082) (-1068.454) -- 0:00:36
398500 -- (-1068.880) [-1069.143] (-1073.589) (-1070.241) * (-1069.162) (-1067.870) (-1070.039) [-1067.250] -- 0:00:36
399000 -- (-1068.306) [-1068.633] (-1069.941) (-1072.378) * [-1071.084] (-1069.143) (-1066.863) (-1067.914) -- 0:00:36
399500 -- [-1066.809] (-1068.520) (-1072.439) (-1072.328) * [-1067.468] (-1077.263) (-1066.357) (-1068.672) -- 0:00:36
400000 -- (-1067.212) (-1068.890) [-1069.762] (-1069.374) * (-1067.396) (-1068.713) [-1066.364] (-1069.284) -- 0:00:36
Average standard deviation of split frequencies: 0.007475
400500 -- (-1066.447) (-1067.226) [-1069.165] (-1068.761) * (-1069.467) (-1068.952) (-1068.468) [-1068.076] -- 0:00:35
401000 -- (-1066.689) (-1067.593) (-1067.132) [-1069.585] * (-1068.259) (-1071.353) [-1067.626] (-1071.272) -- 0:00:35
401500 -- (-1072.660) (-1070.708) [-1068.659] (-1067.193) * [-1066.383] (-1069.583) (-1068.427) (-1070.477) -- 0:00:35
402000 -- (-1066.889) (-1067.082) [-1068.059] (-1072.435) * (-1068.103) (-1069.538) (-1067.841) [-1069.241] -- 0:00:35
402500 -- (-1066.318) (-1067.012) (-1068.989) [-1068.900] * [-1067.224] (-1069.925) (-1068.567) (-1067.290) -- 0:00:37
403000 -- [-1066.227] (-1067.464) (-1067.437) (-1069.151) * [-1066.647] (-1068.661) (-1067.515) (-1067.682) -- 0:00:37
403500 -- (-1066.652) (-1070.804) [-1067.198] (-1068.193) * (-1067.185) (-1070.525) [-1065.992] (-1067.760) -- 0:00:36
404000 -- (-1078.462) (-1071.475) [-1067.544] (-1068.449) * (-1066.726) (-1067.125) (-1066.105) [-1067.183] -- 0:00:36
404500 -- (-1074.477) (-1066.392) (-1067.314) [-1069.187] * (-1066.367) (-1067.963) [-1069.006] (-1072.997) -- 0:00:36
405000 -- (-1066.191) (-1068.553) (-1068.490) [-1067.021] * (-1066.508) (-1067.047) [-1068.553] (-1069.325) -- 0:00:36
Average standard deviation of split frequencies: 0.008128
405500 -- [-1067.967] (-1068.303) (-1072.894) (-1068.751) * (-1068.274) [-1067.004] (-1068.832) (-1070.187) -- 0:00:36
406000 -- (-1070.820) [-1069.220] (-1067.769) (-1067.403) * [-1069.341] (-1069.272) (-1067.878) (-1068.483) -- 0:00:36
406500 -- (-1071.452) (-1068.878) (-1069.212) [-1067.808] * [-1073.256] (-1068.579) (-1068.504) (-1067.218) -- 0:00:36
407000 -- [-1068.572] (-1072.150) (-1068.070) (-1074.288) * [-1068.459] (-1068.977) (-1067.907) (-1070.219) -- 0:00:36
407500 -- (-1067.141) (-1069.437) [-1069.187] (-1068.254) * (-1069.860) (-1071.739) [-1066.931] (-1067.423) -- 0:00:36
408000 -- (-1068.262) (-1069.588) [-1067.667] (-1068.680) * (-1066.940) [-1067.794] (-1067.775) (-1067.995) -- 0:00:36
408500 -- (-1070.110) (-1069.500) [-1066.116] (-1066.961) * (-1066.553) (-1068.165) [-1066.939] (-1067.464) -- 0:00:36
409000 -- (-1069.649) (-1070.936) (-1066.765) [-1066.955] * [-1072.168] (-1067.504) (-1068.169) (-1067.843) -- 0:00:36
409500 -- (-1068.515) (-1068.778) [-1067.074] (-1074.181) * (-1069.260) (-1068.274) [-1069.853] (-1066.960) -- 0:00:36
410000 -- (-1069.497) [-1072.826] (-1066.591) (-1071.552) * (-1067.059) (-1067.283) (-1067.890) [-1069.517] -- 0:00:35
Average standard deviation of split frequencies: 0.007780
410500 -- (-1070.396) [-1071.894] (-1065.893) (-1076.399) * (-1066.951) (-1071.544) [-1068.735] (-1069.874) -- 0:00:35
411000 -- (-1071.119) [-1069.736] (-1069.646) (-1075.426) * [-1067.714] (-1072.350) (-1068.631) (-1072.077) -- 0:00:35
411500 -- [-1070.055] (-1066.753) (-1070.959) (-1067.229) * [-1068.438] (-1072.838) (-1067.650) (-1070.835) -- 0:00:35
412000 -- (-1067.494) [-1070.397] (-1071.627) (-1069.287) * (-1067.007) [-1069.790] (-1070.736) (-1075.727) -- 0:00:35
412500 -- (-1066.149) [-1068.675] (-1070.516) (-1066.938) * [-1068.110] (-1071.451) (-1067.785) (-1066.557) -- 0:00:35
413000 -- [-1068.194] (-1069.013) (-1069.904) (-1068.958) * (-1066.839) (-1066.609) (-1068.612) [-1069.164] -- 0:00:35
413500 -- [-1066.639] (-1067.805) (-1070.317) (-1070.000) * [-1068.888] (-1066.647) (-1066.860) (-1068.432) -- 0:00:35
414000 -- (-1066.637) (-1071.035) [-1066.363] (-1068.338) * [-1068.462] (-1068.391) (-1067.983) (-1067.328) -- 0:00:35
414500 -- (-1067.844) [-1067.319] (-1066.474) (-1067.686) * (-1074.403) [-1068.487] (-1070.422) (-1071.748) -- 0:00:35
415000 -- [-1067.785] (-1072.297) (-1068.040) (-1069.236) * [-1067.285] (-1067.063) (-1068.632) (-1069.368) -- 0:00:35
Average standard deviation of split frequencies: 0.008199
415500 -- (-1066.777) (-1068.382) (-1071.468) [-1066.721] * [-1066.492] (-1066.365) (-1068.175) (-1071.751) -- 0:00:35
416000 -- (-1070.163) [-1067.295] (-1068.612) (-1067.870) * (-1067.495) [-1068.416] (-1067.944) (-1066.811) -- 0:00:35
416500 -- (-1070.265) (-1068.128) [-1067.584] (-1068.524) * (-1066.382) (-1068.132) (-1068.911) [-1066.301] -- 0:00:35
417000 -- (-1070.378) (-1067.113) (-1066.188) [-1067.441] * [-1073.398] (-1067.319) (-1069.464) (-1066.826) -- 0:00:34
417500 -- (-1069.042) [-1068.584] (-1069.923) (-1070.183) * (-1067.405) [-1066.640] (-1073.811) (-1068.624) -- 0:00:34
418000 -- [-1068.404] (-1068.564) (-1067.494) (-1069.576) * (-1069.468) (-1066.536) [-1072.372] (-1068.324) -- 0:00:34
418500 -- (-1067.803) (-1066.698) (-1070.052) [-1067.508] * (-1066.737) (-1070.679) (-1072.227) [-1066.187] -- 0:00:34
419000 -- (-1068.337) (-1066.636) (-1067.703) [-1069.383] * (-1071.277) [-1069.872] (-1066.746) (-1068.820) -- 0:00:36
419500 -- (-1068.324) (-1067.745) (-1068.856) [-1068.823] * (-1066.617) [-1068.652] (-1067.750) (-1071.842) -- 0:00:35
420000 -- (-1068.330) [-1066.831] (-1067.816) (-1067.292) * (-1070.525) (-1067.649) [-1067.897] (-1070.528) -- 0:00:35
Average standard deviation of split frequencies: 0.008899
420500 -- (-1071.460) (-1070.977) (-1068.024) [-1066.258] * (-1070.782) [-1069.069] (-1070.010) (-1069.398) -- 0:00:35
421000 -- (-1067.245) (-1068.191) [-1067.939] (-1066.757) * (-1068.079) (-1067.868) [-1067.303] (-1066.506) -- 0:00:35
421500 -- [-1067.159] (-1067.661) (-1074.083) (-1067.734) * (-1070.961) (-1067.398) (-1067.524) [-1067.485] -- 0:00:35
422000 -- [-1067.123] (-1069.258) (-1075.242) (-1070.238) * (-1069.264) (-1066.601) [-1072.007] (-1066.922) -- 0:00:35
422500 -- [-1068.162] (-1066.757) (-1072.080) (-1070.636) * (-1068.091) [-1066.406] (-1069.309) (-1068.090) -- 0:00:35
423000 -- (-1069.803) (-1067.436) (-1066.991) [-1069.585] * (-1066.942) (-1069.807) [-1068.379] (-1068.211) -- 0:00:35
423500 -- (-1068.109) (-1068.947) (-1067.694) [-1067.108] * (-1067.745) [-1067.171] (-1066.973) (-1067.990) -- 0:00:35
424000 -- (-1067.869) (-1073.533) (-1068.103) [-1066.940] * (-1069.108) [-1068.007] (-1067.188) (-1068.499) -- 0:00:35
424500 -- (-1067.747) (-1071.691) [-1067.603] (-1069.045) * [-1067.897] (-1068.947) (-1069.486) (-1068.207) -- 0:00:35
425000 -- (-1067.771) (-1071.442) (-1068.609) [-1068.288] * (-1069.517) [-1067.510] (-1066.901) (-1070.741) -- 0:00:35
Average standard deviation of split frequencies: 0.009836
425500 -- (-1071.988) (-1070.904) (-1069.588) [-1071.696] * (-1071.442) (-1066.775) [-1067.255] (-1070.719) -- 0:00:35
426000 -- (-1068.213) [-1066.373] (-1070.771) (-1068.022) * (-1072.235) (-1066.698) [-1066.584] (-1066.772) -- 0:00:35
426500 -- [-1070.400] (-1067.262) (-1067.924) (-1067.723) * [-1072.915] (-1071.655) (-1066.515) (-1066.379) -- 0:00:34
427000 -- (-1068.677) (-1070.739) (-1068.845) [-1073.040] * (-1068.170) (-1074.246) [-1069.341] (-1068.633) -- 0:00:34
427500 -- (-1068.145) (-1068.239) (-1072.058) [-1066.789] * (-1069.710) (-1068.735) [-1069.088] (-1069.768) -- 0:00:34
428000 -- (-1069.424) (-1070.287) (-1072.698) [-1067.744] * (-1070.476) [-1066.705] (-1066.811) (-1071.922) -- 0:00:34
428500 -- [-1067.087] (-1068.916) (-1070.274) (-1070.144) * (-1069.928) (-1066.694) [-1066.977] (-1068.072) -- 0:00:34
429000 -- [-1067.583] (-1067.712) (-1069.200) (-1069.242) * [-1068.926] (-1066.702) (-1068.119) (-1069.138) -- 0:00:34
429500 -- (-1066.622) [-1067.860] (-1067.079) (-1067.376) * (-1067.142) (-1067.061) (-1067.304) [-1070.698] -- 0:00:34
430000 -- (-1070.846) [-1067.519] (-1066.707) (-1067.385) * (-1066.852) [-1067.599] (-1066.603) (-1067.626) -- 0:00:34
Average standard deviation of split frequencies: 0.008635
430500 -- (-1067.530) (-1070.606) [-1067.519] (-1071.457) * (-1068.111) [-1067.017] (-1066.447) (-1068.762) -- 0:00:34
431000 -- (-1067.422) [-1068.844] (-1069.384) (-1067.262) * [-1067.336] (-1067.465) (-1068.856) (-1068.102) -- 0:00:34
431500 -- (-1067.471) [-1066.827] (-1069.683) (-1067.042) * (-1066.421) (-1070.612) (-1069.281) [-1066.430] -- 0:00:34
432000 -- [-1067.710] (-1066.785) (-1069.285) (-1070.869) * [-1066.379] (-1066.603) (-1067.727) (-1072.716) -- 0:00:34
432500 -- [-1065.968] (-1067.625) (-1068.665) (-1067.893) * (-1066.226) [-1066.506] (-1068.266) (-1070.152) -- 0:00:34
433000 -- (-1066.221) (-1066.840) (-1070.121) [-1069.186] * (-1067.688) (-1068.867) (-1068.735) [-1072.145] -- 0:00:34
433500 -- (-1068.395) [-1068.054] (-1069.713) (-1067.084) * [-1067.688] (-1071.563) (-1068.365) (-1070.734) -- 0:00:33
434000 -- [-1067.171] (-1068.056) (-1071.534) (-1067.451) * (-1067.938) (-1072.749) [-1072.983] (-1073.951) -- 0:00:33
434500 -- [-1066.412] (-1070.887) (-1074.558) (-1067.497) * (-1066.784) (-1074.279) (-1072.839) [-1070.517] -- 0:00:33
435000 -- (-1067.143) (-1071.641) (-1066.863) [-1068.405] * (-1068.834) (-1068.676) (-1072.652) [-1069.649] -- 0:00:33
Average standard deviation of split frequencies: 0.008904
435500 -- (-1069.871) (-1070.487) (-1068.291) [-1068.403] * (-1070.495) [-1072.440] (-1069.385) (-1068.127) -- 0:00:34
436000 -- (-1068.598) (-1070.416) (-1068.669) [-1069.691] * (-1067.100) (-1067.607) [-1069.320] (-1069.217) -- 0:00:34
436500 -- (-1071.557) [-1066.649] (-1069.181) (-1069.844) * (-1070.558) [-1068.067] (-1067.088) (-1068.448) -- 0:00:34
437000 -- (-1066.855) [-1067.477] (-1069.733) (-1072.726) * (-1067.508) (-1066.681) (-1070.714) [-1069.028] -- 0:00:34
437500 -- [-1067.843] (-1070.923) (-1067.748) (-1070.295) * (-1066.526) (-1066.591) [-1073.921] (-1072.241) -- 0:00:34
438000 -- (-1066.475) [-1071.430] (-1067.870) (-1070.266) * (-1068.909) (-1068.771) (-1066.714) [-1068.981] -- 0:00:34
438500 -- (-1066.515) [-1067.887] (-1073.027) (-1067.820) * (-1071.110) (-1070.071) [-1068.475] (-1067.848) -- 0:00:34
439000 -- (-1073.255) (-1067.762) (-1068.431) [-1074.244] * (-1067.923) (-1067.066) [-1067.536] (-1068.366) -- 0:00:34
439500 -- (-1068.978) (-1066.922) (-1069.200) [-1069.042] * (-1068.894) [-1068.382] (-1066.890) (-1067.870) -- 0:00:34
440000 -- (-1067.562) (-1067.999) [-1068.417] (-1069.462) * (-1068.806) (-1068.786) [-1066.878] (-1069.598) -- 0:00:34
Average standard deviation of split frequencies: 0.008369
440500 -- [-1070.600] (-1066.391) (-1069.150) (-1068.425) * (-1067.110) (-1066.585) [-1068.590] (-1069.220) -- 0:00:34
441000 -- [-1067.959] (-1068.463) (-1067.714) (-1067.750) * (-1068.252) (-1066.585) [-1067.719] (-1072.950) -- 0:00:34
441500 -- (-1069.059) [-1067.738] (-1069.369) (-1068.678) * (-1069.216) (-1069.449) (-1067.597) [-1068.781] -- 0:00:34
442000 -- [-1070.702] (-1068.268) (-1069.569) (-1069.080) * (-1070.771) (-1066.383) (-1071.767) [-1066.386] -- 0:00:34
442500 -- (-1068.028) (-1066.790) (-1068.589) [-1068.745] * (-1070.468) (-1067.224) (-1071.726) [-1066.386] -- 0:00:34
443000 -- (-1070.097) (-1068.321) [-1069.706] (-1067.651) * (-1071.119) (-1067.669) (-1073.568) [-1066.961] -- 0:00:33
443500 -- (-1071.007) [-1067.311] (-1067.606) (-1067.550) * (-1070.988) [-1066.422] (-1066.644) (-1067.010) -- 0:00:33
444000 -- (-1069.427) (-1067.408) [-1067.300] (-1066.268) * (-1066.957) [-1066.426] (-1066.742) (-1070.181) -- 0:00:33
444500 -- [-1068.791] (-1068.556) (-1071.417) (-1068.403) * (-1068.459) [-1067.131] (-1068.489) (-1068.275) -- 0:00:33
445000 -- (-1069.872) (-1069.055) (-1066.064) [-1068.876] * (-1069.349) (-1066.839) [-1067.475] (-1067.722) -- 0:00:33
Average standard deviation of split frequencies: 0.008207
445500 -- (-1070.585) [-1066.880] (-1068.239) (-1067.033) * (-1068.810) (-1067.811) [-1068.160] (-1070.050) -- 0:00:33
446000 -- (-1069.784) (-1068.054) (-1068.191) [-1066.081] * (-1070.460) [-1066.189] (-1070.229) (-1066.295) -- 0:00:33
446500 -- [-1071.801] (-1069.187) (-1069.859) (-1068.429) * (-1067.748) (-1067.121) (-1067.386) [-1068.117] -- 0:00:33
447000 -- (-1080.742) (-1068.682) (-1068.527) [-1068.009] * (-1068.306) (-1068.685) [-1068.134] (-1067.674) -- 0:00:33
447500 -- (-1069.349) [-1067.720] (-1068.093) (-1069.169) * (-1067.405) [-1068.347] (-1070.527) (-1066.870) -- 0:00:33
448000 -- (-1068.767) (-1068.020) [-1067.756] (-1068.496) * [-1067.079] (-1068.242) (-1071.378) (-1072.552) -- 0:00:33
448500 -- (-1067.489) (-1069.949) [-1067.954] (-1066.597) * [-1067.939] (-1069.138) (-1067.269) (-1067.639) -- 0:00:33
449000 -- (-1067.743) (-1067.630) (-1067.139) [-1067.773] * (-1066.805) [-1068.317] (-1066.517) (-1069.556) -- 0:00:33
449500 -- (-1068.845) [-1067.679] (-1067.151) (-1067.187) * (-1069.386) (-1066.809) [-1068.211] (-1066.530) -- 0:00:33
450000 -- (-1067.765) (-1066.944) [-1068.697] (-1070.778) * (-1071.359) (-1071.322) (-1066.875) [-1066.666] -- 0:00:33
Average standard deviation of split frequencies: 0.008060
450500 -- [-1068.493] (-1069.133) (-1068.281) (-1067.838) * (-1070.932) (-1068.318) (-1069.641) [-1066.599] -- 0:00:32
451000 -- (-1072.545) (-1068.564) [-1067.909] (-1067.316) * (-1068.507) (-1068.102) (-1067.514) [-1066.652] -- 0:00:34
451500 -- (-1072.617) (-1073.498) (-1069.549) [-1067.473] * (-1069.366) [-1068.510] (-1067.978) (-1066.438) -- 0:00:34
452000 -- (-1069.957) (-1067.500) (-1069.509) [-1067.454] * [-1071.082] (-1069.213) (-1068.321) (-1067.568) -- 0:00:33
452500 -- (-1069.623) (-1068.341) (-1066.681) [-1068.132] * (-1066.989) (-1067.765) (-1068.533) [-1066.579] -- 0:00:33
453000 -- (-1068.011) (-1070.171) [-1067.047] (-1071.735) * (-1067.505) (-1068.067) [-1069.198] (-1069.318) -- 0:00:33
453500 -- (-1071.071) [-1067.644] (-1069.708) (-1068.125) * (-1067.076) (-1072.394) [-1068.101] (-1071.149) -- 0:00:33
454000 -- (-1066.826) (-1068.430) [-1070.603] (-1067.121) * (-1067.636) (-1071.011) [-1068.039] (-1072.796) -- 0:00:33
454500 -- (-1067.512) (-1068.379) [-1071.396] (-1069.198) * [-1067.894] (-1069.802) (-1070.488) (-1067.806) -- 0:00:33
455000 -- [-1067.250] (-1067.813) (-1069.343) (-1069.598) * [-1069.154] (-1070.759) (-1070.084) (-1068.425) -- 0:00:33
Average standard deviation of split frequencies: 0.009000
455500 -- (-1067.706) [-1066.915] (-1067.068) (-1066.715) * (-1073.244) (-1068.148) (-1067.912) [-1071.531] -- 0:00:33
456000 -- [-1069.950] (-1069.619) (-1066.031) (-1066.676) * (-1069.499) (-1069.137) [-1069.519] (-1068.039) -- 0:00:33
456500 -- [-1069.178] (-1067.686) (-1066.015) (-1069.224) * [-1070.260] (-1067.938) (-1067.982) (-1071.120) -- 0:00:33
457000 -- [-1072.314] (-1067.789) (-1071.897) (-1073.895) * (-1067.650) [-1068.160] (-1067.636) (-1070.201) -- 0:00:33
457500 -- (-1076.084) (-1067.021) (-1070.769) [-1067.215] * [-1067.041] (-1070.063) (-1069.413) (-1066.632) -- 0:00:33
458000 -- (-1070.892) (-1068.089) [-1068.522] (-1068.372) * [-1067.759] (-1070.788) (-1068.716) (-1068.090) -- 0:00:33
458500 -- (-1068.198) (-1070.020) [-1067.131] (-1070.274) * (-1069.682) (-1072.489) [-1069.744] (-1067.831) -- 0:00:33
459000 -- (-1066.770) [-1068.073] (-1066.113) (-1070.658) * (-1069.531) [-1068.390] (-1070.689) (-1066.184) -- 0:00:33
459500 -- [-1067.832] (-1071.065) (-1066.117) (-1071.402) * (-1067.571) (-1068.899) (-1068.285) [-1066.292] -- 0:00:32
460000 -- (-1067.359) (-1068.555) [-1068.569] (-1067.297) * (-1067.507) (-1068.754) (-1070.416) [-1068.484] -- 0:00:32
Average standard deviation of split frequencies: 0.009029
460500 -- (-1068.758) [-1069.659] (-1069.329) (-1067.372) * (-1068.370) (-1070.278) (-1069.095) [-1067.548] -- 0:00:32
461000 -- (-1067.794) (-1068.645) [-1069.627] (-1067.539) * (-1069.976) (-1070.650) (-1070.079) [-1067.024] -- 0:00:32
461500 -- (-1067.530) (-1069.914) (-1068.250) [-1067.176] * [-1069.010] (-1070.219) (-1067.521) (-1066.443) -- 0:00:32
462000 -- [-1067.102] (-1069.866) (-1072.289) (-1067.761) * [-1068.800] (-1066.622) (-1067.420) (-1067.501) -- 0:00:32
462500 -- [-1067.731] (-1069.643) (-1070.984) (-1066.690) * [-1067.154] (-1067.004) (-1067.466) (-1068.811) -- 0:00:32
463000 -- (-1067.366) (-1071.752) (-1066.320) [-1067.889] * [-1067.838] (-1069.171) (-1069.652) (-1067.706) -- 0:00:32
463500 -- (-1069.613) [-1071.192] (-1066.316) (-1067.895) * (-1068.061) (-1070.468) (-1071.210) [-1070.371] -- 0:00:32
464000 -- [-1068.607] (-1067.247) (-1076.530) (-1067.662) * (-1068.227) (-1067.209) (-1070.166) [-1068.052] -- 0:00:32
464500 -- [-1072.168] (-1067.047) (-1068.977) (-1066.594) * (-1067.382) (-1072.407) [-1067.015] (-1067.504) -- 0:00:32
465000 -- (-1068.393) (-1068.875) (-1069.756) [-1066.917] * (-1067.079) (-1071.327) [-1068.824] (-1066.817) -- 0:00:32
Average standard deviation of split frequencies: 0.010060
465500 -- [-1067.319] (-1068.815) (-1070.080) (-1069.759) * (-1066.830) (-1069.766) (-1067.645) [-1068.201] -- 0:00:32
466000 -- (-1074.507) [-1067.813] (-1066.436) (-1067.791) * (-1067.657) (-1065.922) (-1070.080) [-1069.436] -- 0:00:32
466500 -- (-1068.936) (-1068.080) (-1068.814) [-1067.123] * (-1067.680) [-1069.265] (-1068.721) (-1069.938) -- 0:00:32
467000 -- (-1069.858) [-1067.308] (-1069.539) (-1067.715) * [-1067.799] (-1067.907) (-1071.592) (-1068.572) -- 0:00:31
467500 -- (-1069.857) [-1067.971] (-1068.713) (-1067.575) * [-1066.903] (-1070.355) (-1073.761) (-1070.102) -- 0:00:33
468000 -- (-1068.412) (-1066.991) (-1069.863) [-1068.022] * (-1066.993) [-1067.141] (-1070.115) (-1068.817) -- 0:00:32
468500 -- (-1071.120) (-1066.978) (-1068.994) [-1067.458] * (-1069.252) (-1069.778) (-1071.059) [-1069.040] -- 0:00:32
469000 -- [-1067.969] (-1068.285) (-1067.740) (-1068.052) * (-1068.119) [-1069.963] (-1067.471) (-1068.357) -- 0:00:32
469500 -- (-1068.015) (-1069.016) (-1066.399) [-1068.368] * [-1070.056] (-1071.542) (-1067.883) (-1066.574) -- 0:00:32
470000 -- (-1069.157) (-1070.347) [-1067.030] (-1067.100) * (-1067.286) (-1067.704) [-1067.853] (-1066.574) -- 0:00:32
Average standard deviation of split frequencies: 0.009132
470500 -- (-1066.799) [-1066.855] (-1069.639) (-1069.861) * [-1069.859] (-1071.311) (-1068.347) (-1069.447) -- 0:00:32
471000 -- (-1066.293) (-1069.642) [-1067.606] (-1067.582) * (-1067.766) [-1067.402] (-1067.735) (-1069.950) -- 0:00:32
471500 -- [-1066.719] (-1070.644) (-1068.446) (-1070.333) * (-1068.190) [-1070.075] (-1068.398) (-1068.890) -- 0:00:32
472000 -- (-1066.699) (-1069.499) (-1069.372) [-1066.546] * [-1067.780] (-1067.801) (-1068.473) (-1067.410) -- 0:00:32
472500 -- [-1066.732] (-1066.956) (-1067.118) (-1068.556) * (-1073.079) (-1066.718) [-1066.826] (-1067.938) -- 0:00:32
473000 -- (-1066.877) [-1066.280] (-1066.657) (-1071.011) * (-1069.757) (-1067.556) (-1066.881) [-1067.610] -- 0:00:32
473500 -- [-1066.971] (-1066.722) (-1068.520) (-1072.646) * (-1069.005) [-1067.640] (-1066.881) (-1069.368) -- 0:00:32
474000 -- (-1074.943) (-1069.037) (-1067.815) [-1069.894] * (-1069.628) (-1067.667) [-1068.334] (-1069.596) -- 0:00:32
474500 -- (-1067.142) [-1070.304] (-1067.619) (-1071.258) * (-1067.911) (-1067.814) (-1068.253) [-1068.676] -- 0:00:32
475000 -- [-1066.144] (-1072.628) (-1069.642) (-1066.563) * (-1069.953) (-1067.890) (-1067.749) [-1069.490] -- 0:00:32
Average standard deviation of split frequencies: 0.009496
475500 -- [-1067.197] (-1067.837) (-1069.256) (-1069.952) * (-1070.701) (-1067.746) (-1067.592) [-1067.156] -- 0:00:31
476000 -- [-1068.011] (-1067.132) (-1067.912) (-1067.123) * (-1070.387) [-1067.475] (-1068.898) (-1069.604) -- 0:00:31
476500 -- (-1067.692) [-1067.210] (-1067.890) (-1069.426) * (-1067.592) (-1067.337) [-1066.573] (-1067.148) -- 0:00:31
477000 -- (-1066.598) (-1071.312) [-1068.059] (-1068.463) * [-1067.599] (-1067.251) (-1066.950) (-1072.215) -- 0:00:31
477500 -- [-1067.300] (-1066.762) (-1067.835) (-1067.160) * (-1067.179) [-1069.733] (-1067.383) (-1068.183) -- 0:00:31
478000 -- (-1067.261) (-1067.465) (-1067.453) [-1070.093] * (-1069.188) (-1070.833) (-1068.039) [-1066.478] -- 0:00:31
478500 -- (-1067.061) [-1069.686] (-1068.056) (-1071.329) * (-1068.660) (-1067.918) (-1067.622) [-1066.568] -- 0:00:31
479000 -- (-1067.326) (-1070.443) [-1068.142] (-1067.532) * (-1070.952) (-1066.887) [-1069.567] (-1067.786) -- 0:00:31
479500 -- (-1067.631) (-1067.195) [-1067.020] (-1067.671) * (-1069.538) [-1070.593] (-1067.268) (-1069.701) -- 0:00:31
480000 -- (-1066.837) (-1069.636) [-1068.588] (-1067.609) * (-1067.407) [-1066.762] (-1070.195) (-1067.121) -- 0:00:31
Average standard deviation of split frequencies: 0.009115
480500 -- (-1068.274) (-1069.686) (-1070.736) [-1067.268] * (-1067.583) [-1068.094] (-1069.619) (-1068.892) -- 0:00:31
481000 -- [-1066.839] (-1067.513) (-1070.351) (-1068.044) * (-1066.941) (-1067.547) (-1067.888) [-1068.058] -- 0:00:31
481500 -- [-1069.750] (-1068.286) (-1069.302) (-1067.061) * (-1068.547) (-1070.017) [-1068.311] (-1068.690) -- 0:00:31
482000 -- [-1067.697] (-1068.055) (-1069.142) (-1068.091) * (-1067.305) (-1071.919) [-1067.244] (-1066.907) -- 0:00:31
482500 -- [-1069.000] (-1069.846) (-1068.912) (-1066.693) * [-1067.631] (-1070.780) (-1067.617) (-1068.313) -- 0:00:31
483000 -- [-1070.643] (-1068.090) (-1069.365) (-1067.006) * (-1067.895) [-1069.049] (-1066.891) (-1068.924) -- 0:00:31
483500 -- [-1070.191] (-1070.089) (-1068.328) (-1069.678) * (-1067.949) (-1078.269) [-1069.942] (-1067.883) -- 0:00:32
484000 -- (-1067.790) [-1067.530] (-1066.890) (-1067.012) * (-1069.107) (-1069.936) (-1066.609) [-1066.372] -- 0:00:31
484500 -- [-1068.895] (-1069.167) (-1066.616) (-1067.329) * [-1067.688] (-1069.850) (-1069.319) (-1067.961) -- 0:00:31
485000 -- (-1069.567) (-1068.332) [-1066.886] (-1067.482) * (-1067.754) (-1066.608) [-1068.329] (-1068.861) -- 0:00:31
Average standard deviation of split frequencies: 0.009357
485500 -- (-1068.762) [-1068.512] (-1067.961) (-1069.421) * (-1067.094) (-1070.180) (-1070.263) [-1067.553] -- 0:00:31
486000 -- (-1068.106) (-1067.962) [-1066.047] (-1068.051) * (-1066.584) [-1073.490] (-1069.835) (-1068.854) -- 0:00:31
486500 -- (-1068.644) [-1067.961] (-1066.468) (-1071.209) * (-1067.594) (-1068.857) (-1072.756) [-1068.907] -- 0:00:31
487000 -- (-1069.152) (-1067.506) [-1067.868] (-1069.726) * (-1069.266) (-1068.395) [-1068.564] (-1067.113) -- 0:00:31
487500 -- (-1068.613) [-1068.044] (-1066.501) (-1068.732) * (-1068.413) [-1077.417] (-1071.695) (-1067.453) -- 0:00:31
488000 -- (-1069.643) (-1070.529) (-1066.616) [-1069.348] * (-1067.807) [-1070.640] (-1069.640) (-1067.110) -- 0:00:31
488500 -- [-1067.921] (-1067.720) (-1068.936) (-1070.275) * (-1071.291) (-1068.165) [-1068.481] (-1073.050) -- 0:00:31
489000 -- [-1068.574] (-1070.787) (-1069.610) (-1068.488) * (-1066.683) (-1066.961) (-1069.295) [-1067.638] -- 0:00:31
489500 -- [-1067.222] (-1068.127) (-1068.378) (-1067.233) * (-1067.102) [-1073.511] (-1071.454) (-1068.113) -- 0:00:31
490000 -- (-1067.191) (-1068.749) (-1067.373) [-1066.842] * [-1066.843] (-1072.708) (-1071.166) (-1069.296) -- 0:00:31
Average standard deviation of split frequencies: 0.009155
490500 -- (-1072.945) (-1071.454) (-1068.684) [-1067.986] * [-1066.904] (-1069.340) (-1070.907) (-1066.725) -- 0:00:31
491000 -- (-1067.875) (-1071.557) [-1066.667] (-1067.508) * (-1066.560) (-1073.230) [-1068.699] (-1072.314) -- 0:00:31
491500 -- (-1068.454) [-1069.679] (-1069.673) (-1068.051) * (-1068.568) [-1069.250] (-1069.020) (-1066.158) -- 0:00:31
492000 -- (-1068.036) (-1068.980) (-1072.942) [-1066.763] * (-1073.033) [-1066.916] (-1067.854) (-1067.918) -- 0:00:30
492500 -- (-1066.261) (-1070.262) [-1066.803] (-1068.252) * (-1066.967) (-1067.862) (-1066.770) [-1069.952] -- 0:00:30
493000 -- (-1069.281) (-1066.849) (-1069.869) [-1066.995] * (-1071.327) (-1068.007) [-1067.754] (-1067.507) -- 0:00:30
493500 -- (-1073.268) (-1066.463) (-1066.120) [-1069.017] * (-1071.893) [-1067.534] (-1070.907) (-1071.449) -- 0:00:30
494000 -- (-1068.907) (-1066.848) (-1066.829) [-1068.700] * (-1068.284) [-1067.754] (-1070.575) (-1067.474) -- 0:00:30
494500 -- [-1068.888] (-1067.780) (-1067.956) (-1066.643) * (-1068.580) [-1067.313] (-1068.729) (-1066.891) -- 0:00:30
495000 -- (-1070.835) (-1067.687) (-1068.704) [-1069.331] * (-1067.952) (-1068.828) (-1071.526) [-1067.554] -- 0:00:30
Average standard deviation of split frequencies: 0.008554
495500 -- (-1068.440) (-1068.470) (-1067.604) [-1067.885] * (-1067.722) (-1070.717) [-1070.497] (-1067.918) -- 0:00:30
496000 -- (-1067.031) [-1069.112] (-1070.174) (-1067.503) * (-1067.497) (-1071.572) [-1067.890] (-1071.472) -- 0:00:30
496500 -- (-1066.637) (-1068.877) (-1067.869) [-1068.281] * (-1068.672) (-1068.682) [-1069.947] (-1069.333) -- 0:00:30
497000 -- (-1069.536) (-1068.355) [-1067.010] (-1070.973) * (-1069.803) (-1068.850) (-1069.847) [-1071.161] -- 0:00:30
497500 -- [-1069.449] (-1070.528) (-1067.077) (-1070.270) * [-1066.222] (-1068.169) (-1067.290) (-1069.310) -- 0:00:30
498000 -- [-1069.205] (-1069.306) (-1067.507) (-1067.436) * [-1068.250] (-1068.244) (-1071.503) (-1070.601) -- 0:00:30
498500 -- [-1070.575] (-1075.291) (-1068.011) (-1070.025) * [-1067.192] (-1066.778) (-1070.475) (-1069.264) -- 0:00:30
499000 -- (-1068.970) [-1069.172] (-1069.282) (-1072.498) * (-1067.423) (-1067.152) [-1069.498] (-1072.858) -- 0:00:30
499500 -- (-1075.751) [-1069.118] (-1068.256) (-1069.138) * [-1067.286] (-1072.520) (-1069.816) (-1069.772) -- 0:00:30
500000 -- (-1067.476) (-1067.278) (-1067.441) [-1070.394] * [-1067.810] (-1067.556) (-1069.553) (-1067.467) -- 0:00:31
Average standard deviation of split frequencies: 0.009533
500500 -- (-1068.388) [-1067.945] (-1068.761) (-1067.952) * [-1067.159] (-1066.069) (-1067.009) (-1066.562) -- 0:00:30
501000 -- (-1070.963) (-1070.486) [-1067.848] (-1068.279) * [-1068.741] (-1068.717) (-1067.085) (-1067.202) -- 0:00:30
501500 -- [-1067.838] (-1069.238) (-1068.494) (-1077.638) * [-1066.494] (-1068.685) (-1067.693) (-1069.264) -- 0:00:30
502000 -- [-1069.696] (-1071.869) (-1069.707) (-1067.150) * (-1067.004) [-1068.793] (-1070.922) (-1068.906) -- 0:00:30
502500 -- (-1071.723) (-1070.973) [-1067.056] (-1067.477) * (-1066.927) (-1071.885) (-1070.783) [-1068.223] -- 0:00:30
503000 -- (-1069.929) [-1071.058] (-1066.798) (-1067.222) * [-1067.629] (-1069.599) (-1069.083) (-1071.356) -- 0:00:30
503500 -- (-1068.965) (-1069.154) (-1068.954) [-1071.732] * (-1072.234) [-1072.528] (-1069.975) (-1073.157) -- 0:00:30
504000 -- [-1069.448] (-1067.104) (-1068.980) (-1070.579) * (-1068.462) [-1070.027] (-1067.452) (-1068.242) -- 0:00:30
504500 -- [-1067.076] (-1067.042) (-1069.513) (-1068.274) * [-1066.428] (-1067.456) (-1067.036) (-1072.916) -- 0:00:30
505000 -- [-1068.675] (-1068.211) (-1069.119) (-1067.539) * (-1072.099) (-1069.240) [-1067.176] (-1068.434) -- 0:00:30
Average standard deviation of split frequencies: 0.008933
505500 -- [-1066.690] (-1068.236) (-1068.899) (-1069.592) * (-1066.730) [-1067.310] (-1066.435) (-1070.269) -- 0:00:30
506000 -- (-1076.115) [-1067.551] (-1067.970) (-1067.619) * (-1072.700) [-1066.321] (-1068.026) (-1071.519) -- 0:00:30
506500 -- [-1070.004] (-1067.814) (-1067.043) (-1070.924) * (-1070.293) (-1067.421) (-1071.777) [-1070.525] -- 0:00:30
507000 -- [-1070.869] (-1067.895) (-1067.607) (-1068.779) * (-1069.297) [-1066.894] (-1069.641) (-1068.521) -- 0:00:30
507500 -- (-1066.888) (-1066.774) (-1068.414) [-1066.969] * (-1068.330) (-1066.299) (-1068.661) [-1067.660] -- 0:00:30
508000 -- (-1067.112) (-1069.324) (-1069.449) [-1068.854] * (-1067.535) [-1067.053] (-1069.364) (-1068.811) -- 0:00:30
508500 -- (-1068.079) (-1069.651) (-1069.119) [-1067.007] * [-1067.895] (-1066.835) (-1069.084) (-1069.346) -- 0:00:29
509000 -- [-1066.260] (-1069.606) (-1066.978) (-1067.009) * [-1068.190] (-1069.035) (-1068.295) (-1071.120) -- 0:00:29
509500 -- [-1068.699] (-1066.116) (-1066.255) (-1067.233) * (-1067.348) [-1069.038] (-1067.762) (-1068.017) -- 0:00:29
510000 -- (-1071.155) (-1068.998) [-1066.073] (-1069.799) * (-1069.711) (-1067.191) [-1066.267] (-1068.813) -- 0:00:29
Average standard deviation of split frequencies: 0.009462
510500 -- [-1067.202] (-1068.994) (-1067.422) (-1066.324) * (-1066.688) [-1069.356] (-1068.744) (-1069.467) -- 0:00:29
511000 -- [-1069.544] (-1068.157) (-1067.957) (-1069.886) * (-1068.074) [-1067.957] (-1070.280) (-1069.688) -- 0:00:29
511500 -- (-1071.192) [-1068.210] (-1066.958) (-1067.504) * (-1067.791) (-1068.654) [-1069.600] (-1069.231) -- 0:00:29
512000 -- (-1067.833) (-1068.578) [-1067.163] (-1067.927) * (-1067.007) (-1066.787) [-1068.167] (-1066.704) -- 0:00:29
512500 -- [-1068.147] (-1069.984) (-1068.166) (-1067.115) * (-1069.309) (-1070.213) (-1067.518) [-1066.124] -- 0:00:29
513000 -- (-1069.130) (-1068.604) [-1068.321] (-1068.268) * (-1067.859) (-1071.938) [-1067.379] (-1068.551) -- 0:00:29
513500 -- (-1067.885) [-1067.982] (-1069.353) (-1068.377) * [-1069.266] (-1070.629) (-1070.182) (-1068.367) -- 0:00:29
514000 -- (-1069.080) (-1068.257) [-1067.560] (-1067.416) * (-1068.528) [-1067.340] (-1068.399) (-1069.989) -- 0:00:29
514500 -- (-1069.282) (-1068.320) [-1068.225] (-1067.574) * [-1068.113] (-1069.666) (-1073.177) (-1070.218) -- 0:00:29
515000 -- (-1068.440) [-1067.877] (-1067.561) (-1069.480) * [-1067.902] (-1070.126) (-1070.844) (-1070.218) -- 0:00:29
Average standard deviation of split frequencies: 0.009673
515500 -- (-1068.747) [-1066.903] (-1068.642) (-1067.675) * (-1067.334) (-1068.049) [-1068.026] (-1071.268) -- 0:00:30
516000 -- (-1067.319) [-1066.655] (-1070.037) (-1069.579) * (-1067.128) (-1069.372) (-1072.807) [-1070.193] -- 0:00:30
516500 -- [-1066.985] (-1066.323) (-1075.758) (-1069.189) * (-1068.748) [-1069.226] (-1067.143) (-1066.437) -- 0:00:29
517000 -- (-1069.313) (-1069.810) [-1071.367] (-1069.171) * (-1067.248) (-1071.191) [-1068.692] (-1066.728) -- 0:00:29
517500 -- (-1073.092) (-1066.133) (-1073.020) [-1068.708] * (-1067.011) (-1069.785) (-1072.889) [-1068.537] -- 0:00:29
518000 -- (-1067.320) (-1067.228) (-1074.100) [-1067.132] * (-1067.856) (-1070.148) (-1072.450) [-1066.574] -- 0:00:29
518500 -- [-1066.633] (-1067.763) (-1068.756) (-1071.854) * (-1072.234) (-1066.571) [-1069.671] (-1067.678) -- 0:00:29
519000 -- (-1067.204) (-1069.176) [-1069.163] (-1071.187) * (-1072.485) (-1067.126) [-1069.610] (-1066.595) -- 0:00:29
519500 -- (-1067.150) (-1067.494) (-1068.917) [-1069.951] * (-1074.523) [-1067.526] (-1068.822) (-1067.779) -- 0:00:29
520000 -- [-1067.702] (-1069.095) (-1068.641) (-1071.265) * [-1068.308] (-1070.187) (-1068.172) (-1068.937) -- 0:00:29
Average standard deviation of split frequencies: 0.008658
520500 -- (-1066.140) (-1066.433) (-1069.330) [-1069.757] * [-1068.602] (-1068.096) (-1069.276) (-1068.954) -- 0:00:29
521000 -- [-1068.802] (-1072.200) (-1071.538) (-1070.040) * [-1068.019] (-1069.404) (-1067.980) (-1067.653) -- 0:00:29
521500 -- (-1068.036) (-1067.872) (-1070.243) [-1067.706] * [-1069.455] (-1069.378) (-1071.091) (-1068.392) -- 0:00:29
522000 -- (-1069.318) (-1066.818) [-1068.258] (-1071.975) * [-1068.325] (-1068.457) (-1068.809) (-1067.857) -- 0:00:29
522500 -- (-1068.245) [-1066.538] (-1068.889) (-1068.177) * [-1068.038] (-1069.928) (-1070.404) (-1066.440) -- 0:00:29
523000 -- (-1067.947) (-1066.802) (-1068.082) [-1069.758] * (-1070.025) [-1069.736] (-1069.367) (-1067.480) -- 0:00:29
523500 -- (-1069.297) (-1067.280) [-1067.728] (-1071.014) * [-1070.644] (-1067.704) (-1071.067) (-1069.913) -- 0:00:29
524000 -- (-1067.178) (-1066.240) (-1066.518) [-1067.453] * (-1068.491) (-1067.041) [-1071.504] (-1068.005) -- 0:00:29
524500 -- (-1066.573) (-1067.801) (-1067.960) [-1072.506] * (-1066.828) (-1072.867) (-1069.129) [-1066.932] -- 0:00:29
525000 -- (-1067.221) [-1067.033] (-1068.621) (-1075.093) * (-1070.446) [-1067.346] (-1067.211) (-1068.419) -- 0:00:28
Average standard deviation of split frequencies: 0.008626
525500 -- (-1070.752) (-1067.381) (-1068.016) [-1066.484] * (-1068.817) [-1069.988] (-1068.320) (-1070.147) -- 0:00:28
526000 -- (-1069.268) (-1067.605) (-1067.235) [-1067.221] * [-1067.938] (-1069.445) (-1070.541) (-1073.888) -- 0:00:28
526500 -- (-1067.762) (-1067.439) (-1069.405) [-1070.682] * (-1071.653) (-1069.430) (-1070.826) [-1068.417] -- 0:00:28
527000 -- [-1069.877] (-1068.788) (-1066.263) (-1068.538) * (-1071.693) (-1069.590) [-1071.114] (-1068.885) -- 0:00:28
527500 -- (-1068.758) (-1069.300) [-1066.231] (-1067.127) * [-1068.330] (-1069.722) (-1068.488) (-1069.665) -- 0:00:28
528000 -- (-1071.039) [-1066.934] (-1069.360) (-1067.952) * (-1067.394) [-1066.137] (-1067.430) (-1069.447) -- 0:00:28
528500 -- [-1066.407] (-1068.350) (-1067.669) (-1067.101) * (-1066.206) (-1067.127) [-1068.411] (-1067.161) -- 0:00:28
529000 -- (-1067.583) (-1067.742) (-1068.120) [-1067.818] * [-1068.093] (-1069.138) (-1071.368) (-1067.530) -- 0:00:28
529500 -- (-1067.446) (-1067.621) [-1067.118] (-1067.741) * (-1066.687) [-1068.314] (-1067.162) (-1068.646) -- 0:00:28
530000 -- (-1067.500) (-1066.412) (-1069.269) [-1069.832] * (-1068.600) (-1069.247) [-1068.143] (-1072.241) -- 0:00:28
Average standard deviation of split frequencies: 0.008161
530500 -- [-1069.100] (-1067.081) (-1066.056) (-1069.349) * (-1068.951) [-1067.480] (-1069.313) (-1071.718) -- 0:00:28
531000 -- (-1070.123) (-1070.967) (-1069.854) [-1068.931] * (-1072.283) (-1068.624) (-1069.526) [-1067.656] -- 0:00:28
531500 -- (-1072.735) (-1075.301) [-1067.410] (-1069.817) * (-1066.119) (-1068.244) (-1068.098) [-1067.430] -- 0:00:28
532000 -- [-1069.071] (-1074.655) (-1067.785) (-1068.423) * (-1067.031) (-1067.785) (-1068.381) [-1067.440] -- 0:00:29
532500 -- [-1070.866] (-1070.390) (-1073.534) (-1067.359) * (-1067.933) (-1068.257) (-1067.811) [-1067.386] -- 0:00:28
533000 -- (-1070.750) [-1068.435] (-1068.263) (-1067.197) * (-1066.902) (-1067.023) (-1068.566) [-1066.288] -- 0:00:28
533500 -- (-1067.343) [-1066.885] (-1067.435) (-1069.672) * [-1066.425] (-1068.545) (-1069.158) (-1066.304) -- 0:00:28
534000 -- (-1070.112) [-1066.728] (-1071.770) (-1070.164) * (-1070.167) (-1067.544) [-1068.369] (-1066.358) -- 0:00:28
534500 -- (-1067.221) (-1068.892) (-1069.127) [-1067.115] * (-1068.435) (-1070.558) (-1073.389) [-1068.605] -- 0:00:28
535000 -- (-1066.698) [-1070.551] (-1068.525) (-1074.116) * [-1070.505] (-1070.804) (-1067.528) (-1070.129) -- 0:00:28
Average standard deviation of split frequencies: 0.008033
535500 -- (-1067.841) (-1070.392) (-1069.446) [-1069.465] * (-1067.346) (-1068.208) (-1066.996) [-1069.190] -- 0:00:28
536000 -- (-1067.033) (-1071.904) (-1067.917) [-1067.712] * (-1069.132) (-1069.272) (-1066.740) [-1070.188] -- 0:00:28
536500 -- (-1066.871) [-1072.569] (-1068.001) (-1067.250) * (-1067.167) (-1066.885) (-1066.810) [-1066.617] -- 0:00:28
537000 -- (-1068.421) (-1067.875) (-1067.888) [-1066.425] * (-1069.647) [-1069.353] (-1068.531) (-1067.739) -- 0:00:28
537500 -- (-1067.970) [-1066.371] (-1070.048) (-1066.398) * (-1066.967) (-1071.009) [-1069.078] (-1068.021) -- 0:00:28
538000 -- (-1067.505) (-1067.157) (-1067.831) [-1066.037] * [-1069.126] (-1069.055) (-1069.228) (-1071.725) -- 0:00:28
538500 -- [-1068.201] (-1066.991) (-1071.557) (-1067.788) * (-1069.664) (-1069.093) (-1066.221) [-1066.474] -- 0:00:28
539000 -- (-1067.575) (-1066.490) (-1067.384) [-1066.197] * (-1067.839) (-1068.682) [-1066.975] (-1066.423) -- 0:00:28
539500 -- (-1070.845) (-1066.543) [-1069.880] (-1067.653) * (-1067.846) (-1074.190) [-1067.744] (-1067.915) -- 0:00:28
540000 -- (-1072.477) (-1071.659) (-1069.524) [-1066.820] * [-1067.161] (-1071.923) (-1067.042) (-1067.981) -- 0:00:28
Average standard deviation of split frequencies: 0.008446
540500 -- (-1071.589) [-1068.168] (-1066.809) (-1070.926) * (-1067.821) (-1069.238) (-1068.285) [-1068.643] -- 0:00:28
541000 -- (-1068.628) (-1066.457) [-1067.267] (-1068.394) * (-1066.844) (-1066.576) [-1067.424] (-1067.395) -- 0:00:27
541500 -- (-1066.994) (-1066.493) [-1066.696] (-1067.129) * (-1067.024) [-1067.032] (-1071.464) (-1073.205) -- 0:00:27
542000 -- (-1067.926) (-1069.820) (-1072.748) [-1066.714] * (-1067.310) (-1069.195) (-1073.615) [-1073.736] -- 0:00:27
542500 -- (-1067.851) (-1067.620) [-1068.847] (-1067.295) * [-1068.428] (-1066.930) (-1070.175) (-1070.790) -- 0:00:27
543000 -- (-1068.465) (-1067.925) [-1067.389] (-1072.249) * (-1068.173) [-1068.239] (-1069.074) (-1068.052) -- 0:00:27
543500 -- (-1068.577) (-1070.387) [-1075.229] (-1070.552) * (-1069.361) (-1068.451) (-1071.113) [-1069.710] -- 0:00:27
544000 -- [-1072.191] (-1067.984) (-1072.340) (-1068.931) * (-1071.526) [-1068.403] (-1069.032) (-1068.049) -- 0:00:27
544500 -- (-1070.256) (-1071.251) [-1067.569] (-1067.536) * (-1068.708) (-1069.167) [-1068.734] (-1068.026) -- 0:00:27
545000 -- [-1070.559] (-1068.886) (-1066.484) (-1069.345) * [-1066.191] (-1067.771) (-1066.689) (-1067.743) -- 0:00:27
Average standard deviation of split frequencies: 0.008329
545500 -- (-1072.919) (-1067.149) (-1068.263) [-1070.522] * [-1068.207] (-1070.832) (-1066.763) (-1074.110) -- 0:00:27
546000 -- (-1071.758) [-1072.283] (-1066.694) (-1068.775) * (-1072.009) (-1069.255) (-1066.218) [-1072.682] -- 0:00:27
546500 -- [-1067.143] (-1072.291) (-1068.641) (-1069.496) * (-1069.702) [-1069.657] (-1066.050) (-1072.077) -- 0:00:27
547000 -- (-1066.611) (-1073.090) (-1073.150) [-1068.339] * (-1068.305) (-1069.295) (-1068.527) [-1066.081] -- 0:00:27
547500 -- (-1068.016) (-1074.621) (-1068.908) [-1066.547] * (-1069.801) (-1072.139) [-1065.984] (-1069.029) -- 0:00:27
548000 -- (-1067.840) [-1072.262] (-1066.214) (-1071.281) * (-1073.996) [-1070.710] (-1066.928) (-1067.167) -- 0:00:28
548500 -- (-1068.475) (-1070.303) [-1067.704] (-1068.751) * (-1068.954) [-1067.654] (-1068.553) (-1070.337) -- 0:00:27
549000 -- (-1071.633) (-1069.314) (-1069.270) [-1068.463] * (-1070.260) (-1067.032) [-1068.843] (-1070.183) -- 0:00:27
549500 -- (-1066.465) [-1070.424] (-1067.854) (-1069.357) * [-1072.259] (-1073.048) (-1066.679) (-1068.411) -- 0:00:27
550000 -- (-1066.798) [-1071.498] (-1067.120) (-1067.341) * (-1070.556) (-1067.927) [-1069.275] (-1066.782) -- 0:00:27
Average standard deviation of split frequencies: 0.007972
550500 -- (-1066.930) (-1070.661) [-1066.664] (-1069.683) * (-1072.179) (-1066.636) [-1069.136] (-1069.406) -- 0:00:27
551000 -- (-1071.055) (-1070.327) [-1066.101] (-1071.405) * (-1066.799) [-1069.031] (-1070.919) (-1069.669) -- 0:00:27
551500 -- (-1066.631) (-1067.334) [-1066.871] (-1069.653) * (-1067.285) (-1067.589) [-1068.606] (-1067.539) -- 0:00:27
552000 -- (-1067.439) (-1067.548) (-1069.474) [-1068.027] * (-1067.279) (-1069.244) (-1069.788) [-1068.499] -- 0:00:27
552500 -- (-1066.758) (-1070.574) [-1067.996] (-1070.773) * (-1067.815) (-1071.229) [-1067.410] (-1067.965) -- 0:00:27
553000 -- (-1067.336) (-1069.181) [-1068.100] (-1072.084) * (-1067.663) [-1067.687] (-1070.181) (-1070.224) -- 0:00:27
553500 -- (-1069.346) (-1071.948) (-1069.543) [-1072.293] * (-1067.416) [-1066.823] (-1070.447) (-1067.066) -- 0:00:27
554000 -- (-1066.356) (-1071.593) [-1068.256] (-1069.394) * (-1070.944) [-1067.983] (-1070.905) (-1066.701) -- 0:00:27
554500 -- (-1070.572) (-1068.925) [-1072.794] (-1066.846) * (-1070.660) (-1067.910) [-1068.177] (-1067.501) -- 0:00:27
555000 -- (-1066.624) (-1067.804) [-1069.858] (-1070.323) * (-1071.316) (-1067.831) [-1067.458] (-1066.649) -- 0:00:27
Average standard deviation of split frequencies: 0.008055
555500 -- (-1067.166) (-1071.886) [-1070.836] (-1068.803) * (-1067.282) [-1068.680] (-1069.278) (-1069.612) -- 0:00:27
556000 -- (-1067.062) (-1071.535) (-1067.558) [-1066.787] * [-1070.130] (-1070.755) (-1067.048) (-1068.064) -- 0:00:27
556500 -- [-1066.504] (-1068.375) (-1068.196) (-1068.252) * (-1067.996) [-1069.596] (-1068.567) (-1068.181) -- 0:00:27
557000 -- (-1067.667) (-1068.986) (-1068.160) [-1066.753] * (-1067.145) (-1069.939) (-1066.996) [-1068.486] -- 0:00:27
557500 -- (-1067.128) [-1066.943] (-1066.394) (-1070.258) * (-1067.695) [-1072.235] (-1069.037) (-1069.100) -- 0:00:26
558000 -- (-1067.253) [-1069.073] (-1068.963) (-1068.757) * (-1066.791) (-1070.860) (-1068.177) [-1070.595] -- 0:00:26
558500 -- (-1067.479) (-1067.973) [-1066.417] (-1069.164) * (-1069.224) [-1068.025] (-1068.188) (-1067.741) -- 0:00:26
559000 -- (-1068.657) (-1070.042) [-1066.982] (-1067.956) * (-1068.044) (-1067.339) [-1068.351] (-1069.496) -- 0:00:26
559500 -- [-1066.302] (-1070.872) (-1069.068) (-1068.152) * (-1068.836) [-1066.677] (-1067.884) (-1067.140) -- 0:00:26
560000 -- (-1067.064) [-1070.101] (-1069.689) (-1066.458) * (-1068.583) (-1066.921) [-1067.193] (-1068.515) -- 0:00:26
Average standard deviation of split frequencies: 0.007409
560500 -- (-1066.822) (-1067.876) [-1067.455] (-1068.900) * (-1072.025) [-1066.331] (-1066.911) (-1068.748) -- 0:00:26
561000 -- (-1066.738) [-1067.688] (-1066.448) (-1068.599) * (-1071.237) (-1072.677) (-1070.818) [-1068.776] -- 0:00:26
561500 -- [-1067.453] (-1070.479) (-1068.100) (-1069.008) * (-1070.210) (-1069.105) [-1069.506] (-1066.539) -- 0:00:26
562000 -- (-1067.103) (-1069.011) [-1070.402] (-1071.751) * (-1068.727) (-1067.594) [-1073.317] (-1070.165) -- 0:00:26
562500 -- (-1067.173) [-1066.657] (-1071.937) (-1071.456) * (-1074.574) (-1068.098) [-1068.905] (-1069.378) -- 0:00:26
563000 -- [-1067.350] (-1067.678) (-1072.855) (-1067.266) * [-1067.374] (-1068.528) (-1068.806) (-1069.538) -- 0:00:26
563500 -- (-1066.829) [-1067.257] (-1069.466) (-1071.066) * (-1067.660) (-1072.752) (-1069.658) [-1066.549] -- 0:00:26
564000 -- (-1070.815) (-1067.859) [-1068.962] (-1066.282) * [-1068.327] (-1069.513) (-1071.901) (-1066.603) -- 0:00:27
564500 -- (-1071.084) (-1070.052) (-1070.180) [-1068.425] * [-1067.142] (-1069.075) (-1071.374) (-1066.603) -- 0:00:27
565000 -- (-1066.569) [-1068.808] (-1069.095) (-1071.369) * (-1071.920) [-1069.172] (-1068.675) (-1066.564) -- 0:00:26
Average standard deviation of split frequencies: 0.007027
565500 -- (-1068.495) (-1068.480) (-1066.964) [-1068.909] * (-1070.936) (-1069.209) (-1069.171) [-1066.733] -- 0:00:26
566000 -- (-1068.524) [-1070.921] (-1068.621) (-1068.984) * (-1067.164) (-1066.781) [-1067.232] (-1066.450) -- 0:00:26
566500 -- (-1067.481) (-1068.170) (-1068.324) [-1070.000] * (-1067.064) (-1067.412) (-1067.932) [-1066.207] -- 0:00:26
567000 -- (-1066.694) (-1068.288) (-1068.977) [-1066.940] * (-1067.681) (-1067.498) (-1068.828) [-1067.791] -- 0:00:26
567500 -- [-1067.114] (-1066.369) (-1067.499) (-1070.761) * (-1067.069) (-1070.096) [-1069.320] (-1067.640) -- 0:00:26
568000 -- [-1068.751] (-1066.394) (-1068.223) (-1067.298) * (-1066.380) (-1069.125) [-1067.847] (-1068.517) -- 0:00:26
568500 -- (-1069.479) (-1067.997) [-1068.464] (-1068.562) * (-1066.906) (-1066.357) [-1068.098] (-1069.054) -- 0:00:26
569000 -- (-1070.029) (-1067.001) [-1071.350] (-1068.330) * (-1067.406) [-1065.975] (-1068.580) (-1070.100) -- 0:00:26
569500 -- (-1066.994) [-1066.227] (-1068.251) (-1068.948) * (-1067.355) (-1067.969) (-1069.513) [-1066.342] -- 0:00:26
570000 -- (-1069.330) [-1068.167] (-1069.006) (-1068.292) * [-1067.334] (-1069.492) (-1066.282) (-1067.151) -- 0:00:26
Average standard deviation of split frequencies: 0.006867
570500 -- (-1068.882) [-1066.885] (-1068.346) (-1071.495) * (-1068.028) (-1067.957) [-1066.757] (-1066.668) -- 0:00:26
571000 -- (-1068.861) [-1066.041] (-1073.005) (-1068.048) * (-1068.123) (-1067.808) (-1068.256) [-1069.179] -- 0:00:26
571500 -- (-1069.862) (-1066.259) (-1066.155) [-1070.481] * [-1068.168] (-1068.148) (-1069.349) (-1069.763) -- 0:00:26
572000 -- [-1070.376] (-1066.505) (-1069.789) (-1067.237) * (-1066.954) [-1070.257] (-1067.497) (-1067.681) -- 0:00:26
572500 -- (-1068.701) (-1070.310) (-1068.213) [-1067.865] * (-1070.694) (-1068.461) [-1066.491] (-1067.885) -- 0:00:26
573000 -- (-1067.683) (-1068.274) [-1068.152] (-1067.179) * (-1071.626) [-1068.679] (-1066.708) (-1067.243) -- 0:00:26
573500 -- (-1069.623) [-1067.045] (-1068.998) (-1067.730) * (-1067.669) (-1070.964) (-1066.736) [-1067.490] -- 0:00:26
574000 -- (-1068.329) [-1067.038] (-1066.556) (-1078.284) * (-1068.068) [-1068.848] (-1070.590) (-1066.549) -- 0:00:25
574500 -- (-1068.589) [-1066.612] (-1069.749) (-1074.667) * (-1069.200) [-1066.795] (-1068.217) (-1067.231) -- 0:00:25
575000 -- (-1071.066) [-1067.233] (-1068.397) (-1069.616) * (-1066.805) [-1066.225] (-1072.329) (-1072.949) -- 0:00:25
Average standard deviation of split frequencies: 0.007417
575500 -- (-1070.193) [-1066.198] (-1067.340) (-1068.976) * (-1068.970) [-1066.276] (-1068.082) (-1068.042) -- 0:00:25
576000 -- (-1070.417) (-1070.123) (-1067.214) [-1066.858] * (-1067.919) (-1066.244) (-1072.249) [-1068.556] -- 0:00:25
576500 -- (-1070.389) [-1068.104] (-1068.232) (-1071.962) * (-1069.719) [-1066.937] (-1067.150) (-1069.145) -- 0:00:25
577000 -- (-1072.815) [-1069.894] (-1068.073) (-1071.047) * (-1067.656) [-1067.872] (-1067.654) (-1068.326) -- 0:00:25
577500 -- [-1071.671] (-1068.210) (-1067.583) (-1067.850) * (-1067.706) [-1067.031] (-1069.586) (-1067.923) -- 0:00:25
578000 -- (-1068.374) [-1067.727] (-1068.101) (-1067.458) * (-1068.693) [-1067.243] (-1067.092) (-1072.113) -- 0:00:25
578500 -- (-1068.473) (-1069.789) (-1071.114) [-1071.445] * (-1067.133) [-1066.196] (-1068.771) (-1070.412) -- 0:00:25
579000 -- (-1070.989) [-1068.723] (-1068.351) (-1068.157) * (-1067.354) (-1069.396) [-1066.511] (-1070.197) -- 0:00:25
579500 -- (-1067.261) (-1066.555) [-1069.448] (-1070.548) * (-1070.951) (-1067.751) [-1066.717] (-1067.334) -- 0:00:25
580000 -- (-1071.373) (-1068.895) (-1069.674) [-1070.432] * (-1067.280) (-1067.281) (-1066.560) [-1066.860] -- 0:00:25
Average standard deviation of split frequencies: 0.007306
580500 -- (-1067.235) [-1067.358] (-1070.390) (-1072.163) * (-1070.692) [-1068.118] (-1066.614) (-1069.986) -- 0:00:26
581000 -- (-1066.664) (-1069.160) (-1069.772) [-1067.589] * (-1070.160) (-1068.759) (-1072.368) [-1069.783] -- 0:00:25
581500 -- [-1067.718] (-1070.801) (-1067.761) (-1067.589) * (-1067.282) (-1067.546) [-1067.817] (-1068.948) -- 0:00:25
582000 -- (-1069.615) (-1070.099) (-1067.231) [-1067.882] * (-1067.616) [-1069.288] (-1070.656) (-1069.928) -- 0:00:25
582500 -- (-1067.707) (-1072.368) (-1066.762) [-1067.813] * (-1067.260) (-1070.192) [-1066.862] (-1066.885) -- 0:00:25
583000 -- [-1070.681] (-1066.231) (-1066.982) (-1068.530) * (-1069.494) (-1077.514) (-1068.333) [-1066.715] -- 0:00:25
583500 -- [-1071.516] (-1068.979) (-1069.947) (-1068.040) * (-1074.640) (-1071.917) (-1069.442) [-1066.528] -- 0:00:25
584000 -- (-1067.292) [-1068.597] (-1068.263) (-1067.033) * (-1070.619) (-1072.219) [-1066.394] (-1067.347) -- 0:00:25
584500 -- (-1070.473) (-1066.408) (-1068.817) [-1066.726] * (-1072.443) [-1068.268] (-1070.312) (-1070.963) -- 0:00:25
585000 -- [-1066.618] (-1066.156) (-1070.620) (-1067.960) * (-1071.224) (-1067.085) (-1068.000) [-1066.736] -- 0:00:25
Average standard deviation of split frequencies: 0.007391
585500 -- [-1065.962] (-1066.689) (-1067.963) (-1067.241) * (-1075.537) [-1069.874] (-1069.113) (-1071.197) -- 0:00:25
586000 -- [-1072.193] (-1069.229) (-1070.069) (-1068.439) * (-1071.298) [-1068.257] (-1069.273) (-1067.889) -- 0:00:25
586500 -- (-1069.712) (-1070.734) [-1072.386] (-1069.514) * [-1068.131] (-1067.743) (-1068.467) (-1068.536) -- 0:00:25
587000 -- (-1069.085) (-1069.790) [-1065.905] (-1069.840) * (-1068.845) [-1068.246] (-1069.356) (-1069.579) -- 0:00:25
587500 -- (-1066.473) (-1068.062) [-1065.966] (-1069.802) * [-1067.263] (-1070.703) (-1068.008) (-1067.159) -- 0:00:25
588000 -- [-1066.888] (-1073.355) (-1068.399) (-1069.822) * (-1069.288) (-1067.079) (-1068.407) [-1070.253] -- 0:00:25
588500 -- (-1067.973) [-1069.557] (-1066.793) (-1066.828) * (-1068.764) (-1069.367) (-1066.304) [-1068.622] -- 0:00:25
589000 -- (-1068.489) (-1069.671) (-1069.087) [-1066.947] * [-1066.675] (-1069.818) (-1066.005) (-1068.644) -- 0:00:25
589500 -- (-1072.986) [-1068.332] (-1068.729) (-1066.952) * (-1069.619) (-1071.228) (-1068.783) [-1067.460] -- 0:00:25
590000 -- (-1068.335) (-1072.287) [-1069.322] (-1067.908) * [-1066.963] (-1071.195) (-1069.322) (-1068.930) -- 0:00:25
Average standard deviation of split frequencies: 0.006634
590500 -- (-1072.185) [-1069.038] (-1071.747) (-1071.473) * (-1066.725) (-1067.747) [-1069.200] (-1068.096) -- 0:00:24
591000 -- (-1067.512) [-1067.154] (-1069.435) (-1068.379) * (-1070.370) [-1070.033] (-1067.941) (-1071.156) -- 0:00:24
591500 -- (-1069.131) [-1067.127] (-1068.522) (-1067.506) * (-1067.175) (-1070.309) [-1066.775] (-1070.582) -- 0:00:24
592000 -- (-1068.679) (-1072.829) [-1073.163] (-1067.508) * [-1072.500] (-1068.740) (-1066.562) (-1069.227) -- 0:00:24
592500 -- (-1068.572) [-1068.944] (-1068.501) (-1068.435) * [-1066.941] (-1069.373) (-1066.979) (-1069.194) -- 0:00:24
593000 -- (-1070.954) (-1070.057) [-1067.133] (-1067.535) * [-1068.512] (-1067.560) (-1067.156) (-1069.949) -- 0:00:24
593500 -- (-1069.143) [-1067.657] (-1067.072) (-1066.117) * (-1068.870) (-1067.715) [-1068.725] (-1067.040) -- 0:00:24
594000 -- (-1067.886) (-1069.383) (-1067.109) [-1069.723] * (-1068.246) (-1070.237) (-1069.212) [-1067.908] -- 0:00:24
594500 -- (-1067.435) (-1068.119) (-1067.267) [-1068.301] * (-1069.641) [-1066.687] (-1066.772) (-1069.479) -- 0:00:24
595000 -- (-1067.659) [-1068.346] (-1072.171) (-1067.554) * (-1066.562) [-1066.660] (-1067.431) (-1070.807) -- 0:00:24
Average standard deviation of split frequencies: 0.006377
595500 -- (-1068.085) (-1070.995) (-1067.889) [-1069.449] * (-1066.458) (-1073.239) (-1068.396) [-1068.674] -- 0:00:24
596000 -- (-1068.439) [-1068.695] (-1067.072) (-1069.485) * (-1068.216) (-1069.407) (-1071.176) [-1068.891] -- 0:00:24
596500 -- [-1066.517] (-1071.888) (-1068.897) (-1067.022) * (-1069.587) [-1070.050] (-1070.250) (-1070.278) -- 0:00:25
597000 -- (-1067.589) [-1069.315] (-1068.379) (-1068.128) * [-1068.489] (-1070.136) (-1069.985) (-1070.634) -- 0:00:24
597500 -- (-1066.428) [-1067.145] (-1070.492) (-1069.100) * (-1068.893) [-1071.511] (-1069.363) (-1070.371) -- 0:00:24
598000 -- (-1066.375) [-1067.919] (-1070.989) (-1069.468) * (-1066.459) [-1067.685] (-1069.769) (-1069.313) -- 0:00:24
598500 -- (-1067.226) (-1066.681) (-1066.121) [-1068.802] * (-1067.481) (-1068.646) [-1067.340] (-1070.109) -- 0:00:24
599000 -- (-1069.702) (-1068.427) (-1066.375) [-1067.369] * (-1068.951) (-1066.774) [-1068.944] (-1070.354) -- 0:00:24
599500 -- (-1070.961) (-1069.244) (-1066.363) [-1067.581] * [-1067.979] (-1066.561) (-1069.228) (-1068.161) -- 0:00:24
600000 -- [-1067.935] (-1068.140) (-1067.621) (-1068.662) * (-1071.875) [-1066.563] (-1073.304) (-1068.999) -- 0:00:24
Average standard deviation of split frequencies: 0.006573
600500 -- (-1067.499) [-1068.693] (-1066.085) (-1067.599) * (-1067.346) [-1066.088] (-1067.723) (-1068.640) -- 0:00:24
601000 -- (-1068.867) [-1071.470] (-1069.240) (-1067.733) * (-1071.904) (-1068.026) [-1071.594] (-1069.502) -- 0:00:24
601500 -- (-1069.825) [-1068.480] (-1067.776) (-1066.677) * (-1066.902) (-1067.502) (-1070.108) [-1066.978] -- 0:00:24
602000 -- (-1069.044) (-1071.727) (-1068.462) [-1067.703] * (-1068.205) (-1069.012) [-1067.827] (-1070.799) -- 0:00:24
602500 -- (-1068.259) (-1068.491) (-1067.613) [-1068.840] * (-1066.678) (-1069.584) (-1067.398) [-1067.047] -- 0:00:24
603000 -- (-1066.762) (-1069.119) (-1068.509) [-1069.439] * (-1067.029) [-1067.561] (-1068.888) (-1068.104) -- 0:00:24
603500 -- (-1073.516) (-1069.320) [-1067.501] (-1066.738) * (-1067.733) (-1067.521) [-1068.340] (-1069.873) -- 0:00:24
604000 -- [-1067.702] (-1067.911) (-1066.489) (-1067.041) * (-1068.892) (-1067.470) [-1068.275] (-1068.552) -- 0:00:24
604500 -- (-1071.326) (-1067.989) (-1066.672) [-1069.316] * (-1067.768) (-1068.573) [-1068.229] (-1069.688) -- 0:00:24
605000 -- (-1069.967) (-1066.349) (-1069.249) [-1072.199] * (-1067.760) (-1066.595) (-1071.725) [-1066.852] -- 0:00:24
Average standard deviation of split frequencies: 0.006515
605500 -- (-1068.296) (-1067.928) (-1073.419) [-1070.461] * (-1067.400) [-1066.587] (-1076.166) (-1067.733) -- 0:00:24
606000 -- [-1069.566] (-1072.035) (-1067.847) (-1069.800) * (-1071.441) (-1067.160) (-1069.985) [-1066.282] -- 0:00:24
606500 -- (-1068.796) (-1071.917) (-1072.937) [-1066.635] * [-1066.607] (-1068.466) (-1068.195) (-1067.005) -- 0:00:24
607000 -- (-1072.533) (-1069.793) [-1068.093] (-1067.207) * (-1075.374) [-1067.501] (-1068.291) (-1070.258) -- 0:00:23
607500 -- (-1069.354) [-1068.188] (-1070.165) (-1068.516) * (-1068.936) [-1066.320] (-1068.451) (-1067.226) -- 0:00:23
608000 -- [-1071.897] (-1070.849) (-1067.645) (-1069.608) * (-1067.881) (-1067.862) [-1067.276] (-1067.014) -- 0:00:23
608500 -- (-1067.247) (-1067.440) [-1067.471] (-1072.276) * (-1068.201) (-1069.210) (-1067.301) [-1068.859] -- 0:00:23
609000 -- (-1069.104) [-1068.497] (-1071.421) (-1067.815) * (-1069.344) (-1069.866) [-1068.717] (-1067.962) -- 0:00:23
609500 -- (-1068.404) (-1068.059) [-1070.114] (-1069.461) * (-1066.991) (-1066.597) [-1069.219] (-1072.011) -- 0:00:23
610000 -- [-1068.179] (-1068.942) (-1071.321) (-1067.901) * (-1067.409) [-1066.142] (-1073.370) (-1068.437) -- 0:00:23
Average standard deviation of split frequencies: 0.005983
610500 -- (-1069.501) (-1067.991) (-1068.496) [-1068.411] * (-1066.346) (-1066.429) (-1067.811) [-1069.089] -- 0:00:23
611000 -- (-1067.391) (-1074.195) (-1072.349) [-1067.229] * [-1066.469] (-1071.246) (-1069.658) (-1066.727) -- 0:00:23
611500 -- (-1067.573) (-1071.176) [-1071.308] (-1068.301) * [-1071.675] (-1069.072) (-1068.100) (-1070.309) -- 0:00:23
612000 -- (-1069.089) [-1066.508] (-1071.163) (-1067.612) * (-1067.714) (-1069.649) [-1070.054] (-1071.597) -- 0:00:23
612500 -- (-1067.943) [-1067.312] (-1068.655) (-1066.574) * (-1066.650) [-1069.212] (-1067.823) (-1069.755) -- 0:00:24
613000 -- (-1068.624) (-1070.280) (-1069.007) [-1066.710] * (-1067.221) [-1066.303] (-1066.703) (-1069.148) -- 0:00:23
613500 -- (-1068.707) [-1067.753] (-1074.047) (-1069.124) * [-1068.040] (-1068.647) (-1068.809) (-1067.005) -- 0:00:23
614000 -- [-1066.685] (-1069.153) (-1068.170) (-1067.845) * (-1070.205) (-1067.695) (-1069.248) [-1066.446] -- 0:00:23
614500 -- (-1066.222) [-1067.216] (-1068.892) (-1067.239) * (-1069.904) (-1068.530) (-1070.400) [-1066.211] -- 0:00:23
615000 -- (-1069.176) [-1067.640] (-1068.929) (-1067.020) * (-1066.756) [-1069.672] (-1069.867) (-1066.876) -- 0:00:23
Average standard deviation of split frequencies: 0.006122
615500 -- (-1069.224) (-1067.989) (-1068.665) [-1068.230] * (-1068.587) (-1068.518) (-1068.635) [-1069.149] -- 0:00:23
616000 -- (-1070.168) (-1068.543) (-1068.690) [-1067.703] * [-1068.758] (-1068.219) (-1068.299) (-1067.292) -- 0:00:23
616500 -- [-1066.341] (-1068.341) (-1068.443) (-1071.403) * (-1067.775) [-1070.991] (-1069.052) (-1069.342) -- 0:00:23
617000 -- (-1067.688) [-1067.176] (-1068.757) (-1068.390) * [-1068.450] (-1070.569) (-1069.144) (-1068.214) -- 0:00:23
617500 -- (-1068.410) [-1068.805] (-1071.572) (-1067.470) * (-1068.905) (-1069.431) [-1069.317] (-1069.611) -- 0:00:23
618000 -- (-1067.632) [-1070.611] (-1069.215) (-1069.070) * [-1066.834] (-1070.916) (-1070.352) (-1068.112) -- 0:00:23
618500 -- (-1067.044) (-1071.166) (-1071.511) [-1066.975] * (-1069.419) (-1068.150) [-1069.905] (-1066.886) -- 0:00:23
619000 -- (-1075.585) [-1070.743] (-1067.120) (-1069.499) * [-1067.750] (-1068.690) (-1068.597) (-1068.860) -- 0:00:23
619500 -- [-1070.216] (-1066.792) (-1068.108) (-1067.167) * (-1072.877) [-1067.591] (-1075.021) (-1069.406) -- 0:00:23
620000 -- [-1067.752] (-1066.659) (-1067.699) (-1067.413) * (-1073.648) (-1075.727) (-1074.717) [-1067.266] -- 0:00:23
Average standard deviation of split frequencies: 0.005620
620500 -- (-1068.981) [-1067.673] (-1068.823) (-1067.941) * (-1067.928) (-1074.225) (-1072.270) [-1068.470] -- 0:00:23
621000 -- (-1067.521) [-1066.584] (-1067.434) (-1068.142) * (-1067.872) (-1069.379) (-1068.316) [-1068.834] -- 0:00:23
621500 -- [-1068.668] (-1068.340) (-1068.097) (-1069.245) * (-1067.730) (-1067.786) (-1067.446) [-1067.377] -- 0:00:23
622000 -- (-1067.206) (-1069.983) [-1067.992] (-1068.022) * [-1068.825] (-1070.703) (-1066.693) (-1067.841) -- 0:00:23
622500 -- (-1068.502) [-1072.545] (-1070.458) (-1067.466) * (-1068.184) (-1067.734) (-1066.110) [-1067.514] -- 0:00:23
623000 -- [-1067.459] (-1074.573) (-1068.668) (-1066.955) * (-1072.528) (-1069.187) (-1067.370) [-1067.003] -- 0:00:22
623500 -- [-1068.514] (-1073.030) (-1067.797) (-1066.671) * (-1069.412) (-1068.668) [-1067.577] (-1068.086) -- 0:00:22
624000 -- (-1067.742) (-1070.867) [-1066.887] (-1068.481) * (-1070.911) (-1071.228) (-1068.014) [-1067.478] -- 0:00:22
624500 -- (-1066.720) (-1073.895) [-1067.342] (-1071.398) * (-1070.162) [-1066.243] (-1067.357) (-1066.038) -- 0:00:22
625000 -- (-1067.214) [-1067.608] (-1067.585) (-1068.473) * (-1068.492) [-1070.531] (-1066.615) (-1069.072) -- 0:00:22
Average standard deviation of split frequencies: 0.005171
625500 -- [-1068.583] (-1069.929) (-1069.331) (-1069.569) * [-1066.972] (-1069.295) (-1069.892) (-1068.883) -- 0:00:22
626000 -- [-1066.835] (-1068.857) (-1070.460) (-1067.301) * (-1068.537) (-1066.708) [-1069.334] (-1067.965) -- 0:00:22
626500 -- (-1066.561) [-1072.793] (-1069.443) (-1068.380) * (-1070.072) (-1067.621) (-1068.631) [-1072.455] -- 0:00:22
627000 -- (-1071.564) [-1066.562] (-1067.032) (-1066.804) * (-1068.224) (-1068.312) (-1068.718) [-1066.222] -- 0:00:22
627500 -- (-1070.128) (-1066.583) [-1068.990] (-1066.749) * (-1068.255) (-1069.149) (-1066.781) [-1066.962] -- 0:00:22
628000 -- [-1069.281] (-1066.846) (-1071.620) (-1067.510) * (-1067.356) (-1069.520) [-1067.597] (-1066.285) -- 0:00:22
628500 -- (-1069.614) (-1067.728) (-1069.552) [-1069.320] * [-1069.600] (-1068.027) (-1067.018) (-1066.149) -- 0:00:23
629000 -- [-1066.556] (-1067.010) (-1067.729) (-1072.638) * (-1067.788) [-1066.315] (-1070.044) (-1072.551) -- 0:00:23
629500 -- (-1067.330) (-1072.808) (-1068.231) [-1067.114] * (-1067.174) [-1066.942] (-1069.453) (-1070.449) -- 0:00:22
630000 -- (-1068.760) (-1068.301) (-1069.247) [-1065.975] * (-1067.042) (-1069.590) [-1068.588] (-1072.314) -- 0:00:22
Average standard deviation of split frequencies: 0.004584
630500 -- (-1070.712) (-1068.842) [-1071.327] (-1066.882) * (-1068.428) (-1069.363) [-1070.162] (-1071.948) -- 0:00:22
631000 -- (-1066.709) (-1066.425) (-1068.678) [-1069.215] * (-1071.302) [-1074.509] (-1070.179) (-1067.279) -- 0:00:22
631500 -- [-1067.546] (-1068.811) (-1070.189) (-1069.308) * (-1071.028) [-1067.442] (-1067.751) (-1068.624) -- 0:00:22
632000 -- (-1068.827) (-1066.945) [-1070.267] (-1067.597) * (-1072.091) [-1066.955] (-1067.171) (-1067.570) -- 0:00:22
632500 -- [-1067.796] (-1068.277) (-1069.048) (-1066.958) * (-1069.349) (-1070.237) [-1067.252] (-1070.653) -- 0:00:22
633000 -- (-1070.609) (-1068.150) [-1069.314] (-1067.817) * (-1071.130) [-1071.399] (-1066.763) (-1069.977) -- 0:00:22
633500 -- [-1068.431] (-1068.518) (-1067.776) (-1067.916) * (-1076.865) [-1069.632] (-1067.934) (-1068.640) -- 0:00:22
634000 -- (-1071.825) [-1068.354] (-1066.708) (-1069.182) * (-1067.991) (-1068.121) (-1068.523) [-1066.610] -- 0:00:22
634500 -- (-1069.283) (-1068.601) (-1068.678) [-1069.865] * (-1070.609) [-1066.550] (-1067.880) (-1067.149) -- 0:00:22
635000 -- (-1077.694) [-1067.355] (-1067.734) (-1069.252) * (-1069.661) [-1069.068] (-1067.716) (-1069.506) -- 0:00:22
Average standard deviation of split frequencies: 0.005337
635500 -- (-1069.166) (-1070.864) (-1069.970) [-1067.590] * [-1067.462] (-1066.778) (-1067.932) (-1067.342) -- 0:00:22
636000 -- (-1068.255) [-1068.498] (-1071.975) (-1068.479) * (-1068.370) (-1070.569) (-1067.671) [-1066.179] -- 0:00:22
636500 -- (-1069.401) [-1068.908] (-1072.185) (-1066.209) * (-1068.150) (-1069.475) [-1068.160] (-1067.365) -- 0:00:22
637000 -- (-1066.293) [-1069.339] (-1070.671) (-1066.948) * [-1068.469] (-1068.918) (-1070.930) (-1067.515) -- 0:00:22
637500 -- (-1070.493) (-1070.189) (-1071.996) [-1068.931] * (-1067.659) [-1068.939] (-1069.891) (-1068.864) -- 0:00:22
638000 -- [-1073.680] (-1069.049) (-1068.861) (-1067.489) * [-1069.879] (-1069.050) (-1066.956) (-1067.156) -- 0:00:22
638500 -- (-1073.545) (-1067.331) [-1068.209] (-1066.080) * [-1068.881] (-1067.443) (-1066.699) (-1067.650) -- 0:00:22
639000 -- (-1068.914) (-1067.938) [-1074.508] (-1066.149) * (-1067.346) (-1067.998) (-1074.331) [-1071.306] -- 0:00:22
639500 -- (-1067.094) (-1066.885) [-1075.148] (-1067.339) * (-1070.841) (-1067.459) [-1070.149] (-1066.265) -- 0:00:21
640000 -- (-1067.127) (-1068.244) (-1068.998) [-1067.575] * [-1072.449] (-1066.836) (-1068.717) (-1066.202) -- 0:00:21
Average standard deviation of split frequencies: 0.005003
640500 -- (-1067.082) [-1068.253] (-1068.668) (-1066.335) * (-1068.159) (-1066.216) (-1068.337) [-1067.180] -- 0:00:21
641000 -- (-1069.170) (-1067.829) [-1068.864] (-1067.630) * [-1068.726] (-1066.634) (-1067.930) (-1067.296) -- 0:00:21
641500 -- (-1067.563) (-1069.789) (-1072.171) [-1070.100] * [-1069.051] (-1068.860) (-1067.019) (-1067.287) -- 0:00:21
642000 -- [-1068.202] (-1068.991) (-1069.513) (-1069.500) * (-1066.227) [-1068.798] (-1066.808) (-1069.671) -- 0:00:21
642500 -- (-1067.048) [-1066.824] (-1068.882) (-1068.725) * [-1067.226] (-1070.205) (-1069.611) (-1072.718) -- 0:00:21
643000 -- (-1068.415) [-1066.460] (-1068.510) (-1067.059) * (-1068.244) (-1068.062) (-1069.879) [-1069.344] -- 0:00:21
643500 -- (-1069.614) (-1075.353) (-1067.313) [-1070.740] * (-1068.629) (-1069.144) (-1073.207) [-1068.565] -- 0:00:21
644000 -- (-1071.908) [-1067.432] (-1070.151) (-1071.964) * (-1067.914) [-1070.766] (-1073.903) (-1067.231) -- 0:00:21
644500 -- [-1069.146] (-1066.595) (-1070.198) (-1067.995) * (-1067.239) (-1073.454) [-1067.374] (-1068.462) -- 0:00:22
645000 -- [-1067.868] (-1068.707) (-1068.762) (-1068.655) * (-1066.962) (-1067.943) (-1068.182) [-1068.674] -- 0:00:22
Average standard deviation of split frequencies: 0.005157
645500 -- (-1068.069) [-1067.062] (-1073.319) (-1072.200) * (-1069.401) [-1067.519] (-1069.343) (-1067.671) -- 0:00:21
646000 -- (-1067.571) [-1067.236] (-1069.505) (-1067.741) * [-1068.990] (-1067.460) (-1068.092) (-1067.711) -- 0:00:21
646500 -- (-1066.353) (-1067.438) [-1068.812] (-1069.547) * (-1076.194) (-1067.151) (-1067.996) [-1067.118] -- 0:00:21
647000 -- (-1070.238) [-1069.537] (-1070.099) (-1068.563) * (-1071.221) (-1070.829) (-1067.494) [-1067.358] -- 0:00:21
647500 -- (-1067.352) [-1067.195] (-1074.872) (-1066.376) * [-1066.800] (-1075.086) (-1070.502) (-1067.035) -- 0:00:21
648000 -- [-1067.068] (-1068.081) (-1066.817) (-1067.341) * [-1068.691] (-1070.404) (-1067.811) (-1069.883) -- 0:00:21
648500 -- (-1066.961) [-1066.696] (-1068.744) (-1067.505) * (-1067.199) (-1070.195) [-1068.649] (-1067.759) -- 0:00:21
649000 -- (-1070.345) (-1067.035) (-1072.873) [-1067.414] * [-1067.016] (-1069.511) (-1067.355) (-1068.865) -- 0:00:21
649500 -- [-1067.849] (-1075.193) (-1070.155) (-1068.725) * (-1069.226) (-1066.685) (-1067.610) [-1067.993] -- 0:00:21
650000 -- (-1067.969) (-1073.533) (-1070.798) [-1068.511] * (-1067.068) (-1069.356) [-1067.739] (-1068.361) -- 0:00:21
Average standard deviation of split frequencies: 0.005989
650500 -- (-1071.030) (-1067.473) (-1069.419) [-1066.828] * [-1068.538] (-1068.156) (-1067.897) (-1067.127) -- 0:00:21
651000 -- [-1069.636] (-1067.017) (-1070.677) (-1066.998) * (-1066.647) (-1066.783) [-1069.048] (-1068.921) -- 0:00:21
651500 -- (-1069.698) (-1067.828) (-1067.526) [-1069.086] * (-1067.852) (-1068.133) [-1067.344] (-1066.377) -- 0:00:21
652000 -- [-1066.932] (-1067.826) (-1068.373) (-1070.027) * (-1066.933) (-1068.446) [-1067.655] (-1069.833) -- 0:00:21
652500 -- (-1067.906) (-1068.745) [-1068.870] (-1070.687) * (-1066.445) (-1068.142) [-1066.288] (-1069.128) -- 0:00:21
653000 -- (-1068.475) [-1067.791] (-1067.791) (-1067.119) * (-1068.370) (-1068.732) [-1066.540] (-1068.183) -- 0:00:21
653500 -- (-1071.354) [-1067.395] (-1068.218) (-1067.529) * (-1068.540) (-1068.682) (-1068.298) [-1071.348] -- 0:00:21
654000 -- (-1070.153) [-1067.335] (-1069.726) (-1067.279) * [-1066.887] (-1068.244) (-1068.455) (-1073.040) -- 0:00:21
654500 -- (-1068.688) (-1070.988) [-1066.277] (-1067.975) * [-1067.868] (-1067.919) (-1068.574) (-1070.077) -- 0:00:21
655000 -- [-1067.869] (-1068.876) (-1069.156) (-1067.154) * (-1066.858) (-1068.519) [-1067.691] (-1074.576) -- 0:00:21
Average standard deviation of split frequencies: 0.005988
655500 -- (-1067.014) (-1066.714) [-1071.188] (-1067.776) * (-1068.029) [-1067.625] (-1066.810) (-1069.011) -- 0:00:21
656000 -- [-1067.005] (-1066.378) (-1068.652) (-1072.080) * [-1067.217] (-1067.861) (-1068.275) (-1067.241) -- 0:00:20
656500 -- (-1066.399) (-1067.537) (-1066.227) [-1070.379] * (-1069.857) (-1068.169) (-1066.358) [-1066.430] -- 0:00:20
657000 -- (-1066.824) [-1067.017] (-1071.668) (-1067.373) * (-1069.354) (-1066.856) [-1066.835] (-1069.404) -- 0:00:20
657500 -- (-1066.825) (-1069.317) (-1070.268) [-1066.597] * (-1067.382) (-1069.878) [-1067.294] (-1067.304) -- 0:00:20
658000 -- (-1067.987) (-1069.685) (-1066.006) [-1066.840] * [-1071.021] (-1069.042) (-1067.183) (-1068.119) -- 0:00:20
658500 -- (-1066.621) [-1071.706] (-1066.938) (-1067.396) * (-1069.951) (-1069.355) (-1069.102) [-1067.811] -- 0:00:20
659000 -- [-1067.306] (-1068.193) (-1071.594) (-1068.231) * [-1068.265] (-1067.346) (-1072.317) (-1068.491) -- 0:00:20
659500 -- [-1068.318] (-1068.954) (-1068.120) (-1068.692) * [-1067.439] (-1068.501) (-1071.206) (-1067.816) -- 0:00:20
660000 -- (-1067.057) (-1068.961) [-1066.271] (-1068.523) * [-1067.312] (-1067.017) (-1069.217) (-1071.564) -- 0:00:20
Average standard deviation of split frequencies: 0.006089
660500 -- (-1073.776) [-1067.529] (-1068.634) (-1069.577) * (-1067.755) (-1067.357) (-1069.366) [-1068.487] -- 0:00:20
661000 -- (-1071.065) (-1068.801) [-1067.241] (-1067.367) * (-1073.133) (-1066.869) [-1066.358] (-1070.913) -- 0:00:21
661500 -- [-1066.639] (-1069.755) (-1066.485) (-1072.165) * (-1073.106) (-1066.125) [-1067.151] (-1071.179) -- 0:00:20
662000 -- (-1067.526) (-1068.254) [-1071.147] (-1069.362) * (-1072.552) [-1067.230] (-1066.673) (-1069.560) -- 0:00:20
662500 -- (-1068.209) (-1068.250) [-1068.134] (-1068.688) * (-1069.737) [-1066.914] (-1066.364) (-1069.384) -- 0:00:20
663000 -- (-1070.537) (-1069.348) (-1067.382) [-1068.823] * (-1066.275) (-1066.456) [-1066.421] (-1067.380) -- 0:00:20
663500 -- (-1070.404) [-1066.978] (-1067.764) (-1067.118) * (-1066.821) [-1068.032] (-1069.925) (-1069.944) -- 0:00:20
664000 -- (-1066.781) (-1067.029) [-1067.731] (-1067.627) * (-1067.247) (-1068.705) (-1068.684) [-1068.023] -- 0:00:20
664500 -- (-1066.159) (-1067.776) [-1067.581] (-1068.301) * (-1068.449) (-1069.038) [-1073.539] (-1067.711) -- 0:00:20
665000 -- [-1067.193] (-1068.334) (-1067.211) (-1072.229) * [-1067.738] (-1066.141) (-1071.213) (-1067.617) -- 0:00:20
Average standard deviation of split frequencies: 0.005663
665500 -- (-1067.110) [-1067.968] (-1070.721) (-1066.848) * (-1069.973) (-1067.353) (-1067.989) [-1067.162] -- 0:00:20
666000 -- (-1068.236) (-1066.619) (-1068.727) [-1068.767] * (-1066.490) (-1074.034) (-1067.506) [-1068.347] -- 0:00:20
666500 -- (-1066.097) (-1067.167) [-1067.127] (-1070.500) * (-1066.458) [-1068.280] (-1067.534) (-1067.956) -- 0:00:20
667000 -- (-1066.356) [-1066.672] (-1067.384) (-1069.442) * (-1067.949) [-1066.852] (-1068.751) (-1069.035) -- 0:00:20
667500 -- (-1067.289) (-1067.118) [-1067.745] (-1069.832) * (-1066.112) (-1067.840) [-1068.246] (-1074.570) -- 0:00:20
668000 -- (-1068.073) (-1070.821) [-1070.131] (-1072.398) * (-1067.698) (-1066.774) (-1071.624) [-1069.079] -- 0:00:20
668500 -- (-1068.535) (-1070.387) (-1076.903) [-1074.060] * (-1068.826) (-1066.718) [-1067.232] (-1072.192) -- 0:00:20
669000 -- (-1070.002) (-1074.822) [-1067.500] (-1072.290) * (-1068.827) [-1067.112] (-1068.603) (-1070.869) -- 0:00:20
669500 -- (-1068.560) (-1070.452) (-1067.065) [-1071.205] * (-1068.968) [-1068.457] (-1070.446) (-1076.257) -- 0:00:20
670000 -- (-1067.449) (-1069.688) [-1072.328] (-1067.503) * (-1069.158) [-1066.778] (-1068.768) (-1072.616) -- 0:00:20
Average standard deviation of split frequencies: 0.005248
670500 -- (-1066.704) [-1069.320] (-1070.629) (-1067.060) * (-1066.223) (-1068.136) (-1068.012) [-1067.476] -- 0:00:20
671000 -- (-1067.441) (-1067.258) [-1067.273] (-1070.081) * (-1066.817) [-1066.750] (-1066.931) (-1069.484) -- 0:00:20
671500 -- [-1071.902] (-1068.363) (-1069.409) (-1069.171) * (-1068.490) [-1067.270] (-1066.800) (-1069.670) -- 0:00:20
672000 -- (-1067.710) (-1066.543) [-1067.367] (-1068.818) * [-1069.214] (-1068.565) (-1067.491) (-1068.458) -- 0:00:20
672500 -- (-1066.600) [-1067.569] (-1066.991) (-1067.759) * (-1071.625) [-1067.871] (-1070.381) (-1066.394) -- 0:00:19
673000 -- [-1067.619] (-1068.433) (-1071.837) (-1068.001) * (-1069.045) (-1069.615) [-1068.797] (-1067.536) -- 0:00:19
673500 -- (-1071.145) (-1068.180) (-1071.870) [-1069.286] * (-1069.661) [-1071.336] (-1068.361) (-1069.484) -- 0:00:19
674000 -- (-1069.037) (-1069.403) [-1067.055] (-1069.520) * (-1069.609) (-1070.547) [-1069.280] (-1068.122) -- 0:00:19
674500 -- (-1068.639) (-1070.447) (-1072.057) [-1069.333] * (-1067.551) (-1069.740) (-1066.868) [-1067.789] -- 0:00:19
675000 -- (-1070.795) (-1067.624) [-1068.957] (-1070.701) * [-1068.955] (-1068.201) (-1069.600) (-1069.356) -- 0:00:19
Average standard deviation of split frequencies: 0.005765
675500 -- [-1070.940] (-1066.934) (-1067.093) (-1068.974) * [-1068.406] (-1068.279) (-1075.589) (-1069.813) -- 0:00:19
676000 -- [-1067.583] (-1068.649) (-1067.630) (-1069.673) * (-1070.367) (-1068.259) (-1074.035) [-1066.623] -- 0:00:19
676500 -- (-1070.131) (-1071.631) [-1068.654] (-1067.129) * (-1073.704) (-1069.414) (-1069.302) [-1066.534] -- 0:00:19
677000 -- [-1066.683] (-1068.350) (-1067.294) (-1066.325) * [-1066.891] (-1067.660) (-1071.439) (-1067.428) -- 0:00:20
677500 -- [-1068.253] (-1067.680) (-1067.230) (-1066.001) * (-1068.838) [-1067.503] (-1067.976) (-1069.528) -- 0:00:19
678000 -- (-1067.998) (-1068.390) [-1066.337] (-1068.579) * [-1068.170] (-1071.184) (-1067.395) (-1069.613) -- 0:00:19
678500 -- [-1068.680] (-1067.554) (-1066.803) (-1071.913) * (-1072.527) (-1070.199) (-1071.202) [-1070.543] -- 0:00:19
679000 -- (-1067.813) (-1070.619) (-1066.565) [-1067.810] * (-1071.422) (-1067.768) (-1067.813) [-1066.732] -- 0:00:19
679500 -- (-1067.534) (-1067.898) (-1067.262) [-1072.477] * (-1068.527) (-1067.851) (-1066.837) [-1067.067] -- 0:00:19
680000 -- [-1066.979] (-1072.453) (-1066.972) (-1069.229) * (-1070.574) (-1068.874) (-1067.725) [-1068.517] -- 0:00:19
Average standard deviation of split frequencies: 0.006233
680500 -- (-1067.944) (-1076.710) (-1067.256) [-1067.030] * (-1067.983) [-1068.590] (-1068.492) (-1068.305) -- 0:00:19
681000 -- (-1068.730) (-1074.856) [-1066.947] (-1068.408) * (-1066.139) [-1068.612] (-1069.736) (-1069.779) -- 0:00:19
681500 -- [-1070.346] (-1066.397) (-1067.943) (-1066.896) * [-1066.538] (-1072.082) (-1067.447) (-1067.660) -- 0:00:19
682000 -- [-1067.190] (-1068.762) (-1066.006) (-1069.545) * [-1066.794] (-1072.479) (-1066.780) (-1066.399) -- 0:00:19
682500 -- (-1069.093) (-1067.017) [-1066.002] (-1068.576) * [-1066.560] (-1070.291) (-1068.156) (-1067.480) -- 0:00:19
683000 -- (-1067.121) (-1067.681) [-1067.168] (-1068.650) * (-1067.595) (-1067.163) [-1069.239] (-1069.750) -- 0:00:19
683500 -- (-1073.024) [-1066.377] (-1073.797) (-1067.050) * (-1067.755) [-1068.521] (-1067.267) (-1067.401) -- 0:00:19
684000 -- [-1069.496] (-1070.782) (-1067.166) (-1066.940) * (-1067.942) (-1069.063) (-1067.479) [-1066.446] -- 0:00:19
684500 -- (-1070.608) [-1068.872] (-1069.852) (-1067.685) * (-1066.826) (-1068.701) (-1068.146) [-1066.222] -- 0:00:19
685000 -- (-1071.084) [-1066.596] (-1068.165) (-1068.812) * (-1066.511) [-1067.555] (-1069.336) (-1068.309) -- 0:00:19
Average standard deviation of split frequencies: 0.006700
685500 -- (-1068.882) (-1070.275) [-1069.282] (-1070.178) * (-1067.200) (-1070.811) (-1067.533) [-1067.731] -- 0:00:19
686000 -- (-1069.373) (-1067.105) [-1068.834] (-1068.885) * [-1067.078] (-1069.159) (-1069.098) (-1070.028) -- 0:00:19
686500 -- [-1069.335] (-1067.854) (-1067.331) (-1066.516) * (-1069.458) (-1073.485) [-1068.365] (-1069.047) -- 0:00:19
687000 -- [-1067.716] (-1067.207) (-1067.272) (-1067.313) * (-1070.594) [-1067.039] (-1068.134) (-1069.509) -- 0:00:19
687500 -- (-1068.812) (-1067.477) (-1068.036) [-1067.775] * [-1072.529] (-1069.725) (-1067.923) (-1067.915) -- 0:00:19
688000 -- (-1069.737) [-1068.249] (-1067.946) (-1067.954) * [-1068.751] (-1069.107) (-1066.990) (-1068.080) -- 0:00:19
688500 -- (-1068.342) (-1071.380) [-1069.264] (-1070.000) * (-1069.437) (-1070.210) (-1068.910) [-1067.469] -- 0:00:19
689000 -- (-1073.746) (-1078.716) [-1067.448] (-1069.139) * (-1071.109) (-1069.582) (-1066.393) [-1070.996] -- 0:00:18
689500 -- (-1067.314) (-1067.542) (-1067.018) [-1067.379] * (-1069.147) [-1066.603] (-1067.042) (-1069.053) -- 0:00:18
690000 -- [-1068.910] (-1067.977) (-1072.948) (-1067.552) * [-1074.116] (-1066.894) (-1069.747) (-1068.926) -- 0:00:18
Average standard deviation of split frequencies: 0.005460
690500 -- [-1067.092] (-1071.235) (-1068.594) (-1066.927) * (-1068.983) (-1068.744) (-1072.753) [-1067.719] -- 0:00:18
691000 -- [-1067.430] (-1066.365) (-1069.185) (-1067.521) * (-1068.491) [-1066.586] (-1068.237) (-1066.512) -- 0:00:18
691500 -- (-1068.594) [-1066.281] (-1069.272) (-1068.317) * (-1067.263) (-1072.059) (-1067.199) [-1067.774] -- 0:00:18
692000 -- (-1070.653) [-1068.621] (-1072.416) (-1068.592) * (-1067.000) (-1067.652) [-1070.654] (-1070.195) -- 0:00:18
692500 -- (-1067.822) (-1070.939) (-1070.297) [-1070.490] * [-1071.568] (-1073.765) (-1072.149) (-1067.648) -- 0:00:18
693000 -- (-1071.036) (-1069.689) [-1069.348] (-1073.041) * (-1067.106) (-1068.482) [-1069.370] (-1068.982) -- 0:00:18
693500 -- [-1067.060] (-1070.327) (-1066.926) (-1070.147) * (-1067.165) [-1069.501] (-1068.403) (-1068.671) -- 0:00:19
694000 -- [-1068.661] (-1073.238) (-1067.540) (-1069.796) * [-1067.155] (-1069.540) (-1069.363) (-1068.621) -- 0:00:18
694500 -- [-1066.704] (-1068.920) (-1069.165) (-1070.951) * [-1067.155] (-1077.283) (-1068.662) (-1069.332) -- 0:00:18
695000 -- (-1067.251) (-1069.818) [-1072.023] (-1067.883) * (-1068.064) (-1077.689) (-1068.851) [-1069.904] -- 0:00:18
Average standard deviation of split frequencies: 0.005825
695500 -- (-1069.553) (-1071.838) (-1069.625) [-1067.507] * (-1068.916) [-1068.025] (-1068.553) (-1068.343) -- 0:00:18
696000 -- (-1070.806) (-1068.897) (-1067.508) [-1067.440] * (-1068.167) [-1068.466] (-1068.390) (-1068.200) -- 0:00:18
696500 -- (-1069.353) [-1067.516] (-1067.915) (-1068.829) * [-1069.816] (-1067.319) (-1067.974) (-1069.501) -- 0:00:18
697000 -- (-1067.577) (-1068.156) (-1068.913) [-1068.841] * (-1067.554) (-1066.877) (-1069.701) [-1069.223] -- 0:00:18
697500 -- [-1067.487] (-1071.687) (-1067.684) (-1067.561) * [-1066.936] (-1070.163) (-1066.106) (-1067.885) -- 0:00:18
698000 -- (-1068.342) (-1067.126) [-1068.977] (-1066.745) * (-1068.322) (-1066.707) [-1066.386] (-1068.856) -- 0:00:18
698500 -- (-1074.146) (-1068.056) (-1070.768) [-1068.535] * (-1070.407) [-1067.424] (-1066.482) (-1068.396) -- 0:00:18
699000 -- (-1069.443) [-1069.282] (-1068.423) (-1067.366) * [-1069.577] (-1068.234) (-1070.570) (-1070.231) -- 0:00:18
699500 -- (-1073.010) [-1068.856] (-1068.313) (-1067.005) * (-1068.490) (-1066.876) [-1068.726] (-1068.373) -- 0:00:18
700000 -- (-1068.900) (-1068.382) [-1067.606] (-1066.792) * (-1071.936) (-1067.013) [-1067.935] (-1068.956) -- 0:00:18
Average standard deviation of split frequencies: 0.006414
700500 -- (-1069.609) (-1067.881) [-1068.697] (-1069.112) * (-1069.060) [-1070.125] (-1068.481) (-1069.544) -- 0:00:18
701000 -- (-1072.202) [-1068.707] (-1071.520) (-1067.767) * (-1068.222) (-1071.109) (-1070.561) [-1070.723] -- 0:00:18
701500 -- (-1072.373) (-1069.707) [-1067.949] (-1068.891) * [-1069.391] (-1071.936) (-1067.438) (-1072.342) -- 0:00:18
702000 -- [-1069.286] (-1068.191) (-1068.767) (-1070.266) * (-1069.526) (-1068.003) (-1069.027) [-1070.292] -- 0:00:18
702500 -- (-1067.943) (-1068.004) [-1067.853] (-1067.292) * (-1069.526) (-1068.344) (-1069.156) [-1068.396] -- 0:00:18
703000 -- (-1070.723) (-1067.092) (-1070.743) [-1067.299] * (-1068.306) (-1070.803) [-1067.958] (-1068.914) -- 0:00:18
703500 -- (-1068.182) (-1068.825) (-1072.602) [-1066.957] * (-1066.034) [-1070.367] (-1067.240) (-1068.602) -- 0:00:18
704000 -- (-1066.893) (-1068.120) (-1068.050) [-1066.387] * (-1069.029) (-1069.200) (-1068.300) [-1069.046] -- 0:00:18
704500 -- (-1068.338) [-1067.245] (-1068.731) (-1067.801) * (-1067.468) (-1067.467) [-1069.212] (-1070.418) -- 0:00:18
705000 -- (-1069.160) [-1067.444] (-1067.324) (-1070.187) * [-1068.260] (-1069.910) (-1069.285) (-1068.282) -- 0:00:17
Average standard deviation of split frequencies: 0.007595
705500 -- (-1069.067) (-1070.184) [-1066.169] (-1066.449) * (-1066.968) (-1068.263) [-1066.278] (-1068.155) -- 0:00:17
706000 -- (-1067.321) (-1069.769) [-1066.925] (-1069.444) * (-1066.240) (-1067.791) [-1067.362] (-1066.759) -- 0:00:17
706500 -- [-1068.548] (-1069.791) (-1074.267) (-1067.066) * (-1068.348) (-1066.817) [-1068.353] (-1071.701) -- 0:00:17
707000 -- (-1066.483) (-1068.007) (-1073.597) [-1068.934] * (-1066.699) (-1068.402) [-1066.551] (-1070.117) -- 0:00:17
707500 -- (-1067.574) (-1069.090) [-1069.481] (-1069.387) * [-1068.021] (-1069.018) (-1067.744) (-1070.291) -- 0:00:17
708000 -- (-1067.795) [-1070.720] (-1068.563) (-1068.503) * [-1067.091] (-1068.401) (-1068.671) (-1068.570) -- 0:00:17
708500 -- (-1068.892) (-1068.728) [-1069.085] (-1067.026) * (-1067.350) (-1069.757) [-1071.772] (-1070.347) -- 0:00:17
709000 -- (-1072.424) [-1067.824] (-1067.611) (-1071.048) * (-1066.498) [-1067.328] (-1068.405) (-1069.084) -- 0:00:17
709500 -- (-1067.435) (-1069.374) [-1066.718] (-1071.329) * (-1068.583) (-1066.582) (-1067.473) [-1069.457] -- 0:00:17
710000 -- (-1066.010) (-1072.891) [-1067.170] (-1068.699) * [-1066.933] (-1066.295) (-1068.475) (-1072.464) -- 0:00:17
Average standard deviation of split frequencies: 0.007504
710500 -- [-1066.424] (-1066.654) (-1067.336) (-1068.230) * (-1067.314) (-1069.847) (-1066.787) [-1068.779] -- 0:00:17
711000 -- (-1067.289) (-1071.367) [-1067.645] (-1068.669) * (-1067.235) [-1066.842] (-1067.058) (-1068.210) -- 0:00:17
711500 -- (-1066.402) (-1067.663) (-1066.813) [-1068.400] * (-1069.276) (-1067.481) (-1069.838) [-1069.371] -- 0:00:17
712000 -- (-1066.501) (-1068.414) [-1066.675] (-1068.621) * (-1067.574) (-1075.978) (-1066.809) [-1070.715] -- 0:00:17
712500 -- (-1066.682) (-1068.728) [-1066.187] (-1067.594) * (-1067.733) (-1068.750) [-1067.343] (-1067.646) -- 0:00:17
713000 -- (-1069.658) (-1068.572) (-1067.793) [-1069.184] * (-1067.729) (-1068.152) [-1068.482] (-1071.371) -- 0:00:17
713500 -- (-1067.798) [-1066.921] (-1068.242) (-1069.591) * (-1068.502) (-1068.003) (-1069.154) [-1069.140] -- 0:00:17
714000 -- (-1068.172) (-1068.868) [-1067.413] (-1068.499) * (-1068.027) (-1067.929) [-1067.839] (-1068.494) -- 0:00:17
714500 -- (-1069.307) [-1068.602] (-1070.303) (-1068.324) * [-1067.849] (-1070.389) (-1068.241) (-1070.592) -- 0:00:17
715000 -- (-1066.491) [-1068.132] (-1067.360) (-1069.485) * (-1068.025) [-1070.012] (-1070.915) (-1069.457) -- 0:00:17
Average standard deviation of split frequencies: 0.007777
715500 -- [-1066.518] (-1068.525) (-1067.699) (-1072.830) * [-1068.071] (-1068.385) (-1068.335) (-1068.417) -- 0:00:17
716000 -- [-1070.080] (-1068.725) (-1068.609) (-1069.470) * (-1066.795) [-1067.720] (-1066.758) (-1069.149) -- 0:00:17
716500 -- [-1069.229] (-1067.040) (-1066.527) (-1070.208) * (-1068.693) (-1073.251) (-1066.581) [-1070.489] -- 0:00:17
717000 -- (-1066.981) (-1066.588) [-1067.222] (-1071.182) * [-1067.311] (-1069.620) (-1067.355) (-1068.214) -- 0:00:17
717500 -- [-1069.233] (-1069.572) (-1069.558) (-1067.566) * (-1067.326) [-1067.823] (-1067.555) (-1068.919) -- 0:00:17
718000 -- (-1067.994) (-1067.938) (-1066.120) [-1067.806] * (-1070.947) (-1069.018) (-1071.583) [-1067.973] -- 0:00:17
718500 -- (-1066.621) (-1067.977) [-1070.366] (-1068.404) * [-1071.533] (-1067.241) (-1069.265) (-1067.439) -- 0:00:17
719000 -- (-1066.123) (-1066.201) (-1067.491) [-1068.786] * [-1072.640] (-1068.392) (-1070.572) (-1070.565) -- 0:00:17
719500 -- (-1068.319) (-1066.605) [-1067.492] (-1067.150) * (-1070.417) (-1069.807) [-1066.102] (-1068.969) -- 0:00:17
720000 -- (-1069.739) (-1067.351) [-1066.644] (-1066.589) * (-1069.986) [-1068.198] (-1067.300) (-1068.553) -- 0:00:17
Average standard deviation of split frequencies: 0.007686
720500 -- (-1067.993) [-1071.446] (-1069.488) (-1067.390) * [-1069.083] (-1066.150) (-1067.150) (-1070.919) -- 0:00:17
721000 -- (-1068.319) (-1070.330) (-1066.832) [-1068.085] * (-1070.777) (-1070.821) [-1067.301] (-1067.207) -- 0:00:17
721500 -- (-1068.470) (-1072.042) [-1066.488] (-1069.110) * (-1068.507) [-1067.697] (-1066.639) (-1071.992) -- 0:00:16
722000 -- (-1069.092) (-1068.768) [-1069.712] (-1067.562) * (-1068.513) (-1068.337) [-1067.122] (-1069.901) -- 0:00:16
722500 -- (-1075.312) (-1066.426) [-1069.312] (-1067.937) * (-1069.076) (-1067.372) [-1068.997] (-1067.587) -- 0:00:16
723000 -- [-1070.213] (-1069.425) (-1066.377) (-1066.815) * (-1066.959) (-1070.263) [-1068.481] (-1070.341) -- 0:00:16
723500 -- [-1069.226] (-1067.560) (-1068.461) (-1066.878) * (-1068.907) (-1069.898) (-1067.310) [-1068.587] -- 0:00:16
724000 -- [-1067.466] (-1068.822) (-1067.503) (-1068.693) * [-1067.788] (-1070.050) (-1067.094) (-1068.239) -- 0:00:16
724500 -- [-1068.753] (-1068.758) (-1067.433) (-1068.405) * (-1066.895) (-1068.231) [-1067.089] (-1067.461) -- 0:00:16
725000 -- (-1069.418) [-1067.801] (-1070.354) (-1070.531) * (-1069.588) (-1067.634) [-1068.321] (-1071.306) -- 0:00:16
Average standard deviation of split frequencies: 0.007548
725500 -- (-1067.755) [-1070.746] (-1067.856) (-1066.779) * (-1071.479) (-1066.722) [-1068.377] (-1069.484) -- 0:00:16
726000 -- (-1066.001) (-1068.893) (-1068.533) [-1068.321] * (-1072.514) (-1068.894) (-1068.687) [-1067.509] -- 0:00:16
726500 -- (-1066.001) (-1067.933) (-1075.562) [-1069.087] * [-1067.018] (-1066.500) (-1068.054) (-1067.621) -- 0:00:16
727000 -- (-1068.490) (-1068.252) (-1067.087) [-1066.245] * (-1066.128) [-1068.423] (-1068.984) (-1073.399) -- 0:00:16
727500 -- (-1068.628) (-1068.508) [-1067.860] (-1068.149) * (-1067.243) (-1066.516) (-1068.635) [-1069.445] -- 0:00:16
728000 -- (-1068.436) (-1068.221) [-1067.440] (-1069.113) * (-1069.050) (-1069.011) (-1067.357) [-1066.703] -- 0:00:16
728500 -- (-1068.211) (-1067.932) (-1069.013) [-1068.755] * (-1066.808) [-1067.534] (-1068.349) (-1066.616) -- 0:00:16
729000 -- (-1066.650) (-1068.207) (-1070.905) [-1067.835] * (-1066.700) (-1072.811) [-1068.124] (-1069.997) -- 0:00:16
729500 -- [-1067.487] (-1071.585) (-1069.331) (-1067.483) * [-1067.048] (-1068.547) (-1067.475) (-1067.878) -- 0:00:16
730000 -- (-1068.472) (-1068.573) (-1071.681) [-1068.251] * (-1068.721) (-1066.779) (-1067.893) [-1067.541] -- 0:00:16
Average standard deviation of split frequencies: 0.006976
730500 -- (-1072.493) (-1070.908) (-1067.730) [-1068.607] * [-1066.597] (-1068.555) (-1070.494) (-1069.121) -- 0:00:16
731000 -- (-1068.923) (-1066.699) (-1068.881) [-1067.461] * (-1066.399) [-1066.408] (-1068.196) (-1068.877) -- 0:00:16
731500 -- (-1066.465) (-1068.079) [-1068.376] (-1068.617) * (-1066.277) [-1067.073] (-1068.818) (-1070.547) -- 0:00:16
732000 -- [-1066.901] (-1066.702) (-1070.354) (-1067.950) * [-1066.273] (-1067.915) (-1067.451) (-1069.477) -- 0:00:16
732500 -- (-1066.565) [-1068.806] (-1067.774) (-1067.419) * [-1066.800] (-1070.410) (-1067.415) (-1067.993) -- 0:00:16
733000 -- [-1069.257] (-1067.014) (-1068.109) (-1067.817) * [-1068.133] (-1067.690) (-1067.741) (-1068.714) -- 0:00:16
733500 -- (-1069.083) [-1067.430] (-1069.690) (-1069.033) * [-1067.981] (-1066.985) (-1066.936) (-1070.828) -- 0:00:16
734000 -- (-1068.522) [-1068.178] (-1067.856) (-1070.569) * (-1068.190) [-1069.150] (-1069.555) (-1069.734) -- 0:00:16
734500 -- (-1071.176) (-1071.124) [-1067.942] (-1069.663) * (-1067.204) (-1067.948) (-1069.266) [-1071.639] -- 0:00:16
735000 -- [-1073.132] (-1068.201) (-1069.920) (-1067.353) * (-1067.139) (-1067.428) [-1070.831] (-1070.310) -- 0:00:16
Average standard deviation of split frequencies: 0.006845
735500 -- (-1067.138) (-1068.553) [-1068.060] (-1066.253) * (-1066.359) (-1068.185) [-1066.369] (-1070.253) -- 0:00:16
736000 -- (-1072.042) [-1069.936] (-1071.939) (-1066.919) * (-1068.898) (-1068.617) [-1066.957] (-1067.780) -- 0:00:16
736500 -- (-1067.524) (-1069.868) [-1071.401] (-1067.018) * (-1068.002) [-1069.567] (-1067.459) (-1067.719) -- 0:00:16
737000 -- (-1068.524) [-1070.565] (-1068.251) (-1067.899) * (-1069.956) (-1067.535) (-1069.113) [-1069.757] -- 0:00:16
737500 -- [-1068.210] (-1074.730) (-1067.703) (-1068.824) * [-1069.684] (-1069.160) (-1071.278) (-1068.192) -- 0:00:16
738000 -- (-1066.091) (-1067.010) (-1068.246) [-1066.627] * (-1068.099) [-1068.994] (-1070.636) (-1066.592) -- 0:00:15
738500 -- [-1067.602] (-1070.327) (-1070.076) (-1066.638) * [-1067.481] (-1072.282) (-1067.665) (-1070.054) -- 0:00:15
739000 -- [-1068.658] (-1068.264) (-1067.387) (-1066.762) * (-1069.180) (-1068.265) [-1068.791] (-1070.727) -- 0:00:15
739500 -- [-1068.051] (-1069.576) (-1069.376) (-1070.875) * (-1067.846) [-1069.189] (-1068.593) (-1070.767) -- 0:00:15
740000 -- (-1067.925) [-1070.315] (-1070.375) (-1069.264) * (-1067.506) (-1068.175) [-1068.970] (-1070.162) -- 0:00:15
Average standard deviation of split frequencies: 0.006365
740500 -- (-1068.575) (-1069.062) [-1070.372] (-1066.634) * [-1068.607] (-1067.093) (-1067.027) (-1070.577) -- 0:00:15
741000 -- (-1069.189) (-1068.704) [-1067.654] (-1067.766) * (-1070.556) (-1066.070) [-1067.395] (-1069.989) -- 0:00:15
741500 -- (-1068.497) [-1069.090] (-1068.101) (-1071.417) * [-1067.555] (-1066.467) (-1067.179) (-1066.702) -- 0:00:15
742000 -- (-1066.350) [-1066.821] (-1073.128) (-1071.029) * (-1067.563) [-1069.071] (-1067.099) (-1066.354) -- 0:00:15
742500 -- (-1068.623) (-1069.981) [-1068.800] (-1072.031) * (-1068.030) (-1069.891) (-1069.612) [-1067.444] -- 0:00:15
743000 -- (-1067.394) (-1067.127) (-1068.725) [-1069.872] * (-1070.664) [-1069.018] (-1069.823) (-1068.845) -- 0:00:15
743500 -- (-1067.703) (-1068.152) [-1070.968] (-1069.943) * [-1068.817] (-1071.051) (-1072.662) (-1067.284) -- 0:00:15
744000 -- [-1067.781] (-1066.940) (-1069.304) (-1067.182) * (-1069.622) (-1068.482) (-1067.864) [-1068.279] -- 0:00:15
744500 -- (-1068.948) (-1069.109) (-1070.703) [-1067.326] * [-1069.287] (-1072.289) (-1068.410) (-1071.823) -- 0:00:15
745000 -- [-1068.256] (-1067.384) (-1069.648) (-1066.679) * (-1068.923) (-1067.113) [-1067.437] (-1067.689) -- 0:00:15
Average standard deviation of split frequencies: 0.006043
745500 -- (-1066.770) (-1069.710) (-1072.116) [-1066.708] * (-1067.485) (-1068.290) [-1067.225] (-1070.341) -- 0:00:15
746000 -- [-1067.054] (-1068.262) (-1070.128) (-1066.241) * [-1068.888] (-1067.401) (-1072.333) (-1069.362) -- 0:00:15
746500 -- (-1068.733) [-1070.393] (-1071.718) (-1069.139) * (-1069.698) (-1068.274) [-1067.619] (-1070.275) -- 0:00:15
747000 -- (-1069.665) (-1073.028) (-1075.056) [-1069.277] * [-1076.743] (-1066.900) (-1069.251) (-1069.196) -- 0:00:15
747500 -- (-1069.138) [-1071.709] (-1071.054) (-1068.208) * [-1068.976] (-1069.986) (-1069.772) (-1069.833) -- 0:00:15
748000 -- (-1070.535) (-1066.661) [-1067.746] (-1067.076) * [-1069.724] (-1069.265) (-1072.355) (-1069.082) -- 0:00:15
748500 -- (-1068.743) (-1066.912) (-1077.145) [-1069.720] * (-1066.677) [-1068.735] (-1067.292) (-1066.355) -- 0:00:15
749000 -- (-1068.883) (-1069.287) [-1068.859] (-1068.880) * (-1068.114) (-1067.366) [-1066.386] (-1066.344) -- 0:00:15
749500 -- (-1067.140) (-1066.936) [-1070.521] (-1073.851) * (-1069.361) (-1067.313) [-1067.974] (-1066.633) -- 0:00:15
750000 -- (-1067.699) [-1067.930] (-1067.532) (-1069.611) * (-1068.105) [-1066.623] (-1071.006) (-1069.814) -- 0:00:15
Average standard deviation of split frequencies: 0.006123
750500 -- (-1067.711) (-1066.429) [-1068.913] (-1068.252) * [-1067.510] (-1068.304) (-1068.287) (-1069.477) -- 0:00:15
751000 -- (-1067.358) [-1069.923] (-1072.779) (-1072.869) * (-1068.795) [-1067.575] (-1067.043) (-1072.541) -- 0:00:15
751500 -- [-1067.621] (-1073.764) (-1071.441) (-1074.880) * (-1066.760) (-1068.839) [-1066.532] (-1066.400) -- 0:00:15
752000 -- (-1067.886) [-1068.742] (-1068.681) (-1070.600) * (-1071.913) [-1067.482] (-1069.138) (-1067.166) -- 0:00:15
752500 -- [-1068.369] (-1068.142) (-1066.948) (-1067.516) * (-1073.180) (-1068.167) [-1068.813] (-1068.745) -- 0:00:15
753000 -- [-1067.193] (-1067.041) (-1066.529) (-1069.464) * [-1071.839] (-1071.287) (-1071.506) (-1067.598) -- 0:00:15
753500 -- [-1068.024] (-1067.535) (-1066.551) (-1067.366) * (-1066.758) (-1067.965) (-1073.861) [-1067.753] -- 0:00:15
754000 -- (-1066.000) [-1070.170] (-1066.230) (-1066.124) * (-1067.142) [-1071.514] (-1071.258) (-1066.641) -- 0:00:15
754500 -- (-1068.259) (-1068.388) [-1066.295] (-1068.507) * [-1071.343] (-1070.427) (-1067.514) (-1068.228) -- 0:00:14
755000 -- (-1067.781) (-1067.916) [-1066.195] (-1066.908) * [-1066.991] (-1067.935) (-1070.745) (-1067.622) -- 0:00:14
Average standard deviation of split frequencies: 0.006547
755500 -- (-1067.812) [-1073.008] (-1067.780) (-1070.887) * (-1067.978) [-1070.489] (-1071.344) (-1068.483) -- 0:00:14
756000 -- (-1069.476) (-1073.463) (-1066.371) [-1068.773] * [-1066.142] (-1067.056) (-1067.233) (-1067.335) -- 0:00:14
756500 -- [-1067.958] (-1071.981) (-1067.191) (-1070.911) * (-1066.314) (-1067.076) [-1067.178] (-1068.327) -- 0:00:14
757000 -- [-1069.661] (-1066.966) (-1066.820) (-1069.934) * (-1066.550) [-1070.504] (-1066.896) (-1067.040) -- 0:00:14
757500 -- [-1066.997] (-1068.039) (-1067.486) (-1070.858) * [-1067.371] (-1070.856) (-1066.705) (-1069.017) -- 0:00:14
758000 -- (-1070.463) [-1067.327] (-1066.830) (-1067.132) * (-1069.838) (-1066.492) [-1066.399] (-1067.967) -- 0:00:14
758500 -- (-1069.415) (-1067.712) [-1067.100] (-1067.149) * (-1070.898) (-1066.635) (-1067.300) [-1067.240] -- 0:00:14
759000 -- [-1068.928] (-1066.477) (-1069.606) (-1069.747) * (-1067.315) (-1070.106) [-1069.043] (-1067.183) -- 0:00:14
759500 -- [-1066.870] (-1068.861) (-1070.136) (-1067.016) * (-1068.352) [-1068.306] (-1067.832) (-1068.346) -- 0:00:14
760000 -- (-1066.226) (-1069.438) (-1073.061) [-1068.430] * (-1068.181) (-1071.301) [-1067.886] (-1072.701) -- 0:00:14
Average standard deviation of split frequencies: 0.006120
760500 -- [-1067.428] (-1069.265) (-1069.976) (-1069.461) * (-1069.078) [-1070.735] (-1070.651) (-1071.267) -- 0:00:14
761000 -- (-1067.894) (-1069.513) [-1068.341] (-1073.335) * [-1067.484] (-1069.470) (-1067.307) (-1068.201) -- 0:00:14
761500 -- [-1066.614] (-1067.813) (-1067.483) (-1070.178) * (-1071.207) [-1068.067] (-1067.277) (-1067.634) -- 0:00:14
762000 -- (-1067.184) (-1069.528) (-1069.585) [-1067.000] * (-1066.335) (-1069.893) (-1067.744) [-1067.672] -- 0:00:14
762500 -- (-1066.373) (-1068.004) (-1066.211) [-1066.662] * (-1066.351) [-1071.295] (-1067.801) (-1067.750) -- 0:00:14
763000 -- (-1067.621) [-1068.742] (-1079.381) (-1066.826) * (-1067.610) (-1067.028) [-1066.525] (-1070.718) -- 0:00:14
763500 -- (-1068.412) (-1068.342) (-1068.891) [-1066.302] * (-1067.995) (-1067.472) [-1068.332] (-1068.551) -- 0:00:14
764000 -- (-1068.114) (-1068.260) [-1066.347] (-1068.815) * (-1069.930) (-1069.104) [-1067.199] (-1070.547) -- 0:00:14
764500 -- [-1070.551] (-1069.924) (-1069.056) (-1067.190) * (-1066.966) [-1066.670] (-1068.090) (-1067.282) -- 0:00:14
765000 -- (-1067.754) [-1068.235] (-1067.018) (-1067.813) * (-1067.466) (-1067.249) (-1067.440) [-1068.982] -- 0:00:14
Average standard deviation of split frequencies: 0.005923
765500 -- [-1067.193] (-1067.704) (-1066.639) (-1067.790) * (-1067.470) [-1069.539] (-1070.864) (-1068.613) -- 0:00:14
766000 -- (-1073.541) (-1066.065) (-1066.516) [-1067.347] * (-1067.999) (-1067.829) (-1070.078) [-1066.485] -- 0:00:14
766500 -- (-1066.542) [-1067.447] (-1071.494) (-1069.827) * (-1069.141) (-1067.815) [-1067.747] (-1069.351) -- 0:00:14
767000 -- (-1066.994) (-1068.813) [-1067.346] (-1066.486) * (-1069.373) [-1067.437] (-1069.443) (-1069.355) -- 0:00:14
767500 -- (-1066.330) (-1069.067) (-1067.262) [-1068.638] * [-1072.944] (-1067.558) (-1066.988) (-1066.889) -- 0:00:14
768000 -- (-1068.144) (-1068.259) [-1067.661] (-1068.123) * (-1072.984) [-1066.183] (-1070.550) (-1074.395) -- 0:00:14
768500 -- (-1066.443) [-1067.978] (-1066.369) (-1068.245) * [-1067.565] (-1075.916) (-1072.396) (-1070.310) -- 0:00:14
769000 -- (-1068.280) (-1068.807) (-1066.362) [-1066.614] * (-1067.776) (-1072.280) [-1070.579] (-1066.253) -- 0:00:14
769500 -- (-1069.765) (-1072.077) [-1067.981] (-1068.944) * (-1067.828) [-1067.545] (-1067.848) (-1066.916) -- 0:00:14
770000 -- (-1072.671) [-1067.277] (-1068.450) (-1070.145) * (-1067.994) (-1068.192) (-1067.454) [-1067.753] -- 0:00:14
Average standard deviation of split frequencies: 0.006270
770500 -- (-1071.785) (-1069.911) [-1069.306] (-1067.759) * (-1067.345) [-1069.201] (-1068.569) (-1069.958) -- 0:00:13
771000 -- (-1076.522) (-1066.012) [-1073.726] (-1074.006) * (-1068.099) [-1068.777] (-1067.811) (-1075.460) -- 0:00:13
771500 -- (-1071.276) [-1067.065] (-1067.039) (-1066.940) * (-1075.610) (-1067.833) [-1067.968] (-1075.124) -- 0:00:13
772000 -- [-1068.738] (-1070.494) (-1068.616) (-1068.103) * (-1070.571) [-1067.080] (-1066.782) (-1073.140) -- 0:00:13
772500 -- [-1067.668] (-1069.579) (-1066.702) (-1067.718) * (-1067.698) [-1069.063] (-1067.926) (-1070.498) -- 0:00:13
773000 -- [-1068.557] (-1067.528) (-1066.702) (-1067.196) * (-1067.371) [-1068.910] (-1066.839) (-1067.261) -- 0:00:13
773500 -- (-1066.513) (-1066.600) (-1067.591) [-1071.091] * (-1069.331) (-1069.556) [-1067.116] (-1066.710) -- 0:00:13
774000 -- (-1068.974) [-1067.629] (-1067.013) (-1068.649) * (-1069.729) [-1069.028] (-1070.690) (-1067.029) -- 0:00:13
774500 -- (-1069.974) (-1073.284) (-1068.568) [-1067.451] * [-1068.030] (-1068.284) (-1068.942) (-1068.107) -- 0:00:13
775000 -- [-1069.520] (-1076.853) (-1068.072) (-1066.663) * [-1069.660] (-1069.151) (-1068.407) (-1067.432) -- 0:00:13
Average standard deviation of split frequencies: 0.005265
775500 -- (-1069.664) [-1073.725] (-1067.450) (-1073.701) * (-1072.854) (-1068.009) (-1068.538) [-1070.413] -- 0:00:13
776000 -- (-1074.088) (-1070.313) (-1066.953) [-1066.858] * (-1068.994) [-1067.305] (-1067.741) (-1071.915) -- 0:00:13
776500 -- (-1072.526) (-1068.074) (-1067.271) [-1067.574] * (-1069.846) (-1069.457) (-1068.469) [-1070.204] -- 0:00:13
777000 -- (-1073.405) (-1067.933) [-1066.789] (-1067.278) * (-1071.067) [-1069.759] (-1074.449) (-1067.759) -- 0:00:13
777500 -- [-1070.435] (-1068.747) (-1067.488) (-1066.847) * [-1067.620] (-1068.225) (-1069.967) (-1069.433) -- 0:00:13
778000 -- (-1068.777) (-1071.903) (-1066.753) [-1066.613] * (-1068.483) [-1070.100] (-1068.766) (-1068.692) -- 0:00:13
778500 -- [-1072.360] (-1069.513) (-1067.542) (-1067.310) * (-1067.658) (-1069.558) (-1069.298) [-1073.093] -- 0:00:13
779000 -- (-1066.728) (-1074.556) [-1069.284] (-1067.877) * [-1068.300] (-1067.809) (-1068.602) (-1070.653) -- 0:00:13
779500 -- [-1066.712] (-1070.830) (-1070.403) (-1069.193) * (-1069.260) (-1067.601) (-1070.342) [-1070.593] -- 0:00:13
780000 -- [-1068.129] (-1070.777) (-1068.878) (-1069.642) * (-1070.143) (-1069.801) (-1070.360) [-1070.818] -- 0:00:13
Average standard deviation of split frequencies: 0.005435
780500 -- (-1066.623) (-1068.305) [-1068.541] (-1069.344) * [-1066.746] (-1067.940) (-1070.537) (-1068.630) -- 0:00:13
781000 -- (-1067.093) [-1069.352] (-1067.745) (-1070.397) * (-1068.063) [-1066.141] (-1069.206) (-1068.196) -- 0:00:13
781500 -- [-1069.612] (-1071.001) (-1066.700) (-1067.541) * (-1070.122) (-1067.804) (-1069.842) [-1068.405] -- 0:00:13
782000 -- [-1067.159] (-1067.373) (-1066.907) (-1067.539) * (-1067.382) (-1068.625) (-1069.619) [-1068.416] -- 0:00:13
782500 -- [-1067.014] (-1068.613) (-1070.224) (-1072.659) * (-1067.024) [-1069.055] (-1067.176) (-1067.821) -- 0:00:13
783000 -- (-1068.770) (-1067.729) (-1068.649) [-1069.086] * (-1072.409) (-1067.973) (-1070.152) [-1067.088] -- 0:00:13
783500 -- [-1068.520] (-1069.788) (-1072.450) (-1066.509) * (-1069.463) [-1069.618] (-1067.106) (-1069.034) -- 0:00:13
784000 -- (-1068.210) [-1068.654] (-1073.030) (-1066.617) * [-1067.456] (-1072.482) (-1070.686) (-1067.781) -- 0:00:13
784500 -- [-1068.726] (-1070.296) (-1068.798) (-1067.757) * (-1066.817) (-1069.526) (-1068.392) [-1068.411] -- 0:00:13
785000 -- (-1068.512) (-1069.254) (-1070.408) [-1068.803] * (-1066.152) (-1069.631) (-1067.945) [-1066.399] -- 0:00:13
Average standard deviation of split frequencies: 0.006522
785500 -- (-1066.855) (-1072.585) [-1067.687] (-1068.226) * [-1068.282] (-1066.945) (-1068.526) (-1067.066) -- 0:00:13
786000 -- (-1066.771) [-1073.389] (-1067.614) (-1069.492) * [-1069.347] (-1066.998) (-1068.609) (-1067.134) -- 0:00:13
786500 -- (-1067.175) [-1067.441] (-1067.247) (-1067.729) * (-1067.984) [-1066.241] (-1069.920) (-1072.022) -- 0:00:13
787000 -- (-1068.811) (-1069.181) (-1067.460) [-1069.949] * (-1072.644) [-1068.037] (-1068.934) (-1071.607) -- 0:00:12
787500 -- (-1067.339) [-1066.918] (-1068.823) (-1069.313) * (-1072.403) (-1068.314) [-1068.643] (-1070.551) -- 0:00:12
788000 -- [-1068.850] (-1069.249) (-1069.748) (-1068.538) * (-1072.871) (-1068.010) [-1067.476] (-1068.888) -- 0:00:12
788500 -- [-1066.182] (-1068.925) (-1068.557) (-1067.469) * (-1072.029) (-1073.288) [-1066.978] (-1075.834) -- 0:00:12
789000 -- (-1066.759) (-1067.964) [-1068.091] (-1068.232) * (-1069.784) [-1069.688] (-1067.986) (-1072.245) -- 0:00:12
789500 -- (-1068.134) (-1070.140) (-1070.098) [-1071.374] * [-1069.803] (-1067.603) (-1067.552) (-1070.604) -- 0:00:12
790000 -- [-1066.210] (-1067.525) (-1066.712) (-1067.718) * (-1066.513) (-1068.721) (-1071.107) [-1071.608] -- 0:00:12
Average standard deviation of split frequencies: 0.006037
790500 -- (-1067.392) (-1074.917) [-1072.233] (-1067.664) * (-1067.883) (-1069.154) [-1067.794] (-1068.270) -- 0:00:12
791000 -- (-1067.716) [-1072.202] (-1066.354) (-1067.884) * (-1068.310) (-1066.269) [-1066.042] (-1070.961) -- 0:00:12
791500 -- (-1068.698) [-1067.434] (-1068.355) (-1067.227) * (-1069.858) [-1068.816] (-1066.600) (-1070.370) -- 0:00:12
792000 -- (-1071.442) (-1070.801) [-1067.270] (-1067.409) * (-1067.165) (-1071.037) [-1068.438] (-1070.973) -- 0:00:12
792500 -- [-1070.235] (-1066.784) (-1070.999) (-1068.999) * [-1067.048] (-1070.372) (-1068.232) (-1067.672) -- 0:00:12
793000 -- (-1067.739) (-1067.581) (-1067.928) [-1069.036] * (-1067.502) (-1068.742) [-1067.581] (-1066.685) -- 0:00:12
793500 -- (-1067.869) (-1066.650) [-1069.668] (-1066.012) * (-1067.257) (-1067.842) [-1067.776] (-1067.837) -- 0:00:12
794000 -- [-1069.483] (-1067.912) (-1068.479) (-1067.315) * [-1068.173] (-1068.927) (-1071.961) (-1066.451) -- 0:00:12
794500 -- (-1071.514) (-1067.127) (-1073.292) [-1066.787] * (-1072.068) (-1068.066) (-1067.629) [-1069.973] -- 0:00:12
795000 -- (-1067.512) (-1066.873) (-1068.549) [-1068.710] * (-1069.826) (-1068.645) (-1068.005) [-1066.385] -- 0:00:12
Average standard deviation of split frequencies: 0.005589
795500 -- [-1066.686] (-1067.896) (-1068.267) (-1069.217) * (-1069.194) (-1066.799) (-1069.489) [-1067.702] -- 0:00:12
796000 -- (-1066.273) (-1066.350) (-1070.353) [-1066.986] * [-1067.195] (-1071.941) (-1067.471) (-1070.396) -- 0:00:12
796500 -- (-1068.536) (-1067.337) [-1072.940] (-1067.238) * (-1070.242) (-1069.587) [-1068.065] (-1068.700) -- 0:00:12
797000 -- (-1066.767) [-1066.732] (-1067.916) (-1072.890) * (-1067.580) [-1068.920] (-1075.155) (-1072.027) -- 0:00:12
797500 -- (-1067.929) (-1067.817) [-1069.395] (-1068.386) * [-1067.340] (-1069.045) (-1068.409) (-1067.669) -- 0:00:12
798000 -- (-1067.935) (-1068.896) [-1068.009] (-1073.974) * (-1067.778) (-1067.711) [-1068.131] (-1069.475) -- 0:00:12
798500 -- (-1068.716) (-1068.957) [-1068.705] (-1067.785) * (-1068.140) (-1069.957) (-1069.837) [-1067.265] -- 0:00:12
799000 -- (-1068.232) (-1071.395) [-1066.237] (-1071.339) * (-1070.367) (-1074.836) (-1067.936) [-1067.045] -- 0:00:12
799500 -- (-1070.504) (-1071.531) (-1066.609) [-1067.200] * (-1067.306) (-1067.859) [-1072.909] (-1069.034) -- 0:00:12
800000 -- (-1069.725) (-1068.810) (-1066.937) [-1069.214] * (-1069.342) [-1069.658] (-1073.573) (-1068.140) -- 0:00:12
Average standard deviation of split frequencies: 0.005336
800500 -- [-1067.303] (-1069.164) (-1067.354) (-1067.190) * (-1069.872) [-1069.691] (-1068.253) (-1067.414) -- 0:00:12
801000 -- (-1068.467) (-1067.590) (-1071.127) [-1070.564] * (-1069.782) (-1070.107) [-1070.395] (-1069.163) -- 0:00:12
801500 -- (-1070.208) [-1066.783] (-1069.868) (-1068.361) * (-1070.338) [-1069.636] (-1068.672) (-1070.833) -- 0:00:12
802000 -- [-1066.863] (-1069.159) (-1072.077) (-1071.426) * (-1070.158) (-1067.134) [-1068.178] (-1069.259) -- 0:00:12
802500 -- (-1068.850) [-1070.110] (-1069.182) (-1069.514) * [-1068.408] (-1067.499) (-1068.418) (-1068.374) -- 0:00:12
803000 -- (-1069.018) [-1070.022] (-1070.281) (-1070.826) * [-1068.483] (-1069.366) (-1067.579) (-1066.823) -- 0:00:12
803500 -- (-1067.489) (-1070.935) (-1068.766) [-1070.023] * (-1067.352) [-1068.256] (-1069.005) (-1066.512) -- 0:00:11
804000 -- [-1068.201] (-1070.703) (-1067.362) (-1068.760) * [-1068.885] (-1066.996) (-1067.833) (-1070.679) -- 0:00:11
804500 -- (-1068.593) (-1069.840) (-1066.216) [-1067.996] * (-1068.856) [-1068.575] (-1069.910) (-1066.681) -- 0:00:11
805000 -- (-1067.586) (-1069.291) [-1071.556] (-1068.847) * (-1068.884) (-1069.923) (-1068.022) [-1067.376] -- 0:00:12
Average standard deviation of split frequencies: 0.005447
805500 -- (-1068.264) (-1066.271) (-1073.139) [-1068.444] * (-1069.297) (-1070.068) [-1067.390] (-1068.802) -- 0:00:12
806000 -- (-1068.276) (-1072.296) (-1069.474) [-1068.461] * [-1067.967] (-1074.247) (-1069.413) (-1067.741) -- 0:00:12
806500 -- (-1069.390) (-1070.922) (-1069.130) [-1068.311] * [-1068.790] (-1067.112) (-1066.612) (-1072.484) -- 0:00:11
807000 -- [-1068.668] (-1068.586) (-1067.064) (-1068.881) * (-1070.255) (-1068.812) (-1067.115) [-1068.696] -- 0:00:11
807500 -- [-1068.450] (-1070.222) (-1071.419) (-1067.893) * (-1068.833) [-1068.124] (-1067.183) (-1067.427) -- 0:00:11
808000 -- (-1067.278) (-1069.682) (-1071.998) [-1066.632] * (-1066.608) (-1069.462) (-1068.587) [-1067.657] -- 0:00:11
808500 -- (-1071.062) (-1068.916) [-1070.629] (-1067.638) * (-1067.240) (-1066.717) (-1068.044) [-1067.956] -- 0:00:11
809000 -- (-1069.046) (-1066.094) (-1068.811) [-1068.415] * (-1066.779) [-1066.768] (-1067.936) (-1069.147) -- 0:00:11
809500 -- (-1071.171) [-1065.943] (-1068.830) (-1072.571) * (-1066.950) [-1066.739] (-1067.003) (-1069.065) -- 0:00:11
810000 -- (-1070.866) (-1070.945) [-1069.227] (-1066.601) * (-1066.553) (-1066.352) (-1067.281) [-1067.802] -- 0:00:11
Average standard deviation of split frequencies: 0.005924
810500 -- [-1067.326] (-1073.099) (-1066.909) (-1067.904) * (-1072.480) (-1066.969) (-1066.863) [-1068.732] -- 0:00:11
811000 -- (-1067.362) (-1069.158) (-1069.152) [-1067.669] * (-1069.741) [-1066.242] (-1070.800) (-1069.165) -- 0:00:11
811500 -- (-1068.704) [-1068.321] (-1067.914) (-1066.516) * (-1067.218) (-1068.894) (-1067.363) [-1069.901] -- 0:00:11
812000 -- (-1069.731) [-1067.991] (-1067.702) (-1067.383) * (-1069.522) (-1070.201) (-1068.039) [-1068.144] -- 0:00:11
812500 -- (-1067.180) (-1070.789) (-1070.186) [-1070.875] * (-1068.932) (-1067.423) (-1069.754) [-1068.796] -- 0:00:11
813000 -- (-1067.023) (-1072.947) (-1066.227) [-1070.956] * (-1070.057) (-1066.326) (-1067.927) [-1066.667] -- 0:00:11
813500 -- (-1066.740) [-1069.899] (-1070.831) (-1066.775) * (-1070.052) (-1067.554) (-1069.735) [-1072.050] -- 0:00:11
814000 -- (-1067.635) [-1067.771] (-1068.097) (-1066.408) * [-1066.967] (-1068.846) (-1070.096) (-1071.149) -- 0:00:11
814500 -- (-1070.940) (-1067.951) (-1068.894) [-1066.577] * (-1069.112) (-1066.966) [-1076.342] (-1072.172) -- 0:00:11
815000 -- (-1070.177) (-1067.445) [-1073.432] (-1067.476) * (-1069.024) (-1067.747) [-1070.034] (-1074.394) -- 0:00:11
Average standard deviation of split frequencies: 0.005741
815500 -- (-1068.811) (-1068.020) [-1069.897] (-1067.334) * (-1069.044) (-1067.052) [-1067.826] (-1072.891) -- 0:00:11
816000 -- (-1068.444) [-1068.604] (-1070.840) (-1068.550) * (-1069.663) [-1067.158] (-1067.373) (-1074.223) -- 0:00:11
816500 -- (-1071.231) (-1069.989) [-1067.751] (-1067.745) * [-1066.774] (-1067.158) (-1067.832) (-1074.213) -- 0:00:11
817000 -- (-1071.340) (-1075.709) [-1067.762] (-1067.355) * (-1067.053) (-1067.136) (-1077.332) [-1068.416] -- 0:00:11
817500 -- (-1067.940) [-1066.865] (-1070.862) (-1068.119) * (-1067.917) [-1067.899] (-1072.835) (-1067.511) -- 0:00:11
818000 -- [-1067.193] (-1066.979) (-1070.789) (-1071.503) * [-1066.800] (-1068.472) (-1067.777) (-1068.330) -- 0:00:11
818500 -- [-1066.248] (-1070.435) (-1068.863) (-1069.156) * (-1066.516) (-1072.346) [-1066.785] (-1072.210) -- 0:00:11
819000 -- [-1066.206] (-1067.841) (-1068.399) (-1067.638) * (-1066.743) [-1069.542] (-1067.883) (-1068.580) -- 0:00:11
819500 -- (-1069.258) [-1069.457] (-1069.128) (-1072.317) * [-1069.671] (-1069.729) (-1068.820) (-1066.801) -- 0:00:11
820000 -- (-1068.717) (-1068.518) [-1067.521] (-1070.042) * (-1067.067) (-1067.685) [-1067.318] (-1066.902) -- 0:00:11
Average standard deviation of split frequencies: 0.005816
820500 -- (-1067.131) (-1070.647) (-1066.849) [-1070.747] * (-1067.196) (-1067.935) [-1067.869] (-1068.028) -- 0:00:11
821000 -- (-1070.999) (-1068.596) (-1072.110) [-1068.316] * (-1068.826) [-1067.674] (-1068.605) (-1069.115) -- 0:00:11
821500 -- (-1067.348) (-1067.020) [-1065.970] (-1069.552) * (-1066.520) (-1070.587) (-1068.499) [-1071.898] -- 0:00:11
822000 -- (-1070.228) (-1066.599) [-1066.682] (-1066.759) * [-1066.973] (-1066.378) (-1066.295) (-1071.428) -- 0:00:11
822500 -- (-1068.906) [-1070.212] (-1067.140) (-1068.826) * (-1070.499) (-1069.847) [-1069.127] (-1067.025) -- 0:00:11
823000 -- [-1069.136] (-1072.527) (-1067.132) (-1068.360) * (-1068.927) (-1069.173) [-1067.984] (-1066.967) -- 0:00:10
823500 -- [-1068.112] (-1067.665) (-1069.971) (-1066.940) * (-1068.130) [-1068.592] (-1067.371) (-1067.231) -- 0:00:10
824000 -- (-1067.831) (-1066.721) [-1067.137] (-1066.300) * (-1066.941) [-1067.194] (-1067.160) (-1067.277) -- 0:00:10
824500 -- [-1068.379] (-1068.373) (-1067.820) (-1070.440) * [-1069.184] (-1066.937) (-1069.384) (-1069.613) -- 0:00:10
825000 -- (-1066.118) (-1068.881) (-1067.238) [-1070.433] * (-1071.591) (-1069.024) [-1071.206] (-1067.517) -- 0:00:10
Average standard deviation of split frequencies: 0.005707
825500 -- (-1067.751) (-1067.446) [-1068.823] (-1069.242) * (-1073.066) (-1069.146) (-1070.321) [-1068.635] -- 0:00:10
826000 -- [-1067.160] (-1066.461) (-1068.343) (-1067.908) * (-1071.894) (-1067.554) (-1068.016) [-1068.574] -- 0:00:10
826500 -- (-1069.497) [-1070.372] (-1072.665) (-1073.658) * (-1069.269) (-1068.017) (-1068.339) [-1067.411] -- 0:00:10
827000 -- (-1070.194) [-1066.889] (-1072.884) (-1067.861) * (-1071.117) [-1066.745] (-1067.648) (-1068.320) -- 0:00:10
827500 -- (-1071.290) (-1069.563) (-1069.183) [-1066.440] * [-1068.053] (-1068.888) (-1068.591) (-1067.740) -- 0:00:10
828000 -- [-1070.450] (-1066.624) (-1066.674) (-1066.973) * (-1067.182) (-1066.561) [-1067.499] (-1067.172) -- 0:00:10
828500 -- [-1069.875] (-1069.523) (-1068.439) (-1068.435) * [-1066.287] (-1068.696) (-1069.275) (-1067.982) -- 0:00:10
829000 -- (-1067.436) (-1068.726) (-1067.375) [-1069.534] * (-1066.737) (-1068.262) [-1066.536] (-1066.573) -- 0:00:10
829500 -- (-1068.377) (-1072.235) (-1068.779) [-1067.816] * [-1068.337] (-1074.490) (-1067.785) (-1071.231) -- 0:00:10
830000 -- (-1068.499) (-1069.152) (-1071.532) [-1068.915] * [-1068.864] (-1067.991) (-1067.910) (-1071.557) -- 0:00:10
Average standard deviation of split frequencies: 0.005781
830500 -- (-1068.061) (-1067.922) [-1068.041] (-1068.127) * [-1070.501] (-1070.075) (-1071.292) (-1070.568) -- 0:00:10
831000 -- (-1073.405) [-1068.732] (-1068.710) (-1069.860) * [-1067.755] (-1069.112) (-1070.217) (-1068.486) -- 0:00:10
831500 -- [-1066.992] (-1067.866) (-1070.421) (-1067.760) * (-1066.553) (-1066.887) [-1066.258] (-1070.446) -- 0:00:10
832000 -- [-1067.115] (-1070.093) (-1068.797) (-1068.218) * [-1066.369] (-1066.891) (-1068.373) (-1069.290) -- 0:00:10
832500 -- (-1068.560) [-1068.972] (-1069.792) (-1068.774) * [-1068.049] (-1066.976) (-1068.872) (-1067.903) -- 0:00:10
833000 -- (-1066.962) (-1068.990) [-1068.239] (-1068.986) * [-1070.371] (-1067.633) (-1070.225) (-1072.002) -- 0:00:10
833500 -- (-1068.053) (-1068.094) [-1068.220] (-1073.609) * (-1069.502) [-1069.554] (-1068.620) (-1069.903) -- 0:00:10
834000 -- (-1069.301) (-1067.673) (-1067.540) [-1068.439] * (-1070.207) [-1068.919] (-1071.705) (-1068.940) -- 0:00:10
834500 -- (-1069.128) (-1072.678) [-1068.380] (-1066.345) * (-1070.703) [-1068.963] (-1069.136) (-1069.312) -- 0:00:10
835000 -- (-1067.203) [-1068.385] (-1067.509) (-1068.483) * (-1067.324) (-1068.947) (-1067.667) [-1068.042] -- 0:00:10
Average standard deviation of split frequencies: 0.005956
835500 -- (-1066.918) [-1069.863] (-1072.623) (-1069.389) * (-1069.349) (-1069.921) (-1069.694) [-1068.067] -- 0:00:10
836000 -- (-1076.178) (-1068.718) [-1068.530] (-1069.689) * (-1068.472) (-1066.550) [-1072.100] (-1071.909) -- 0:00:10
836500 -- (-1068.094) (-1068.481) [-1070.564] (-1068.751) * (-1070.457) (-1068.226) (-1070.818) [-1068.147] -- 0:00:10
837000 -- (-1067.675) [-1067.229] (-1067.433) (-1071.247) * (-1067.272) (-1069.352) (-1069.714) [-1068.216] -- 0:00:10
837500 -- (-1066.250) (-1067.205) [-1069.527] (-1069.100) * (-1066.334) (-1068.382) [-1068.945] (-1068.855) -- 0:00:10
838000 -- [-1069.106] (-1066.571) (-1069.204) (-1068.182) * [-1067.119] (-1066.725) (-1069.759) (-1069.654) -- 0:00:10
838500 -- (-1072.395) (-1068.660) (-1071.514) [-1069.019] * (-1066.284) (-1067.039) (-1070.567) [-1067.527] -- 0:00:10
839000 -- (-1072.732) [-1068.570] (-1068.053) (-1066.951) * (-1069.594) [-1067.249] (-1067.965) (-1069.954) -- 0:00:09
839500 -- (-1073.763) (-1069.634) (-1068.016) [-1066.803] * (-1067.109) (-1067.203) (-1067.975) [-1068.467] -- 0:00:09
840000 -- [-1068.245] (-1068.077) (-1073.291) (-1070.026) * [-1067.177] (-1066.599) (-1068.377) (-1070.112) -- 0:00:09
Average standard deviation of split frequencies: 0.006343
840500 -- [-1067.131] (-1066.530) (-1074.117) (-1070.000) * (-1070.989) (-1067.194) (-1072.051) [-1069.259] -- 0:00:09
841000 -- [-1066.904] (-1067.595) (-1069.432) (-1071.374) * (-1067.975) (-1068.567) (-1070.762) [-1066.506] -- 0:00:09
841500 -- (-1071.876) (-1068.399) (-1068.124) [-1070.794] * (-1066.934) [-1067.298] (-1067.648) (-1066.288) -- 0:00:09
842000 -- (-1071.264) [-1068.024] (-1068.921) (-1068.880) * (-1068.603) (-1066.680) (-1068.160) [-1069.563] -- 0:00:09
842500 -- (-1070.011) (-1068.594) [-1067.439] (-1070.460) * (-1073.139) (-1069.661) (-1068.145) [-1072.384] -- 0:00:09
843000 -- (-1069.864) (-1069.322) [-1067.432] (-1070.532) * (-1071.121) (-1066.635) [-1067.394] (-1068.160) -- 0:00:09
843500 -- (-1068.023) (-1071.069) [-1066.087] (-1070.479) * (-1071.511) [-1069.292] (-1067.495) (-1067.584) -- 0:00:09
844000 -- (-1068.536) (-1067.866) (-1069.004) [-1068.620] * (-1066.910) [-1067.672] (-1069.588) (-1067.820) -- 0:00:09
844500 -- [-1068.358] (-1071.447) (-1067.848) (-1066.552) * [-1066.763] (-1069.793) (-1071.484) (-1070.347) -- 0:00:09
845000 -- (-1071.647) (-1068.438) (-1066.040) [-1069.089] * [-1068.879] (-1067.482) (-1073.045) (-1071.770) -- 0:00:09
Average standard deviation of split frequencies: 0.006304
845500 -- (-1071.779) [-1069.547] (-1066.044) (-1070.866) * (-1070.081) [-1067.529] (-1070.124) (-1069.166) -- 0:00:09
846000 -- (-1069.174) [-1069.284] (-1067.253) (-1069.899) * (-1072.382) (-1067.346) (-1068.779) [-1067.433] -- 0:00:09
846500 -- (-1069.022) [-1068.064] (-1066.878) (-1069.053) * (-1070.452) [-1067.083] (-1067.764) (-1068.176) -- 0:00:09
847000 -- (-1070.749) (-1068.600) (-1068.181) [-1067.924] * (-1067.677) (-1067.101) (-1071.262) [-1068.710] -- 0:00:09
847500 -- (-1066.936) (-1069.986) [-1069.418] (-1069.541) * (-1066.645) (-1067.225) [-1071.406] (-1066.616) -- 0:00:09
848000 -- (-1069.319) [-1067.053] (-1071.000) (-1067.495) * (-1066.901) (-1066.790) (-1070.237) [-1069.361] -- 0:00:09
848500 -- [-1070.703] (-1070.403) (-1069.939) (-1068.186) * [-1068.138] (-1067.520) (-1070.655) (-1068.304) -- 0:00:09
849000 -- (-1068.346) (-1070.934) [-1068.913] (-1070.734) * [-1066.858] (-1070.252) (-1066.284) (-1069.993) -- 0:00:09
849500 -- (-1069.115) [-1067.444] (-1066.364) (-1069.430) * (-1068.678) (-1067.833) (-1066.590) [-1067.452] -- 0:00:09
850000 -- (-1066.492) (-1072.287) (-1070.261) [-1068.138] * [-1067.367] (-1068.002) (-1069.499) (-1067.926) -- 0:00:09
Average standard deviation of split frequencies: 0.005957
850500 -- [-1066.934] (-1067.313) (-1073.431) (-1073.071) * (-1068.367) (-1069.159) (-1070.317) [-1070.966] -- 0:00:09
851000 -- (-1068.317) [-1069.109] (-1079.078) (-1066.854) * (-1069.288) (-1068.925) [-1069.388] (-1071.717) -- 0:00:09
851500 -- (-1067.435) (-1070.031) [-1067.599] (-1067.200) * (-1070.991) [-1067.381] (-1067.532) (-1068.520) -- 0:00:09
852000 -- (-1067.639) (-1069.282) [-1067.083] (-1066.240) * (-1066.951) (-1069.629) [-1066.914] (-1066.213) -- 0:00:09
852500 -- [-1066.684] (-1069.143) (-1069.572) (-1068.299) * (-1067.547) [-1070.667] (-1068.177) (-1066.834) -- 0:00:09
853000 -- (-1068.013) [-1069.372] (-1067.326) (-1069.219) * (-1067.404) (-1068.382) (-1067.714) [-1070.573] -- 0:00:09
853500 -- (-1068.707) [-1070.471] (-1069.251) (-1069.264) * (-1072.482) [-1066.260] (-1068.453) (-1066.480) -- 0:00:09
854000 -- [-1071.549] (-1073.928) (-1067.861) (-1072.321) * (-1068.897) [-1066.235] (-1069.271) (-1066.656) -- 0:00:09
854500 -- (-1072.319) [-1068.917] (-1066.872) (-1067.539) * (-1068.840) [-1069.241] (-1071.467) (-1066.912) -- 0:00:09
855000 -- [-1068.626] (-1069.696) (-1066.523) (-1068.407) * (-1066.358) [-1067.108] (-1066.488) (-1066.921) -- 0:00:08
Average standard deviation of split frequencies: 0.005714
855500 -- (-1070.205) [-1070.482] (-1068.260) (-1070.628) * [-1066.741] (-1066.046) (-1068.639) (-1068.986) -- 0:00:08
856000 -- (-1068.545) (-1067.743) (-1067.894) [-1067.329] * [-1073.010] (-1066.638) (-1069.052) (-1068.102) -- 0:00:08
856500 -- (-1067.601) [-1067.802] (-1067.943) (-1069.287) * (-1070.025) (-1069.745) (-1069.901) [-1067.738] -- 0:00:08
857000 -- [-1067.506] (-1067.066) (-1067.025) (-1067.183) * (-1069.515) (-1071.581) (-1066.490) [-1066.993] -- 0:00:08
857500 -- (-1068.255) [-1069.936] (-1067.819) (-1068.391) * (-1067.477) (-1067.386) [-1069.283] (-1070.300) -- 0:00:08
858000 -- [-1067.432] (-1070.139) (-1070.413) (-1067.449) * (-1067.881) [-1066.987] (-1066.899) (-1068.322) -- 0:00:08
858500 -- (-1067.941) (-1069.320) (-1071.405) [-1066.806] * (-1070.985) (-1069.180) [-1068.144] (-1067.173) -- 0:00:08
859000 -- (-1068.124) (-1068.427) [-1069.196] (-1067.223) * (-1068.630) (-1067.429) (-1066.862) [-1067.263] -- 0:00:08
859500 -- (-1068.198) (-1069.483) (-1070.369) [-1066.941] * (-1068.081) (-1070.521) [-1066.459] (-1069.453) -- 0:00:08
860000 -- (-1069.841) (-1067.150) [-1068.766] (-1067.734) * [-1068.731] (-1070.832) (-1067.224) (-1068.991) -- 0:00:08
Average standard deviation of split frequencies: 0.005751
860500 -- (-1070.369) (-1073.102) [-1066.911] (-1067.193) * (-1069.019) [-1068.181] (-1067.224) (-1067.944) -- 0:00:08
861000 -- (-1070.405) [-1068.052] (-1069.244) (-1069.274) * (-1071.230) (-1066.276) (-1066.965) [-1067.245] -- 0:00:08
861500 -- [-1069.248] (-1066.546) (-1068.762) (-1070.172) * (-1069.075) (-1068.776) [-1067.066] (-1068.164) -- 0:00:08
862000 -- [-1066.566] (-1068.449) (-1071.912) (-1068.176) * (-1068.568) (-1067.405) (-1068.334) [-1068.141] -- 0:00:08
862500 -- (-1068.816) (-1067.268) [-1067.901] (-1069.429) * [-1067.709] (-1068.193) (-1069.249) (-1071.364) -- 0:00:08
863000 -- (-1069.322) [-1066.959] (-1066.416) (-1067.940) * [-1067.500] (-1070.312) (-1068.039) (-1067.243) -- 0:00:08
863500 -- (-1068.866) [-1067.767] (-1067.394) (-1070.134) * (-1067.642) (-1068.115) (-1069.286) [-1067.243] -- 0:00:08
864000 -- (-1069.462) (-1068.782) [-1067.495] (-1068.180) * (-1066.805) [-1067.891] (-1066.243) (-1067.362) -- 0:00:08
864500 -- (-1068.915) (-1068.777) [-1068.791] (-1067.012) * [-1067.965] (-1070.103) (-1069.974) (-1068.149) -- 0:00:08
865000 -- [-1068.389] (-1067.274) (-1068.286) (-1068.572) * (-1067.620) (-1067.290) (-1068.611) [-1070.179] -- 0:00:08
Average standard deviation of split frequencies: 0.005954
865500 -- [-1068.712] (-1067.560) (-1068.552) (-1070.979) * (-1069.752) [-1068.987] (-1068.684) (-1073.771) -- 0:00:08
866000 -- (-1068.454) (-1073.019) (-1069.680) [-1071.615] * (-1066.785) (-1068.588) [-1067.705] (-1073.553) -- 0:00:08
866500 -- [-1067.383] (-1066.420) (-1066.628) (-1067.707) * (-1066.638) (-1067.142) (-1067.515) [-1068.918] -- 0:00:08
867000 -- (-1066.719) [-1068.619] (-1067.819) (-1067.475) * [-1066.423] (-1068.966) (-1066.882) (-1067.722) -- 0:00:08
867500 -- (-1066.978) (-1071.460) (-1067.109) [-1068.141] * (-1069.730) (-1068.401) (-1066.715) [-1067.948] -- 0:00:08
868000 -- [-1068.404] (-1067.427) (-1066.754) (-1068.782) * (-1068.972) (-1067.992) [-1067.340] (-1066.155) -- 0:00:08
868500 -- [-1067.725] (-1068.408) (-1068.604) (-1067.718) * (-1067.111) [-1068.328] (-1069.142) (-1067.167) -- 0:00:08
869000 -- (-1068.338) (-1067.088) (-1068.888) [-1066.907] * (-1068.830) [-1067.314] (-1071.543) (-1069.507) -- 0:00:08
869500 -- (-1068.347) (-1067.959) (-1073.850) [-1069.328] * [-1067.089] (-1067.036) (-1066.905) (-1068.241) -- 0:00:08
870000 -- (-1067.415) (-1067.249) [-1066.628] (-1066.199) * (-1066.849) (-1066.489) (-1071.773) [-1070.282] -- 0:00:08
Average standard deviation of split frequencies: 0.006396
870500 -- (-1066.767) (-1067.954) (-1067.383) [-1070.498] * [-1069.210] (-1067.536) (-1066.642) (-1073.247) -- 0:00:08
871000 -- [-1066.619] (-1067.136) (-1072.518) (-1070.091) * (-1067.958) [-1066.482] (-1070.235) (-1071.358) -- 0:00:07
871500 -- [-1067.573] (-1069.155) (-1067.256) (-1067.439) * [-1067.609] (-1070.081) (-1067.308) (-1068.311) -- 0:00:07
872000 -- (-1066.201) (-1066.992) [-1066.740] (-1069.368) * (-1068.169) (-1070.721) [-1068.295] (-1067.044) -- 0:00:07
872500 -- [-1066.039] (-1068.298) (-1069.770) (-1067.113) * (-1069.775) (-1068.896) (-1069.280) [-1067.642] -- 0:00:07
873000 -- [-1066.533] (-1067.580) (-1067.180) (-1067.251) * (-1073.080) (-1067.710) (-1067.319) [-1068.274] -- 0:00:07
873500 -- (-1066.418) [-1067.958] (-1067.637) (-1068.729) * [-1069.080] (-1068.632) (-1070.230) (-1072.092) -- 0:00:07
874000 -- (-1069.278) (-1070.255) [-1067.005] (-1070.239) * (-1068.711) [-1069.602] (-1074.421) (-1069.629) -- 0:00:07
874500 -- (-1071.009) [-1068.670] (-1074.422) (-1067.140) * (-1076.549) (-1069.852) (-1071.171) [-1070.240] -- 0:00:07
875000 -- [-1066.830] (-1070.525) (-1070.776) (-1068.632) * (-1070.093) (-1067.268) [-1069.042] (-1067.175) -- 0:00:07
Average standard deviation of split frequencies: 0.006222
875500 -- (-1071.083) [-1072.205] (-1070.812) (-1071.780) * [-1067.401] (-1070.948) (-1068.814) (-1067.031) -- 0:00:07
876000 -- (-1068.716) [-1072.630] (-1067.710) (-1073.506) * (-1066.260) [-1067.733] (-1066.811) (-1068.016) -- 0:00:07
876500 -- (-1069.614) [-1066.593] (-1067.573) (-1072.127) * (-1066.833) (-1069.475) [-1067.445] (-1068.054) -- 0:00:07
877000 -- (-1068.432) (-1067.253) (-1069.924) [-1072.798] * (-1070.077) (-1068.040) [-1066.370] (-1066.146) -- 0:00:07
877500 -- (-1068.772) (-1067.732) (-1069.167) [-1069.754] * [-1069.261] (-1071.263) (-1066.828) (-1067.367) -- 0:00:07
878000 -- (-1068.459) (-1066.128) (-1069.408) [-1069.631] * (-1069.690) (-1071.114) [-1069.202] (-1071.497) -- 0:00:07
878500 -- (-1071.419) (-1070.545) [-1070.225] (-1074.616) * (-1068.094) [-1068.102] (-1071.947) (-1070.876) -- 0:00:07
879000 -- (-1069.858) (-1070.504) (-1069.391) [-1069.880] * (-1068.195) [-1067.206] (-1071.977) (-1069.422) -- 0:00:07
879500 -- (-1067.919) (-1070.832) [-1066.808] (-1068.561) * [-1067.090] (-1073.660) (-1068.971) (-1069.851) -- 0:00:07
880000 -- (-1072.112) (-1068.255) (-1068.097) [-1067.424] * (-1074.164) [-1068.342] (-1069.640) (-1072.192) -- 0:00:07
Average standard deviation of split frequencies: 0.006290
880500 -- [-1068.574] (-1068.693) (-1069.438) (-1066.946) * (-1072.812) [-1067.886] (-1067.135) (-1067.256) -- 0:00:07
881000 -- (-1070.050) [-1073.872] (-1068.760) (-1066.366) * [-1066.853] (-1070.349) (-1068.447) (-1069.228) -- 0:00:07
881500 -- (-1070.476) [-1069.035] (-1068.919) (-1067.357) * (-1068.575) (-1069.403) (-1066.916) [-1070.178] -- 0:00:07
882000 -- [-1067.759] (-1067.939) (-1069.097) (-1068.831) * (-1067.195) (-1067.694) [-1067.303] (-1073.137) -- 0:00:07
882500 -- (-1069.582) [-1068.259] (-1066.950) (-1067.699) * [-1068.228] (-1066.441) (-1069.050) (-1068.086) -- 0:00:07
883000 -- [-1067.082] (-1068.374) (-1067.710) (-1070.059) * [-1070.014] (-1073.987) (-1067.426) (-1066.644) -- 0:00:07
883500 -- [-1067.783] (-1066.740) (-1068.915) (-1071.312) * (-1074.001) (-1073.139) (-1070.454) [-1067.733] -- 0:00:07
884000 -- (-1068.361) [-1067.170] (-1067.463) (-1066.816) * (-1070.720) [-1070.649] (-1071.384) (-1069.435) -- 0:00:07
884500 -- (-1070.169) (-1071.786) (-1067.192) [-1066.222] * (-1068.813) (-1071.397) [-1070.358] (-1067.855) -- 0:00:07
885000 -- (-1070.394) (-1070.015) (-1068.812) [-1067.470] * (-1070.794) [-1068.354] (-1068.459) (-1069.691) -- 0:00:07
Average standard deviation of split frequencies: 0.005952
885500 -- (-1067.861) [-1068.625] (-1068.359) (-1068.342) * (-1068.664) [-1066.427] (-1069.507) (-1068.369) -- 0:00:07
886000 -- (-1066.407) [-1068.477] (-1066.587) (-1069.378) * [-1066.578] (-1067.313) (-1068.527) (-1068.275) -- 0:00:07
886500 -- (-1066.801) (-1068.088) (-1068.988) [-1067.285] * (-1070.925) (-1066.647) [-1068.545] (-1069.644) -- 0:00:07
887000 -- (-1068.887) (-1069.142) [-1066.997] (-1068.054) * (-1069.745) (-1067.064) [-1068.970] (-1067.442) -- 0:00:07
887500 -- [-1066.826] (-1067.176) (-1067.577) (-1068.132) * (-1070.190) (-1067.135) [-1066.717] (-1068.624) -- 0:00:06
888000 -- (-1067.111) [-1067.436] (-1070.093) (-1069.563) * (-1067.836) (-1067.164) (-1068.607) [-1068.033] -- 0:00:06
888500 -- [-1066.446] (-1067.217) (-1070.043) (-1068.595) * (-1067.096) [-1068.876] (-1068.170) (-1067.796) -- 0:00:06
889000 -- (-1066.512) (-1066.948) [-1070.209] (-1068.351) * (-1068.222) [-1070.669] (-1069.359) (-1069.212) -- 0:00:06
889500 -- (-1067.718) [-1069.146] (-1073.492) (-1070.113) * (-1066.786) (-1067.755) [-1068.460] (-1068.544) -- 0:00:06
890000 -- (-1066.432) (-1066.072) (-1069.052) [-1069.603] * (-1068.104) [-1067.223] (-1067.622) (-1072.931) -- 0:00:06
Average standard deviation of split frequencies: 0.005363
890500 -- (-1068.307) (-1067.062) [-1068.103] (-1070.508) * (-1068.071) [-1067.189] (-1068.179) (-1067.768) -- 0:00:06
891000 -- (-1068.479) [-1069.929] (-1066.464) (-1068.018) * (-1068.314) [-1066.054] (-1070.541) (-1069.750) -- 0:00:06
891500 -- (-1068.697) (-1070.739) [-1066.444] (-1070.092) * (-1071.100) (-1067.496) [-1069.605] (-1066.761) -- 0:00:06
892000 -- (-1067.950) (-1066.040) [-1066.104] (-1066.575) * (-1072.139) (-1069.014) (-1069.993) [-1067.009] -- 0:00:06
892500 -- [-1066.535] (-1069.114) (-1073.961) (-1066.401) * (-1068.119) [-1069.875] (-1068.932) (-1067.974) -- 0:00:06
893000 -- (-1070.642) (-1067.067) (-1068.048) [-1066.499] * (-1070.258) (-1071.077) (-1068.185) [-1067.286] -- 0:00:06
893500 -- (-1069.509) (-1067.136) [-1068.826] (-1069.535) * (-1066.999) (-1073.446) [-1071.106] (-1069.602) -- 0:00:06
894000 -- [-1071.124] (-1071.955) (-1067.251) (-1069.853) * [-1066.372] (-1073.285) (-1069.937) (-1066.758) -- 0:00:06
894500 -- [-1068.288] (-1067.573) (-1066.830) (-1067.923) * [-1066.286] (-1066.820) (-1069.472) (-1066.468) -- 0:00:06
895000 -- (-1069.272) (-1066.510) (-1066.496) [-1067.863] * (-1067.067) (-1071.343) (-1066.363) [-1066.773] -- 0:00:06
Average standard deviation of split frequencies: 0.005051
895500 -- (-1068.273) (-1067.040) [-1070.323] (-1067.619) * (-1066.769) [-1068.343] (-1067.361) (-1068.763) -- 0:00:06
896000 -- [-1072.299] (-1071.782) (-1072.129) (-1075.424) * (-1066.449) (-1067.149) [-1067.809] (-1069.832) -- 0:00:06
896500 -- (-1067.556) [-1069.210] (-1071.910) (-1067.208) * (-1067.261) (-1068.657) (-1067.748) [-1069.805] -- 0:00:06
897000 -- (-1070.425) (-1067.727) (-1069.544) [-1066.543] * (-1067.658) [-1067.980] (-1067.297) (-1068.550) -- 0:00:06
897500 -- (-1066.607) (-1071.909) (-1068.466) [-1070.901] * [-1069.832] (-1071.778) (-1068.332) (-1067.127) -- 0:00:06
898000 -- (-1068.511) (-1070.418) [-1068.200] (-1067.899) * (-1067.588) (-1081.444) [-1067.360] (-1067.529) -- 0:00:06
898500 -- [-1069.041] (-1068.390) (-1069.094) (-1068.731) * (-1067.565) [-1069.094] (-1068.951) (-1070.841) -- 0:00:06
899000 -- (-1070.410) (-1067.557) (-1068.895) [-1067.708] * (-1068.197) [-1068.504] (-1069.333) (-1073.284) -- 0:00:06
899500 -- [-1067.584] (-1068.236) (-1070.360) (-1070.994) * (-1067.891) (-1067.918) [-1067.718] (-1068.720) -- 0:00:06
900000 -- (-1069.033) (-1070.379) [-1068.618] (-1067.966) * (-1067.929) [-1069.666] (-1070.648) (-1067.833) -- 0:00:06
Average standard deviation of split frequencies: 0.005548
900500 -- (-1068.406) (-1067.394) (-1067.262) [-1068.291] * (-1068.478) [-1066.863] (-1070.187) (-1069.170) -- 0:00:06
901000 -- (-1068.214) [-1066.962] (-1069.905) (-1066.373) * (-1069.048) [-1066.294] (-1067.347) (-1073.992) -- 0:00:06
901500 -- (-1067.834) (-1067.915) (-1067.436) [-1067.176] * (-1070.596) (-1066.433) [-1068.393] (-1073.954) -- 0:00:06
902000 -- (-1067.921) (-1070.239) [-1069.450] (-1070.086) * [-1069.175] (-1068.212) (-1067.260) (-1069.607) -- 0:00:06
902500 -- [-1067.780] (-1068.790) (-1067.996) (-1069.985) * (-1068.981) (-1067.366) [-1067.861] (-1069.103) -- 0:00:06
903000 -- (-1067.662) (-1071.033) (-1067.558) [-1068.673] * (-1067.828) (-1069.057) [-1066.423] (-1066.876) -- 0:00:06
903500 -- (-1068.411) [-1072.056] (-1068.659) (-1067.908) * [-1071.552] (-1068.329) (-1068.723) (-1069.368) -- 0:00:05
904000 -- (-1070.443) [-1070.106] (-1069.230) (-1067.972) * (-1066.834) (-1070.699) (-1066.736) [-1067.858] -- 0:00:05
904500 -- (-1067.576) [-1066.906] (-1067.262) (-1068.264) * (-1067.264) [-1066.919] (-1069.216) (-1069.807) -- 0:00:05
905000 -- (-1067.907) (-1067.151) (-1067.248) [-1067.387] * (-1069.741) (-1067.548) (-1071.450) [-1069.444] -- 0:00:05
Average standard deviation of split frequencies: 0.005585
905500 -- (-1073.493) (-1067.140) [-1067.111] (-1067.296) * [-1067.619] (-1068.523) (-1069.775) (-1080.580) -- 0:00:05
906000 -- (-1068.348) (-1068.192) [-1066.945] (-1071.010) * (-1068.117) [-1069.502] (-1071.000) (-1067.355) -- 0:00:05
906500 -- (-1067.277) [-1068.598] (-1069.189) (-1066.833) * (-1069.204) (-1069.161) (-1068.143) [-1066.911] -- 0:00:05
907000 -- (-1070.336) (-1073.527) (-1067.441) [-1066.812] * (-1067.049) (-1070.442) [-1066.531] (-1066.860) -- 0:00:05
907500 -- (-1076.271) [-1071.522] (-1068.895) (-1070.877) * (-1068.510) [-1067.979] (-1068.801) (-1069.184) -- 0:00:05
908000 -- (-1074.159) (-1068.316) [-1065.875] (-1072.924) * (-1068.473) (-1076.260) (-1066.395) [-1065.887] -- 0:00:05
908500 -- (-1070.457) (-1066.207) [-1068.132] (-1070.046) * [-1067.541] (-1071.769) (-1067.260) (-1066.439) -- 0:00:05
909000 -- (-1067.703) [-1066.476] (-1066.550) (-1069.207) * (-1070.376) (-1070.318) [-1068.671] (-1067.956) -- 0:00:05
909500 -- (-1067.402) (-1066.649) [-1066.853] (-1069.754) * (-1070.535) [-1071.393] (-1070.016) (-1069.065) -- 0:00:05
910000 -- (-1070.055) [-1068.836] (-1067.464) (-1066.680) * [-1066.551] (-1070.595) (-1067.622) (-1068.372) -- 0:00:05
Average standard deviation of split frequencies: 0.005867
910500 -- (-1067.970) (-1069.934) (-1069.670) [-1067.194] * [-1066.182] (-1074.917) (-1066.611) (-1068.906) -- 0:00:05
911000 -- (-1069.287) (-1067.692) [-1067.825] (-1069.097) * (-1066.210) [-1069.902] (-1067.520) (-1068.299) -- 0:00:05
911500 -- [-1068.695] (-1067.090) (-1067.524) (-1071.147) * (-1067.201) (-1068.507) (-1066.520) [-1066.116] -- 0:00:05
912000 -- (-1068.309) (-1068.311) [-1067.460] (-1068.210) * (-1067.925) [-1071.087] (-1066.688) (-1068.049) -- 0:00:05
912500 -- (-1069.499) [-1069.247] (-1067.514) (-1068.780) * (-1066.703) (-1071.580) [-1067.548] (-1066.849) -- 0:00:05
913000 -- (-1068.308) [-1068.264] (-1067.896) (-1069.282) * (-1067.998) (-1067.571) [-1068.755] (-1067.529) -- 0:00:05
913500 -- (-1067.212) [-1070.218] (-1066.780) (-1066.281) * (-1068.738) [-1068.492] (-1069.004) (-1068.096) -- 0:00:05
914000 -- (-1067.761) (-1067.730) (-1066.169) [-1070.309] * (-1068.547) [-1066.491] (-1067.327) (-1068.591) -- 0:00:05
914500 -- (-1068.274) [-1070.886] (-1068.754) (-1070.009) * [-1067.331] (-1068.391) (-1067.010) (-1072.327) -- 0:00:05
915000 -- (-1067.681) [-1071.820] (-1068.866) (-1070.668) * (-1066.569) (-1070.990) [-1067.286] (-1066.355) -- 0:00:05
Average standard deviation of split frequencies: 0.005935
915500 -- (-1069.204) (-1069.222) [-1070.941] (-1074.521) * (-1066.698) (-1069.015) (-1069.424) [-1066.921] -- 0:00:05
916000 -- (-1068.810) (-1067.569) (-1067.003) [-1072.527] * [-1066.624] (-1069.073) (-1066.902) (-1067.536) -- 0:00:05
916500 -- (-1067.238) (-1067.238) [-1066.657] (-1070.772) * (-1067.433) (-1066.907) [-1069.944] (-1068.933) -- 0:00:05
917000 -- (-1065.912) (-1068.076) (-1069.688) [-1066.740] * (-1070.373) [-1067.652] (-1071.520) (-1070.181) -- 0:00:05
917500 -- (-1070.612) (-1067.796) (-1069.823) [-1070.120] * (-1069.549) [-1067.785] (-1069.910) (-1067.350) -- 0:00:05
918000 -- (-1068.852) (-1070.553) [-1068.589] (-1067.834) * [-1069.984] (-1069.411) (-1068.385) (-1069.357) -- 0:00:05
918500 -- (-1069.342) (-1067.633) (-1067.318) [-1069.617] * (-1068.107) (-1067.645) [-1072.181] (-1066.767) -- 0:00:05
919000 -- [-1068.105] (-1067.640) (-1069.631) (-1067.683) * (-1070.077) (-1069.458) [-1067.307] (-1066.630) -- 0:00:05
919500 -- [-1069.411] (-1066.842) (-1066.003) (-1069.960) * (-1074.525) (-1069.360) (-1068.032) [-1070.988] -- 0:00:04
920000 -- (-1067.811) [-1066.842] (-1068.154) (-1070.529) * (-1069.604) (-1069.918) [-1067.133] (-1070.100) -- 0:00:04
Average standard deviation of split frequencies: 0.006178
920500 -- (-1068.072) [-1067.102] (-1066.965) (-1070.887) * (-1072.789) [-1068.234] (-1066.086) (-1073.939) -- 0:00:04
921000 -- (-1069.697) [-1066.881] (-1067.502) (-1069.102) * [-1067.300] (-1066.834) (-1068.346) (-1069.747) -- 0:00:04
921500 -- (-1068.997) [-1069.438] (-1066.377) (-1067.387) * (-1070.144) [-1068.211] (-1068.950) (-1067.739) -- 0:00:04
922000 -- (-1066.563) (-1067.449) [-1067.170] (-1066.764) * (-1070.710) [-1067.354] (-1067.546) (-1072.211) -- 0:00:04
922500 -- (-1066.721) [-1067.407] (-1069.365) (-1067.093) * (-1069.369) (-1070.660) [-1067.549] (-1069.940) -- 0:00:04
923000 -- [-1070.425] (-1068.293) (-1068.566) (-1069.369) * [-1066.576] (-1066.809) (-1067.464) (-1068.412) -- 0:00:04
923500 -- (-1069.990) (-1070.210) (-1068.725) [-1068.607] * (-1067.184) [-1066.695] (-1069.712) (-1067.902) -- 0:00:04
924000 -- (-1071.745) (-1067.657) [-1067.048] (-1070.701) * (-1068.302) (-1067.938) (-1067.954) [-1067.844] -- 0:00:04
924500 -- (-1068.821) (-1067.157) [-1069.182] (-1067.603) * (-1068.767) (-1067.363) (-1068.165) [-1067.901] -- 0:00:04
925000 -- (-1072.891) (-1068.518) [-1069.205] (-1069.249) * (-1070.671) [-1067.281] (-1070.943) (-1069.767) -- 0:00:04
Average standard deviation of split frequencies: 0.005905
925500 -- (-1066.306) [-1067.460] (-1068.919) (-1068.503) * (-1069.864) (-1069.955) (-1066.699) [-1069.900] -- 0:00:04
926000 -- (-1069.860) [-1066.226] (-1071.017) (-1067.773) * (-1066.871) (-1067.966) [-1068.602] (-1066.943) -- 0:00:04
926500 -- (-1071.157) (-1067.209) (-1068.642) [-1068.315] * (-1068.200) [-1068.201] (-1075.653) (-1066.335) -- 0:00:04
927000 -- (-1070.695) [-1067.595] (-1066.424) (-1067.875) * (-1068.342) (-1072.205) (-1069.039) [-1066.498] -- 0:00:04
927500 -- (-1067.563) (-1068.560) (-1067.054) [-1067.695] * (-1068.621) (-1072.575) (-1072.695) [-1066.398] -- 0:00:04
928000 -- (-1067.404) [-1067.608] (-1069.494) (-1069.714) * (-1068.453) (-1067.476) (-1067.797) [-1066.515] -- 0:00:04
928500 -- (-1067.142) (-1069.821) (-1068.653) [-1069.450] * (-1070.117) [-1067.580] (-1067.288) (-1068.478) -- 0:00:04
929000 -- (-1067.821) [-1068.849] (-1068.314) (-1070.616) * (-1069.984) [-1068.103] (-1067.782) (-1070.008) -- 0:00:04
929500 -- (-1068.520) [-1067.232] (-1070.125) (-1070.673) * (-1068.614) (-1072.033) [-1071.725] (-1070.396) -- 0:00:04
930000 -- (-1068.271) (-1073.668) (-1071.413) [-1072.106] * (-1072.388) (-1070.757) [-1067.496] (-1073.396) -- 0:00:04
Average standard deviation of split frequencies: 0.006011
930500 -- [-1068.511] (-1068.173) (-1070.693) (-1067.530) * (-1070.113) (-1067.195) [-1066.535] (-1067.048) -- 0:00:04
931000 -- (-1066.234) (-1067.578) [-1068.111] (-1066.297) * (-1071.276) [-1067.631] (-1066.845) (-1067.637) -- 0:00:04
931500 -- (-1066.488) [-1069.787] (-1068.243) (-1066.822) * [-1068.127] (-1069.367) (-1070.504) (-1067.899) -- 0:00:04
932000 -- (-1067.841) (-1074.021) (-1067.620) [-1067.562] * (-1068.518) [-1068.941] (-1068.462) (-1068.211) -- 0:00:04
932500 -- (-1067.321) (-1066.917) (-1068.388) [-1068.448] * [-1068.328] (-1068.935) (-1067.427) (-1070.106) -- 0:00:04
933000 -- (-1069.428) [-1069.451] (-1068.266) (-1068.969) * [-1068.610] (-1070.434) (-1068.562) (-1069.067) -- 0:00:04
933500 -- (-1069.547) [-1069.253] (-1071.730) (-1067.289) * [-1069.428] (-1068.456) (-1067.442) (-1070.975) -- 0:00:04
934000 -- (-1067.343) (-1070.194) (-1067.522) [-1066.922] * [-1069.547] (-1070.614) (-1067.603) (-1073.776) -- 0:00:04
934500 -- (-1067.794) (-1069.385) (-1070.163) [-1067.772] * (-1068.160) (-1069.137) (-1069.059) [-1067.326] -- 0:00:04
935000 -- [-1067.966] (-1072.342) (-1068.689) (-1068.454) * (-1067.312) [-1068.971] (-1070.979) (-1068.903) -- 0:00:04
Average standard deviation of split frequencies: 0.006178
935500 -- (-1066.749) (-1067.583) [-1068.072] (-1067.726) * (-1070.839) [-1066.969] (-1069.462) (-1066.634) -- 0:00:03
936000 -- (-1069.160) (-1069.999) [-1067.023] (-1067.242) * (-1071.304) [-1072.539] (-1068.072) (-1067.166) -- 0:00:03
936500 -- (-1067.768) (-1069.317) (-1067.647) [-1068.515] * (-1075.285) (-1071.769) [-1066.770] (-1067.500) -- 0:00:03
937000 -- (-1067.183) (-1068.920) [-1068.735] (-1067.412) * (-1070.343) (-1067.659) (-1067.615) [-1067.203] -- 0:00:03
937500 -- (-1067.050) (-1069.112) [-1073.421] (-1071.901) * [-1069.963] (-1068.310) (-1067.676) (-1070.190) -- 0:00:03
938000 -- (-1070.380) (-1070.663) (-1070.524) [-1067.694] * [-1072.637] (-1069.023) (-1066.352) (-1067.741) -- 0:00:03
938500 -- (-1067.236) (-1067.672) [-1067.983] (-1072.196) * [-1068.476] (-1070.305) (-1068.205) (-1067.485) -- 0:00:03
939000 -- (-1070.287) (-1068.117) (-1067.471) [-1068.640] * (-1067.967) (-1069.413) [-1066.384] (-1068.066) -- 0:00:03
939500 -- (-1067.886) (-1068.030) (-1066.019) [-1066.991] * (-1068.653) (-1069.646) [-1066.739] (-1067.291) -- 0:00:03
940000 -- [-1066.302] (-1068.008) (-1068.138) (-1068.365) * [-1068.563] (-1069.344) (-1065.909) (-1066.566) -- 0:00:03
Average standard deviation of split frequencies: 0.006314
940500 -- [-1066.824] (-1068.844) (-1068.333) (-1070.394) * (-1067.316) [-1070.390] (-1069.918) (-1067.273) -- 0:00:03
941000 -- [-1068.750] (-1068.371) (-1073.491) (-1068.077) * (-1068.101) (-1068.771) [-1068.136] (-1068.141) -- 0:00:03
941500 -- [-1067.781] (-1067.181) (-1068.853) (-1066.291) * (-1070.981) [-1070.208] (-1068.127) (-1071.460) -- 0:00:03
942000 -- (-1068.270) [-1068.336] (-1066.541) (-1068.139) * (-1069.099) (-1071.364) [-1068.141] (-1070.988) -- 0:00:03
942500 -- (-1069.267) (-1068.295) [-1066.359] (-1069.733) * (-1075.399) [-1068.924] (-1070.717) (-1068.724) -- 0:00:03
943000 -- (-1067.210) (-1070.297) (-1067.698) [-1068.258] * (-1070.600) (-1066.583) (-1071.312) [-1066.694] -- 0:00:03
943500 -- [-1066.502] (-1071.136) (-1068.253) (-1069.641) * (-1070.041) [-1066.093] (-1067.251) (-1069.242) -- 0:00:03
944000 -- [-1066.416] (-1076.295) (-1071.182) (-1067.571) * [-1067.753] (-1066.547) (-1067.280) (-1069.379) -- 0:00:03
944500 -- (-1068.669) (-1072.361) (-1070.956) [-1069.045] * [-1066.133] (-1067.713) (-1068.431) (-1067.876) -- 0:00:03
945000 -- (-1069.091) (-1071.204) (-1070.720) [-1068.214] * [-1067.122] (-1066.354) (-1066.599) (-1068.166) -- 0:00:03
Average standard deviation of split frequencies: 0.006013
945500 -- (-1067.532) (-1071.816) [-1068.223] (-1068.052) * (-1067.570) [-1067.494] (-1066.878) (-1066.936) -- 0:00:03
946000 -- (-1067.309) (-1067.466) [-1066.940] (-1067.249) * (-1066.212) (-1068.178) (-1068.807) [-1068.354] -- 0:00:03
946500 -- (-1069.184) (-1070.254) (-1067.634) [-1067.532] * (-1068.249) (-1070.144) [-1066.935] (-1068.151) -- 0:00:03
947000 -- [-1067.528] (-1069.926) (-1066.794) (-1067.564) * (-1068.350) (-1074.112) (-1068.797) [-1066.202] -- 0:00:03
947500 -- (-1069.160) (-1066.661) (-1067.708) [-1067.519] * (-1068.216) (-1068.314) [-1070.956] (-1066.587) -- 0:00:03
948000 -- (-1067.235) (-1066.647) [-1067.428] (-1066.415) * [-1067.473] (-1068.445) (-1068.375) (-1066.570) -- 0:00:03
948500 -- (-1067.018) (-1066.799) (-1070.082) [-1068.145] * (-1069.048) (-1069.703) [-1067.225] (-1067.220) -- 0:00:03
949000 -- [-1067.736] (-1066.262) (-1068.395) (-1069.248) * (-1068.051) (-1073.897) [-1067.217] (-1066.554) -- 0:00:03
949500 -- (-1068.911) (-1067.118) [-1068.547] (-1068.645) * (-1070.861) (-1070.747) [-1067.666] (-1066.674) -- 0:00:03
950000 -- (-1068.688) (-1070.135) [-1068.281] (-1067.960) * (-1069.658) (-1068.609) (-1067.757) [-1067.841] -- 0:00:03
Average standard deviation of split frequencies: 0.005917
950500 -- (-1072.169) (-1066.349) [-1068.006] (-1068.361) * (-1073.671) (-1068.617) [-1067.751] (-1067.563) -- 0:00:03
951000 -- [-1071.736] (-1067.227) (-1070.058) (-1067.064) * (-1067.669) (-1068.849) (-1066.421) [-1066.318] -- 0:00:03
951500 -- (-1070.862) (-1067.983) (-1067.844) [-1066.085] * (-1068.883) (-1068.997) [-1071.047] (-1067.636) -- 0:00:03
952000 -- [-1067.177] (-1072.174) (-1068.820) (-1067.440) * (-1068.679) (-1066.428) (-1069.137) [-1066.478] -- 0:00:02
952500 -- [-1071.755] (-1069.129) (-1069.210) (-1066.922) * (-1069.928) (-1069.031) (-1067.752) [-1066.460] -- 0:00:02
953000 -- (-1069.971) (-1069.660) [-1068.534] (-1067.422) * (-1067.434) (-1070.831) [-1068.829] (-1067.287) -- 0:00:02
953500 -- (-1070.226) (-1069.636) (-1068.769) [-1068.108] * (-1066.857) (-1071.071) [-1067.098] (-1068.597) -- 0:00:02
954000 -- (-1068.431) [-1071.085] (-1075.283) (-1067.831) * (-1066.816) [-1068.122] (-1070.182) (-1072.144) -- 0:00:02
954500 -- (-1067.563) (-1066.882) [-1068.682] (-1069.949) * [-1066.954] (-1066.484) (-1067.855) (-1068.902) -- 0:00:02
955000 -- (-1069.310) (-1069.823) [-1067.953] (-1067.527) * (-1066.274) [-1067.590] (-1067.393) (-1066.854) -- 0:00:02
Average standard deviation of split frequencies: 0.005654
955500 -- (-1067.908) (-1067.060) [-1071.512] (-1067.185) * (-1069.840) [-1066.779] (-1067.654) (-1069.831) -- 0:00:02
956000 -- (-1068.646) [-1068.009] (-1069.878) (-1067.139) * (-1068.210) [-1067.661] (-1066.563) (-1069.082) -- 0:00:02
956500 -- [-1067.998] (-1068.765) (-1068.335) (-1069.084) * (-1067.244) (-1067.673) [-1069.628] (-1070.623) -- 0:00:02
957000 -- (-1067.175) [-1069.540] (-1068.336) (-1071.538) * (-1069.545) (-1072.521) (-1067.138) [-1066.743] -- 0:00:02
957500 -- (-1066.736) (-1069.785) [-1067.370] (-1073.887) * [-1071.605] (-1072.892) (-1066.680) (-1068.155) -- 0:00:02
958000 -- (-1066.604) (-1066.817) [-1066.687] (-1074.944) * (-1072.112) (-1070.611) (-1068.474) [-1067.847] -- 0:00:02
958500 -- (-1066.750) [-1066.578] (-1069.028) (-1065.979) * (-1071.641) [-1067.277] (-1069.462) (-1070.482) -- 0:00:02
959000 -- (-1067.295) [-1071.003] (-1069.080) (-1067.660) * (-1069.187) (-1068.826) [-1067.991] (-1072.136) -- 0:00:02
959500 -- [-1066.310] (-1066.818) (-1068.459) (-1066.759) * (-1069.727) (-1070.439) [-1067.532] (-1067.944) -- 0:00:02
960000 -- (-1067.305) (-1074.758) [-1068.381] (-1070.204) * (-1068.494) (-1069.278) (-1069.811) [-1068.186] -- 0:00:02
Average standard deviation of split frequencies: 0.005365
960500 -- [-1066.485] (-1071.047) (-1067.792) (-1068.865) * (-1069.655) (-1067.918) (-1067.091) [-1067.310] -- 0:00:02
961000 -- (-1066.506) (-1069.559) (-1068.377) [-1067.464] * (-1068.737) [-1066.459] (-1067.147) (-1070.590) -- 0:00:02
961500 -- (-1072.530) (-1068.970) [-1067.988] (-1067.734) * [-1066.772] (-1066.707) (-1068.878) (-1070.509) -- 0:00:02
962000 -- (-1072.360) [-1072.383] (-1067.091) (-1070.836) * (-1066.512) (-1069.879) [-1066.587] (-1072.106) -- 0:00:02
962500 -- (-1066.957) (-1067.916) [-1067.847] (-1068.376) * (-1067.453) (-1073.907) [-1068.064] (-1067.523) -- 0:00:02
963000 -- [-1069.179] (-1068.265) (-1069.117) (-1070.941) * (-1067.452) (-1067.279) [-1068.759] (-1068.660) -- 0:00:02
963500 -- (-1071.295) (-1069.297) [-1070.017] (-1074.378) * [-1067.342] (-1067.421) (-1070.714) (-1067.933) -- 0:00:02
964000 -- (-1068.623) (-1072.580) [-1069.049] (-1068.367) * (-1065.950) (-1070.208) [-1071.935] (-1070.725) -- 0:00:02
964500 -- [-1066.125] (-1071.081) (-1069.137) (-1067.401) * [-1065.943] (-1068.293) (-1069.852) (-1069.092) -- 0:00:02
965000 -- (-1067.151) (-1068.933) [-1068.108] (-1068.668) * (-1071.019) [-1066.331] (-1066.509) (-1068.655) -- 0:00:02
Average standard deviation of split frequencies: 0.005303
965500 -- (-1067.938) (-1066.419) (-1067.402) [-1067.332] * (-1068.739) [-1066.096] (-1066.469) (-1069.012) -- 0:00:02
966000 -- (-1068.260) (-1067.784) (-1068.205) [-1067.233] * (-1070.903) [-1067.568] (-1066.968) (-1067.701) -- 0:00:02
966500 -- (-1066.568) (-1071.212) (-1066.816) [-1067.130] * (-1070.597) (-1068.669) (-1067.371) [-1066.485] -- 0:00:02
967000 -- (-1066.584) (-1070.842) (-1068.845) [-1068.130] * (-1071.600) (-1069.873) [-1066.843] (-1069.563) -- 0:00:02
967500 -- [-1069.828] (-1070.416) (-1067.221) (-1068.863) * (-1068.300) (-1067.095) (-1067.575) [-1068.818] -- 0:00:02
968000 -- [-1070.215] (-1069.483) (-1066.756) (-1066.701) * (-1068.595) [-1066.414] (-1067.868) (-1067.478) -- 0:00:01
968500 -- [-1069.383] (-1068.821) (-1066.397) (-1067.598) * (-1072.229) (-1068.486) (-1068.578) [-1067.326] -- 0:00:01
969000 -- (-1069.243) (-1069.040) [-1068.266] (-1070.854) * (-1066.350) (-1067.969) (-1070.413) [-1066.153] -- 0:00:01
969500 -- (-1068.204) [-1066.761] (-1067.259) (-1075.077) * (-1067.478) [-1066.609] (-1070.474) (-1067.138) -- 0:00:01
970000 -- (-1070.373) [-1068.724] (-1066.493) (-1070.685) * (-1068.318) (-1067.988) [-1073.003] (-1067.358) -- 0:00:01
Average standard deviation of split frequencies: 0.005277
970500 -- (-1067.005) (-1070.717) (-1066.475) [-1073.105] * (-1066.745) (-1068.204) [-1069.026] (-1070.202) -- 0:00:01
971000 -- (-1067.589) (-1070.084) [-1066.739] (-1070.501) * (-1067.460) (-1069.330) (-1068.770) [-1066.901] -- 0:00:01
971500 -- (-1069.595) (-1068.093) (-1068.840) [-1066.383] * (-1068.357) [-1069.218] (-1067.388) (-1067.316) -- 0:00:01
972000 -- (-1067.205) [-1067.655] (-1068.849) (-1071.990) * (-1070.277) (-1067.411) (-1072.790) [-1073.055] -- 0:00:01
972500 -- (-1069.622) (-1067.515) (-1066.944) [-1067.260] * [-1072.123] (-1068.061) (-1066.648) (-1069.727) -- 0:00:01
973000 -- (-1067.735) (-1069.756) [-1070.509] (-1069.651) * [-1067.165] (-1067.192) (-1067.359) (-1066.851) -- 0:00:01
973500 -- (-1068.178) (-1067.698) [-1067.667] (-1067.883) * [-1067.204] (-1066.894) (-1068.731) (-1067.479) -- 0:00:01
974000 -- (-1068.613) [-1071.088] (-1069.582) (-1067.332) * (-1066.740) (-1069.815) (-1068.835) [-1067.547] -- 0:00:01
974500 -- (-1069.996) (-1071.088) (-1070.454) [-1068.124] * (-1074.335) (-1068.819) [-1069.264] (-1067.046) -- 0:00:01
975000 -- (-1069.056) [-1068.715] (-1069.384) (-1070.201) * (-1071.206) (-1067.925) (-1068.211) [-1068.474] -- 0:00:01
Average standard deviation of split frequencies: 0.005249
975500 -- (-1068.937) (-1067.902) (-1069.470) [-1067.634] * (-1074.669) (-1067.160) [-1069.037] (-1067.002) -- 0:00:01
976000 -- (-1066.366) [-1067.100] (-1067.595) (-1068.523) * (-1070.071) (-1066.534) [-1072.219] (-1066.408) -- 0:00:01
976500 -- (-1066.396) [-1067.302] (-1069.487) (-1068.930) * (-1071.930) (-1068.105) (-1066.438) [-1068.819] -- 0:00:01
977000 -- [-1067.450] (-1068.794) (-1067.285) (-1071.636) * [-1067.858] (-1068.145) (-1066.105) (-1068.858) -- 0:00:01
977500 -- (-1068.355) [-1070.381] (-1067.464) (-1066.307) * (-1069.717) (-1072.575) [-1068.415] (-1067.082) -- 0:00:01
978000 -- [-1069.990] (-1069.272) (-1067.668) (-1068.529) * [-1066.487] (-1070.432) (-1073.314) (-1071.146) -- 0:00:01
978500 -- (-1068.438) (-1072.263) (-1068.013) [-1068.564] * (-1070.713) [-1069.741] (-1067.628) (-1068.778) -- 0:00:01
979000 -- (-1066.127) [-1070.232] (-1071.980) (-1070.317) * (-1068.683) (-1072.276) [-1069.206] (-1068.992) -- 0:00:01
979500 -- (-1066.388) (-1070.556) [-1068.425] (-1069.176) * [-1067.733] (-1067.713) (-1066.113) (-1075.219) -- 0:00:01
980000 -- (-1066.644) (-1067.425) (-1067.772) [-1072.081] * [-1067.227] (-1068.088) (-1066.032) (-1071.589) -- 0:00:01
Average standard deviation of split frequencies: 0.004999
980500 -- [-1067.175] (-1066.840) (-1066.672) (-1072.080) * (-1070.212) [-1067.186] (-1067.342) (-1071.450) -- 0:00:01
981000 -- [-1067.038] (-1067.025) (-1070.388) (-1075.300) * (-1074.602) (-1068.785) (-1067.320) [-1065.987] -- 0:00:01
981500 -- (-1069.863) (-1066.638) (-1069.268) [-1072.384] * (-1075.309) [-1069.510] (-1068.035) (-1068.147) -- 0:00:01
982000 -- [-1067.608] (-1066.950) (-1070.334) (-1072.388) * (-1070.694) (-1068.916) (-1069.113) [-1067.021] -- 0:00:01
982500 -- (-1068.269) (-1069.267) (-1067.332) [-1068.907] * (-1066.381) (-1067.431) (-1066.648) [-1071.689] -- 0:00:01
983000 -- (-1068.499) (-1068.246) (-1070.256) [-1066.997] * (-1066.517) (-1069.345) (-1071.805) [-1069.325] -- 0:00:01
983500 -- (-1068.304) (-1068.649) (-1071.831) [-1067.896] * (-1069.201) (-1067.125) (-1067.771) [-1069.170] -- 0:00:01
984000 -- (-1067.337) (-1071.744) (-1070.077) [-1068.244] * (-1070.896) [-1066.634] (-1070.285) (-1067.295) -- 0:00:00
984500 -- [-1071.148] (-1067.360) (-1071.375) (-1067.968) * [-1067.034] (-1071.437) (-1067.920) (-1069.436) -- 0:00:00
985000 -- (-1068.416) (-1068.784) [-1069.856] (-1066.904) * [-1070.226] (-1073.303) (-1069.887) (-1067.644) -- 0:00:00
Average standard deviation of split frequencies: 0.004813
985500 -- [-1067.219] (-1071.843) (-1069.079) (-1067.480) * [-1068.080] (-1069.742) (-1069.981) (-1068.901) -- 0:00:00
986000 -- (-1066.312) (-1070.926) (-1068.810) [-1066.794] * [-1067.622] (-1069.392) (-1068.748) (-1067.756) -- 0:00:00
986500 -- [-1067.579] (-1073.152) (-1068.405) (-1066.330) * (-1068.308) (-1068.389) [-1068.271] (-1074.141) -- 0:00:00
987000 -- (-1068.519) [-1067.742] (-1068.123) (-1066.286) * (-1068.219) [-1066.712] (-1067.407) (-1067.943) -- 0:00:00
987500 -- (-1070.872) (-1070.010) (-1071.349) [-1067.169] * (-1067.417) [-1067.470] (-1068.493) (-1074.133) -- 0:00:00
988000 -- [-1069.708] (-1067.955) (-1068.390) (-1067.180) * [-1067.354] (-1067.370) (-1067.709) (-1070.566) -- 0:00:00
988500 -- (-1074.082) (-1067.730) [-1066.713] (-1068.406) * (-1070.210) (-1069.806) [-1069.255] (-1071.289) -- 0:00:00
989000 -- (-1067.975) (-1069.668) (-1070.649) [-1067.996] * (-1067.736) (-1068.179) (-1068.090) [-1067.525] -- 0:00:00
989500 -- (-1074.079) (-1067.315) [-1067.865] (-1067.901) * (-1068.425) [-1067.462] (-1068.383) (-1067.185) -- 0:00:00
990000 -- (-1068.957) (-1069.560) [-1067.090] (-1068.262) * (-1067.645) (-1067.978) [-1069.477] (-1066.986) -- 0:00:00
Average standard deviation of split frequencies: 0.004505
990500 -- (-1067.385) (-1071.061) [-1067.786] (-1070.091) * (-1067.214) (-1069.072) [-1071.503] (-1069.039) -- 0:00:00
991000 -- [-1067.907] (-1070.616) (-1068.564) (-1069.128) * (-1068.754) [-1067.544] (-1068.619) (-1072.239) -- 0:00:00
991500 -- (-1069.852) (-1071.019) (-1067.994) [-1068.723] * (-1067.469) (-1069.326) (-1067.762) [-1072.596] -- 0:00:00
992000 -- (-1069.890) [-1069.762] (-1067.820) (-1070.030) * (-1067.785) [-1069.943] (-1070.720) (-1067.012) -- 0:00:00
992500 -- (-1068.715) [-1072.422] (-1067.812) (-1070.127) * (-1066.251) [-1071.167] (-1069.092) (-1067.408) -- 0:00:00
993000 -- (-1070.544) (-1067.976) [-1067.398] (-1070.270) * (-1067.140) (-1067.035) (-1069.952) [-1068.767] -- 0:00:00
993500 -- [-1066.741] (-1072.291) (-1067.605) (-1067.804) * (-1070.246) [-1066.490] (-1071.635) (-1070.442) -- 0:00:00
994000 -- [-1068.242] (-1067.146) (-1067.914) (-1069.577) * (-1067.727) [-1067.968] (-1066.464) (-1069.010) -- 0:00:00
994500 -- (-1066.942) (-1067.466) [-1068.893] (-1068.618) * (-1068.884) [-1066.921] (-1068.297) (-1070.225) -- 0:00:00
995000 -- (-1067.496) [-1066.936] (-1071.646) (-1071.799) * (-1066.708) (-1068.836) [-1068.105] (-1070.848) -- 0:00:00
Average standard deviation of split frequencies: 0.004354
995500 -- (-1069.095) (-1067.378) (-1076.247) [-1069.504] * (-1066.751) (-1068.102) [-1066.398] (-1071.316) -- 0:00:00
996000 -- (-1071.063) (-1066.112) (-1069.599) [-1071.172] * [-1067.134] (-1078.429) (-1068.038) (-1072.303) -- 0:00:00
996500 -- (-1067.924) [-1067.830] (-1066.850) (-1071.502) * (-1069.763) (-1068.585) [-1070.953] (-1066.989) -- 0:00:00
997000 -- [-1066.677] (-1071.363) (-1069.164) (-1074.565) * (-1068.316) [-1068.174] (-1070.828) (-1068.221) -- 0:00:00
997500 -- (-1067.005) [-1071.958] (-1066.146) (-1069.861) * [-1067.492] (-1071.640) (-1068.303) (-1068.534) -- 0:00:00
998000 -- [-1066.781] (-1068.235) (-1066.654) (-1069.451) * [-1069.284] (-1066.290) (-1069.167) (-1066.394) -- 0:00:00
998500 -- [-1067.712] (-1068.800) (-1068.301) (-1072.327) * [-1067.632] (-1069.537) (-1069.684) (-1069.747) -- 0:00:00
999000 -- [-1068.139] (-1071.105) (-1067.903) (-1067.239) * (-1068.314) [-1066.996] (-1069.455) (-1066.865) -- 0:00:00
999500 -- (-1068.750) (-1072.223) [-1067.834] (-1066.737) * [-1069.049] (-1066.785) (-1066.526) (-1068.907) -- 0:00:00
1000000 -- (-1069.095) (-1067.831) [-1066.532] (-1068.915) * (-1069.496) (-1068.842) (-1068.776) [-1069.888] -- 0:00:00
Average standard deviation of split frequencies: 0.004554
Analysis completed in 1 mins 2 seconds
Analysis used 60.98 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1065.85
Likelihood of best state for "cold" chain of run 2 was -1065.85
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.4 % ( 59 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.2 % ( 28 %) Dirichlet(Pi{all})
28.9 % ( 22 %) Slider(Pi{all})
79.0 % ( 62 %) Multiplier(Alpha{1,2})
77.7 % ( 55 %) Multiplier(Alpha{3})
19.8 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
69.8 % ( 79 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.4 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.0 % ( 24 %) Dirichlet(Pi{all})
29.3 % ( 25 %) Slider(Pi{all})
78.6 % ( 58 %) Multiplier(Alpha{1,2})
77.8 % ( 51 %) Multiplier(Alpha{3})
19.8 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.2 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166564 0.82 0.67
3 | 167232 166740 0.84
4 | 166572 166409 166483
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165627 0.82 0.67
3 | 166831 166746 0.84
4 | 166567 166649 167580
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1067.50
| 2 |
| 1 2 |
| 2 2 2 |
| 1 2 2 1 1 |
| 2 1 1 1 2 1 2 |
| 11 2 1 1 * 1 * 2 |
| 1 12 2 2 1 21 11 22222 2 2 |
| 2 1 2 2 11 1 1 2 2 1 1 1|
|*1 2 122 2 11 1 1 2 2 21 2 |
| 1 2 2 2 11 1 1 |
| 22 2 2 1 1 21 1 12|
| 1 1 1 12 1 2 1 2 12 2 |
| 2 2 1 1 1 |
| 2 2 1 2 1 |
| 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1069.04
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1067.58 -1070.32
2 -1067.54 -1071.52
--------------------------------------
TOTAL -1067.56 -1071.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892636 0.091777 0.339368 1.486249 0.853864 1353.05 1426.62 1.000
r(A<->C){all} 0.173433 0.020838 0.000075 0.463991 0.138191 249.16 275.88 1.001
r(A<->G){all} 0.165334 0.018700 0.000004 0.436610 0.128582 134.35 171.87 1.000
r(A<->T){all} 0.156959 0.018596 0.000043 0.434186 0.119057 246.88 282.77 1.000
r(C<->G){all} 0.175916 0.020180 0.000089 0.463828 0.141326 271.23 320.94 1.000
r(C<->T){all} 0.163116 0.017928 0.000006 0.429210 0.130391 144.91 218.83 1.001
r(G<->T){all} 0.165242 0.018353 0.000031 0.432153 0.131776 232.91 251.42 1.000
pi(A){all} 0.213353 0.000214 0.186292 0.242211 0.212888 1201.92 1247.95 1.000
pi(C){all} 0.308526 0.000272 0.275808 0.340767 0.307926 1246.39 1297.15 1.000
pi(G){all} 0.298808 0.000268 0.267797 0.331617 0.298847 1192.58 1279.14 1.000
pi(T){all} 0.179313 0.000185 0.152433 0.205370 0.179076 1255.96 1359.40 1.000
alpha{1,2} 0.407032 0.221188 0.000124 1.330003 0.239379 1195.05 1281.90 1.000
alpha{3} 0.449870 0.219594 0.000142 1.383567 0.296381 1010.76 1156.45 1.000
pinvar{all} 0.998081 0.000005 0.993729 1.000000 0.998833 1103.45 1189.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .*.***
9 -- .*..*.
10 -- ..*..*
11 -- .****.
12 -- .**...
13 -- .***.*
14 -- ...*.*
15 -- .*.*..
16 -- ..**..
17 -- ..*.*.
18 -- .**.**
19 -- .*...*
20 -- ..****
21 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 463 0.154231 0.008951 0.147901 0.160560 2
8 446 0.148568 0.000942 0.147901 0.149234 2
9 445 0.148235 0.005182 0.144570 0.151899 2
10 444 0.147901 0.002827 0.145903 0.149900 2
11 437 0.145570 0.001413 0.144570 0.146569 2
12 436 0.145237 0.000942 0.144570 0.145903 2
13 433 0.144237 0.002355 0.142572 0.145903 2
14 432 0.143904 0.017901 0.131246 0.156562 2
15 427 0.142239 0.004240 0.139241 0.145237 2
16 424 0.141239 0.000000 0.141239 0.141239 2
17 423 0.140906 0.001413 0.139907 0.141905 2
18 422 0.140573 0.011306 0.132578 0.148568 2
19 422 0.140573 0.003769 0.137908 0.143238 2
20 391 0.130247 0.001413 0.129247 0.131246 2
21 384 0.127915 0.005653 0.123917 0.131912 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100864 0.010690 0.000026 0.310810 0.068318 1.000 2
length{all}[2] 0.101323 0.009637 0.000015 0.294532 0.071714 1.000 2
length{all}[3] 0.100617 0.010222 0.000001 0.307341 0.068974 1.000 2
length{all}[4] 0.097306 0.009454 0.000051 0.292226 0.067560 1.000 2
length{all}[5] 0.097645 0.009671 0.000001 0.287931 0.067339 1.000 2
length{all}[6] 0.098475 0.009821 0.000018 0.298211 0.067799 1.000 2
length{all}[7] 0.096498 0.008959 0.000027 0.301377 0.068333 1.000 2
length{all}[8] 0.103830 0.011880 0.000206 0.304564 0.067579 1.000 2
length{all}[9] 0.095714 0.007088 0.000056 0.283147 0.072913 0.999 2
length{all}[10] 0.092902 0.007811 0.000562 0.279179 0.068625 0.998 2
length{all}[11] 0.102662 0.010595 0.000212 0.313316 0.070049 1.002 2
length{all}[12] 0.102387 0.010046 0.000733 0.292423 0.071384 1.000 2
length{all}[13] 0.105466 0.012929 0.000132 0.317528 0.070716 0.998 2
length{all}[14] 0.092936 0.010479 0.000251 0.256870 0.067133 0.999 2
length{all}[15] 0.096471 0.006817 0.000528 0.257981 0.070982 1.000 2
length{all}[16] 0.094721 0.008815 0.000223 0.276090 0.066307 0.998 2
length{all}[17] 0.098726 0.009423 0.000252 0.303228 0.065076 0.999 2
length{all}[18] 0.101155 0.009170 0.000110 0.286156 0.067790 0.998 2
length{all}[19] 0.094478 0.008739 0.000313 0.293892 0.061683 0.998 2
length{all}[20] 0.100995 0.011058 0.000402 0.315361 0.067387 0.998 2
length{all}[21] 0.098353 0.011746 0.000215 0.321585 0.061039 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004554
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 783
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 261 / 261 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 261 / 261 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.061938 0.049850 0.081201 0.013002 0.087315 0.070715 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1111.752736
Iterating by ming2
Initial: fx= 1111.752736
x= 0.06194 0.04985 0.08120 0.01300 0.08731 0.07072 0.30000 1.30000
1 h-m-p 0.0000 0.0001 625.1933 ++ 1092.012282 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0081 38.3147 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 571.1094 ++ 1044.853309 m 0.0001 44 | 2/8
4 h-m-p 0.0029 0.0145 22.7726 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 514.1099 ++ 1032.315704 m 0.0000 76 | 3/8
6 h-m-p 0.0020 0.0508 10.4303 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 445.9202 ++ 1025.457718 m 0.0000 108 | 4/8
8 h-m-p 0.0017 0.1565 7.2983 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 364.4062 ++ 1019.972952 m 0.0000 140 | 5/8
10 h-m-p 0.0160 8.0000 5.0024 -------------.. | 5/8
11 h-m-p 0.0000 0.0000 258.0624 ++ 1018.367957 m 0.0000 173 | 6/8
12 h-m-p 0.0849 8.0000 0.0000 C 1018.367957 0 0.0220 184 | 6/8
13 h-m-p 1.4841 8.0000 0.0000 ------------C 1018.367957 0 0.0000 209
Out..
lnL = -1018.367957
210 lfun, 210 eigenQcodon, 1260 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042008 0.056873 0.082045 0.075163 0.024297 0.099958 0.299961 0.609577 0.102239
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.500653
np = 9
lnL0 = -1107.390242
Iterating by ming2
Initial: fx= 1107.390242
x= 0.04201 0.05687 0.08204 0.07516 0.02430 0.09996 0.29996 0.60958 0.10224
1 h-m-p 0.0000 0.0001 522.4864 ++ 1075.550708 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 395.9689 ++ 1054.203724 m 0.0002 26 | 2/9
3 h-m-p 0.0000 0.0000 3941.9566 ++ 1043.517795 m 0.0000 38 | 3/9
4 h-m-p 0.0004 0.0038 61.5482 ++ 1031.643279 m 0.0038 50 | 4/9
5 h-m-p 0.0000 0.0001 546.0973 ++ 1026.907510 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0001 721.6337 ++ 1026.106517 m 0.0001 74 | 5/9
7 h-m-p 0.0001 0.0005 72.5237 ++ 1024.394771 m 0.0005 86 | 6/9
8 h-m-p 0.0002 0.0012 2.2445 ----------.. | 6/9
9 h-m-p 0.0000 0.0001 252.4869 ++ 1018.367947 m 0.0001 118 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 1018.367947 m 8.0000 130 | 7/9
11 h-m-p 0.0378 8.0000 0.0016 ++++ 1018.367947 m 8.0000 146 | 7/9
12 h-m-p 0.0219 8.0000 0.6035 -------------.. | 7/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 1018.367946 m 8.0000 188 | 7/9
14 h-m-p 0.0160 8.0000 0.1221 --------C 1018.367946 0 0.0000 210 | 7/9
15 h-m-p 0.0012 0.6005 0.0016 +++++ 1018.367946 m 0.6005 227 | 8/9
16 h-m-p 0.0160 8.0000 0.0074 +++++ 1018.367946 m 8.0000 244 | 8/9
17 h-m-p 0.0707 8.0000 0.8425 ---------C 1018.367946 0 0.0000 266 | 8/9
18 h-m-p 0.0160 8.0000 0.0002 +++++ 1018.367946 m 8.0000 282 | 8/9
19 h-m-p 0.0160 8.0000 1.2991 ------------Y 1018.367946 0 0.0000 307 | 8/9
20 h-m-p 0.1951 8.0000 0.0000 --Y 1018.367946 0 0.0030 321 | 8/9
21 h-m-p 0.2399 8.0000 0.0000 --Y 1018.367946 0 0.0037 336
Out..
lnL = -1018.367946
337 lfun, 1011 eigenQcodon, 4044 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044009 0.047681 0.011083 0.077879 0.059044 0.035088 0.165920 1.639991 0.279241 0.491249 1.538539
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.554257
np = 11
lnL0 = -1087.235800
Iterating by ming2
Initial: fx= 1087.235800
x= 0.04401 0.04768 0.01108 0.07788 0.05904 0.03509 0.16592 1.63999 0.27924 0.49125 1.53854
1 h-m-p 0.0000 0.0000 597.8465 ++ 1071.042324 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0007 230.5499 ++ 1039.865733 m 0.0007 30 | 2/11
3 h-m-p 0.0000 0.0000 13689.8645 ++ 1031.160827 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0001 484.9439 ++ 1027.979110 m 0.0001 58 | 4/11
5 h-m-p 0.0000 0.0000 35659.0571 ++ 1022.244528 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 38166.3528 ++ 1018.367955 m 0.0000 86 | 6/11
7 h-m-p 1.6000 8.0000 0.0000 ++ 1018.367955 m 8.0000 100 | 6/11
8 h-m-p 0.1454 8.0000 0.0005 ------Y 1018.367955 0 0.0000 125
Out..
lnL = -1018.367955
126 lfun, 504 eigenQcodon, 2268 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1018.387773 S = -1018.364463 -0.008947
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:02
did 20 / 57 patterns 0:02
did 30 / 57 patterns 0:02
did 40 / 57 patterns 0:02
did 50 / 57 patterns 0:02
did 57 / 57 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018621 0.086201 0.107440 0.073562 0.063818 0.044885 0.132424 0.638386 1.900082
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.190281
np = 9
lnL0 = -1114.095844
Iterating by ming2
Initial: fx= 1114.095844
x= 0.01862 0.08620 0.10744 0.07356 0.06382 0.04488 0.13242 0.63839 1.90008
1 h-m-p 0.0000 0.0001 561.8979 ++ 1088.502111 m 0.0001 14 | 1/9
2 h-m-p 0.0007 0.0041 58.7402 ++ 1077.297438 m 0.0041 26 | 2/9
3 h-m-p 0.0000 0.0002 387.2677 ++ 1073.618849 m 0.0002 38 | 3/9
4 h-m-p 0.0001 0.0010 813.3736 ++ 1029.926611 m 0.0010 50 | 4/9
5 h-m-p 0.0001 0.0006 125.6610 ++ 1029.133660 m 0.0006 62 | 5/9
6 h-m-p 0.0000 0.0001 1266.0208 ++ 1025.092948 m 0.0001 74 | 6/9
7 h-m-p 0.0048 2.3988 43.2955 ------------.. | 6/9
8 h-m-p 0.0000 0.0001 254.8759 ++ 1018.367955 m 0.0001 108 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ------------C 1018.367955 0 0.0000 132 | 6/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 1018.367955 m 8.0000 149 | 6/9
11 h-m-p 0.0342 0.1711 0.0005 ---C 1018.367955 0 0.0001 167 | 6/9
12 h-m-p 0.0160 8.0000 0.0001 +++++ 1018.367955 m 8.0000 185 | 6/9
13 h-m-p 0.0160 8.0000 0.3457 +++++ 1018.367951 m 8.0000 203 | 6/9
14 h-m-p 1.6000 8.0000 0.7463 ++ 1018.367950 m 8.0000 218 | 6/9
15 h-m-p 1.6000 8.0000 0.8856 ++ 1018.367950 m 8.0000 233 | 6/9
16 h-m-p 1.6000 8.0000 1.8907 ++ 1018.367949 m 8.0000 248 | 6/9
17 h-m-p 0.3503 1.7517 17.6671 ------C 1018.367949 0 0.0000 266 | 6/9
18 h-m-p 1.6000 8.0000 0.0002 ++ 1018.367949 m 8.0000 278 | 6/9
19 h-m-p 1.6000 8.0000 0.0000 C 1018.367949 0 0.4000 293 | 6/9
20 h-m-p 0.4596 8.0000 0.0000 -Y 1018.367949 0 0.0287 309 | 6/9
21 h-m-p 0.2267 8.0000 0.0000 ---C 1018.367949 0 0.0009 327
Out..
lnL = -1018.367949
328 lfun, 3608 eigenQcodon, 19680 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.085725 0.032814 0.040816 0.070106 0.079387 0.097883 15.036235 0.900000 1.004166 1.956948 1.300005
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.712517
np = 11
lnL0 = -1116.395283
Iterating by ming2
Initial: fx= 1116.395283
x= 0.08572 0.03281 0.04082 0.07011 0.07939 0.09788 15.03623 0.90000 1.00417 1.95695 1.30001
1 h-m-p 0.0000 0.0001 556.2271 ++ 1071.216962 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0003 206.9649 ++ 1060.424270 m 0.0003 30 | 2/11
3 h-m-p 0.0000 0.0001 837.1780 ++ 1030.614615 m 0.0001 44 | 3/11
4 h-m-p 0.0004 0.0020 70.4336 ++ 1025.784668 m 0.0020 58 | 4/11
5 h-m-p 0.0000 0.0000 7631.5088 ++ 1022.352238 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 28979.2609 ++ 1019.892520 m 0.0000 86 | 5/11
7 h-m-p 0.0052 0.0258 60.0740 ------------.. | 5/11
8 h-m-p 0.0000 0.0000 257.1429 ++ 1018.367943 m 0.0000 124 | 7/11
9 h-m-p 0.0825 8.0000 0.0000 +Y 1018.367943 0 0.3301 139 | 7/11
10 h-m-p 1.6000 8.0000 0.0000 ----------Y 1018.367943 0 0.0000 167
Out..
lnL = -1018.367943
168 lfun, 2016 eigenQcodon, 11088 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1018.370792 S = -1018.362774 -0.003515
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:11
did 20 / 57 patterns 0:11
did 30 / 57 patterns 0:11
did 40 / 57 patterns 0:11
did 50 / 57 patterns 0:11
did 57 / 57 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=261
NC_011896_1_WP_010907705_1_403_MLBR_RS01930 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
NC_002677_1_NP_301381_1_253_ML0393 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT
**************************************************
NC_011896_1_WP_010907705_1_403_MLBR_RS01930 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
NC_002677_1_NP_301381_1_253_ML0393 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170 YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS
**************************************************
NC_011896_1_WP_010907705_1_403_MLBR_RS01930 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
NC_002677_1_NP_301381_1_253_ML0393 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170 ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV
**************************************************
NC_011896_1_WP_010907705_1_403_MLBR_RS01930 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
NC_002677_1_NP_301381_1_253_ML0393 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170 AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ
**************************************************
NC_011896_1_WP_010907705_1_403_MLBR_RS01930 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NC_002677_1_NP_301381_1_253_ML0393 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170 LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA
**************************************************
NC_011896_1_WP_010907705_1_403_MLBR_RS01930 NVVVTDLAELL
NC_002677_1_NP_301381_1_253_ML0393 NVVVTDLAELL
NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695 NVVVTDLAELL
NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905 NVVVTDLAELL
NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085 NVVVTDLAELL
NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170 NVVVTDLAELL
***********
>NC_011896_1_WP_010907705_1_403_MLBR_RS01930 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC AATGTAGTGGTGACCGATCTCGCTGAACTACTG >NC_002677_1_NP_301381_1_253_ML0393 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC AATGTAGTGGTGACCGATCTCGCTGAACTACTG >NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC AATGTAGTGGTGACCGATCTCGCTGAACTACTG >NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC AATGTAGTGGTGACCGATCTCGCTGAACTACTG >NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC AATGTAGTGGTGACCGATCTCGCTGAACTACTG >NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170 ATGGCGAACTGGGATCACCCAACTAGTAAAGTGAGGTCCACCGTGCTGGG TCTGCCGGAGCAAGTGCGCGCCTGCCTATTCGACCTCGACGGTGTTCTCA CCGATACCGCGAGTGTCCATGCCAAGGCATGGCAGACCATGTTTGACACC TATCTATACCAACGGGCCAAGCACACCGGAGAAAATTTTGTGCCCTTCGA CCCCACCGCAGACTACCGACAATACGTGGACGGTAAGAAGCGCGAAGACG GGGTCCGGTCATTTCTGGGCAGTCGGGGAATCACACTGCCTGAAGGCAGT GCCGACAACTCCGGCGACGTCGAGACAATATATGGCCTAGGCAACCGCAA AGACGACCTATTCCGGCAGGTACTCAAGGAGCATGGCATTGAGGTCTTCG ACGGGTCGCGACGCTATCTGGAGGCAATCACGTACGCAGGCCTCGGCGTC GCCGTCGTGTCGTCGAGCACCAATACCCGCGACGTACTCAAGATCACCGG TCTTGACCGATTTGTCCAGCAACAGGTGGACGGTATCACCCTGCGTGAAG AGCACATCGCCGGCAAGCCGGCCCCCGACTCATACCTGCGCGGGGCGCAG TTGCTCGACGTCGCTCCCGACGCGGCAGCCGTATTCGAGGACGCCTTGTC CGGCGTGCAGGCCGGCCTGTCCGGTCACTTCGGCTTCGTGGTGGGCATCA ACCGCACGGGTCGGGTAGACCAGGCCGAAGAACTGCGCCGCATCGGCGCC AATGTAGTGGTGACCGATCTCGCTGAACTACTG
>NC_011896_1_WP_010907705_1_403_MLBR_RS01930 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA NVVVTDLAELL >NC_002677_1_NP_301381_1_253_ML0393 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA NVVVTDLAELL >NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA NVVVTDLAELL >NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA NVVVTDLAELL >NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA NVVVTDLAELL >NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170 MANWDHPTSKVRSTVLGLPEQVRACLFDLDGVLTDTASVHAKAWQTMFDT YLYQRAKHTGENFVPFDPTADYRQYVDGKKREDGVRSFLGSRGITLPEGS ADNSGDVETIYGLGNRKDDLFRQVLKEHGIEVFDGSRRYLEAITYAGLGV AVVSSSTNTRDVLKITGLDRFVQQQVDGITLREEHIAGKPAPDSYLRGAQ LLDVAPDAAAVFEDALSGVQAGLSGHFGFVVGINRTGRVDQAEELRRIGA NVVVTDLAELL
#NEXUS
[ID: 0985989244]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907705_1_403_MLBR_RS01930
NC_002677_1_NP_301381_1_253_ML0393
NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695
NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905
NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085
NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907705_1_403_MLBR_RS01930,
2 NC_002677_1_NP_301381_1_253_ML0393,
3 NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695,
4 NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905,
5 NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085,
6 NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06831779,2:0.07171369,3:0.06897448,4:0.06755997,5:0.06733867,6:0.06779869);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06831779,2:0.07171369,3:0.06897448,4:0.06755997,5:0.06733867,6:0.06779869);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1067.58 -1070.32
2 -1067.54 -1071.52
--------------------------------------
TOTAL -1067.56 -1071.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0393/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892636 0.091777 0.339368 1.486249 0.853864 1353.05 1426.62 1.000
r(A<->C){all} 0.173433 0.020838 0.000075 0.463991 0.138191 249.16 275.88 1.001
r(A<->G){all} 0.165334 0.018700 0.000004 0.436610 0.128582 134.35 171.87 1.000
r(A<->T){all} 0.156959 0.018596 0.000043 0.434186 0.119057 246.88 282.77 1.000
r(C<->G){all} 0.175916 0.020180 0.000089 0.463828 0.141326 271.23 320.94 1.000
r(C<->T){all} 0.163116 0.017928 0.000006 0.429210 0.130391 144.91 218.83 1.001
r(G<->T){all} 0.165242 0.018353 0.000031 0.432153 0.131776 232.91 251.42 1.000
pi(A){all} 0.213353 0.000214 0.186292 0.242211 0.212888 1201.92 1247.95 1.000
pi(C){all} 0.308526 0.000272 0.275808 0.340767 0.307926 1246.39 1297.15 1.000
pi(G){all} 0.298808 0.000268 0.267797 0.331617 0.298847 1192.58 1279.14 1.000
pi(T){all} 0.179313 0.000185 0.152433 0.205370 0.179076 1255.96 1359.40 1.000
alpha{1,2} 0.407032 0.221188 0.000124 1.330003 0.239379 1195.05 1281.90 1.000
alpha{3} 0.449870 0.219594 0.000142 1.383567 0.296381 1010.76 1156.45 1.000
pinvar{all} 0.998081 0.000005 0.993729 1.000000 0.998833 1103.45 1189.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0393/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 261
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 4 4 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 7 7 7 7 7 7 | TCC 4 4 4 4 4 4 | TAC 5 5 5 5 5 5 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 7 7 7 7 7 7 | CCC 4 4 4 4 4 4 | CAC 4 4 4 4 4 4 | CGC 9 9 9 9 9 9
CTA 5 5 5 5 5 5 | CCA 1 1 1 1 1 1 | Gln CAA 4 4 4 4 4 4 | CGA 3 3 3 3 3 3
CTG 10 10 10 10 10 10 | CCG 2 2 2 2 2 2 | CAG 7 7 7 7 7 7 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 4 4 4 4 4 4
ATC 7 7 7 7 7 7 | ACC 12 12 12 12 12 12 | AAC 4 4 4 4 4 4 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 7 7 7 7 7 7 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 2 2 2 2 2 2 | Asp GAT 3 3 3 3 3 3 | Gly GGT 7 7 7 7 7 7
GTC 8 8 8 8 8 8 | GCC 12 12 12 12 12 12 | GAC 20 20 20 20 20 20 | GGC 14 14 14 14 14 14
GTA 5 5 5 5 5 5 | GCA 5 5 5 5 5 5 | Glu GAA 7 7 7 7 7 7 | GGA 2 2 2 2 2 2
GTG 12 12 12 12 12 12 | GCG 4 4 4 4 4 4 | GAG 7 7 7 7 7 7 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907705_1_403_MLBR_RS01930
position 1: T:0.12644 C:0.25287 A:0.19157 G:0.42912
position 2: T:0.27969 C:0.21839 A:0.29885 G:0.20307
position 3: T:0.13027 C:0.45594 A:0.14943 G:0.26437
Average T:0.17880 C:0.30907 A:0.21328 G:0.29885
#2: NC_002677_1_NP_301381_1_253_ML0393
position 1: T:0.12644 C:0.25287 A:0.19157 G:0.42912
position 2: T:0.27969 C:0.21839 A:0.29885 G:0.20307
position 3: T:0.13027 C:0.45594 A:0.14943 G:0.26437
Average T:0.17880 C:0.30907 A:0.21328 G:0.29885
#3: NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695
position 1: T:0.12644 C:0.25287 A:0.19157 G:0.42912
position 2: T:0.27969 C:0.21839 A:0.29885 G:0.20307
position 3: T:0.13027 C:0.45594 A:0.14943 G:0.26437
Average T:0.17880 C:0.30907 A:0.21328 G:0.29885
#4: NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905
position 1: T:0.12644 C:0.25287 A:0.19157 G:0.42912
position 2: T:0.27969 C:0.21839 A:0.29885 G:0.20307
position 3: T:0.13027 C:0.45594 A:0.14943 G:0.26437
Average T:0.17880 C:0.30907 A:0.21328 G:0.29885
#5: NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085
position 1: T:0.12644 C:0.25287 A:0.19157 G:0.42912
position 2: T:0.27969 C:0.21839 A:0.29885 G:0.20307
position 3: T:0.13027 C:0.45594 A:0.14943 G:0.26437
Average T:0.17880 C:0.30907 A:0.21328 G:0.29885
#6: NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170
position 1: T:0.12644 C:0.25287 A:0.19157 G:0.42912
position 2: T:0.27969 C:0.21839 A:0.29885 G:0.20307
position 3: T:0.13027 C:0.45594 A:0.14943 G:0.26437
Average T:0.17880 C:0.30907 A:0.21328 G:0.29885
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 24 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 0
TTC 42 | TCC 24 | TAC 30 | TGC 6
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 18 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 6
CTC 42 | CCC 24 | CAC 24 | CGC 54
CTA 30 | CCA 6 | Gln Q CAA 24 | CGA 18
CTG 60 | CCG 12 | CAG 42 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 18 | Ser S AGT 24
ATC 42 | ACC 72 | AAC 24 | AGC 6
ATA 6 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 42 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 12 | Asp D GAT 18 | Gly G GGT 42
GTC 48 | GCC 72 | GAC 120 | GGC 84
GTA 30 | GCA 30 | Glu E GAA 42 | GGA 12
GTG 72 | GCG 24 | GAG 42 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12644 C:0.25287 A:0.19157 G:0.42912
position 2: T:0.27969 C:0.21839 A:0.29885 G:0.20307
position 3: T:0.13027 C:0.45594 A:0.14943 G:0.26437
Average T:0.17880 C:0.30907 A:0.21328 G:0.29885
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1018.367957 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299961 1.300005
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907705_1_403_MLBR_RS01930: 0.000004, NC_002677_1_NP_301381_1_253_ML0393: 0.000004, NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695: 0.000004, NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905: 0.000004, NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085: 0.000004, NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29996
omega (dN/dS) = 1.30001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 630.3 152.7 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 630.3 152.7 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 630.3 152.7 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 630.3 152.7 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 630.3 152.7 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 630.3 152.7 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1018.367946 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.165920 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907705_1_403_MLBR_RS01930: 0.000004, NC_002677_1_NP_301381_1_253_ML0393: 0.000004, NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695: 0.000004, NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905: 0.000004, NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085: 0.000004, NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.16592
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 633.9 149.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 633.9 149.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 633.9 149.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 633.9 149.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 633.9 149.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 633.9 149.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1018.367955 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.132424 0.688309 0.175909 0.015116 1.683778
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907705_1_403_MLBR_RS01930: 0.000004, NC_002677_1_NP_301381_1_253_ML0393: 0.000004, NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695: 0.000004, NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905: 0.000004, NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085: 0.000004, NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.13242
MLEs of dN/dS (w) for site classes (K=3)
p: 0.68831 0.17591 0.13578
w: 0.01512 1.00000 1.68378
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 634.8 148.2 0.4149 0.0000 0.0000 0.0 0.0
7..2 0.000 634.8 148.2 0.4149 0.0000 0.0000 0.0 0.0
7..3 0.000 634.8 148.2 0.4149 0.0000 0.0000 0.0 0.0
7..4 0.000 634.8 148.2 0.4149 0.0000 0.0000 0.0 0.0
7..5 0.000 634.8 148.2 0.4149 0.0000 0.0000 0.0 0.0
7..6 0.000 634.8 148.2 0.4149 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907705_1_403_MLBR_RS01930)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907705_1_403_MLBR_RS01930)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1018.367949 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 15.036235 6.500644 28.605252
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907705_1_403_MLBR_RS01930: 0.000004, NC_002677_1_NP_301381_1_253_ML0393: 0.000004, NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695: 0.000004, NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905: 0.000004, NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085: 0.000004, NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 15.03623
Parameters in M7 (beta):
p = 6.50064 q = 28.60525
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.08990 0.11869 0.13819 0.15503 0.17108 0.18743 0.20511 0.22573 0.25279 0.30105
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 577.9 205.1 0.1845 0.0000 0.0000 0.0 0.0
7..2 0.000 577.9 205.1 0.1845 0.0000 0.0000 0.0 0.0
7..3 0.000 577.9 205.1 0.1845 0.0000 0.0000 0.0 0.0
7..4 0.000 577.9 205.1 0.1845 0.0000 0.0000 0.0 0.0
7..5 0.000 577.9 205.1 0.1845 0.0000 0.0000 0.0 0.0
7..6 0.000 577.9 205.1 0.1845 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1018.367943 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 15.038953 0.000010 0.399674 2.164200 2.108491
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907705_1_403_MLBR_RS01930: 0.000004, NC_002677_1_NP_301381_1_253_ML0393: 0.000004, NZ_LVXE01000013_1_WP_010907705_1_433_A3216_RS05695: 0.000004, NZ_LYPH01000014_1_WP_010907705_1_398_A8144_RS01905: 0.000004, NZ_CP029543_1_WP_010907705_1_407_DIJ64_RS02085: 0.000004, NZ_AP014567_1_WP_010907705_1_424_JK2ML_RS02170: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 15.03895
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.39967 q = 2.16420
(p1 = 0.99999) w = 2.10849
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00022 0.00343 0.01240 0.02919 0.05599 0.09566 0.15255 0.23434 0.35786 0.58225 2.10849
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 577.9 205.1 2.1085 0.0000 0.0000 0.0 0.0
7..2 0.000 577.9 205.1 2.1085 0.0000 0.0000 0.0 0.0
7..3 0.000 577.9 205.1 2.1085 0.0000 0.0000 0.0 0.0
7..4 0.000 577.9 205.1 2.1085 0.0000 0.0000 0.0 0.0
7..5 0.000 577.9 205.1 2.1085 0.0000 0.0000 0.0 0.0
7..6 0.000 577.9 205.1 2.1085 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907705_1_403_MLBR_RS01930)
Pr(w>1) post mean +- SE for w
1 M 1.000** 2.108
2 A 1.000** 2.108
3 N 1.000** 2.108
4 W 1.000** 2.108
5 D 1.000** 2.108
6 H 1.000** 2.108
7 P 1.000** 2.108
8 T 1.000** 2.108
9 S 1.000** 2.108
10 K 1.000** 2.108
11 V 1.000** 2.108
12 R 1.000** 2.108
13 S 1.000** 2.108
14 T 1.000** 2.108
15 V 1.000** 2.108
16 L 1.000** 2.108
17 G 1.000** 2.108
18 L 1.000** 2.108
19 P 1.000** 2.108
20 E 1.000** 2.108
21 Q 1.000** 2.108
22 V 1.000** 2.108
23 R 1.000** 2.108
24 A 1.000** 2.108
25 C 1.000** 2.108
26 L 1.000** 2.108
27 F 1.000** 2.108
28 D 1.000** 2.108
29 L 1.000** 2.108
30 D 1.000** 2.108
31 G 1.000** 2.108
32 V 1.000** 2.108
33 L 1.000** 2.108
34 T 1.000** 2.108
35 D 1.000** 2.108
36 T 1.000** 2.108
37 A 1.000** 2.108
38 S 1.000** 2.108
39 V 1.000** 2.108
40 H 1.000** 2.108
41 A 1.000** 2.108
42 K 1.000** 2.108
43 A 1.000** 2.108
44 W 1.000** 2.108
45 Q 1.000** 2.108
46 T 1.000** 2.108
47 M 1.000** 2.108
48 F 1.000** 2.108
49 D 1.000** 2.108
50 T 1.000** 2.108
51 Y 1.000** 2.108
52 L 1.000** 2.108
53 Y 1.000** 2.108
54 Q 1.000** 2.108
55 R 1.000** 2.108
56 A 1.000** 2.108
57 K 1.000** 2.108
58 H 1.000** 2.108
59 T 1.000** 2.108
60 G 1.000** 2.108
61 E 1.000** 2.108
62 N 1.000** 2.108
63 F 1.000** 2.108
64 V 1.000** 2.108
65 P 1.000** 2.108
66 F 1.000** 2.108
67 D 1.000** 2.108
68 P 1.000** 2.108
69 T 1.000** 2.108
70 A 1.000** 2.108
71 D 1.000** 2.108
72 Y 1.000** 2.108
73 R 1.000** 2.108
74 Q 1.000** 2.108
75 Y 1.000** 2.108
76 V 1.000** 2.108
77 D 1.000** 2.108
78 G 1.000** 2.108
79 K 1.000** 2.108
80 K 1.000** 2.108
81 R 1.000** 2.108
82 E 1.000** 2.108
83 D 1.000** 2.108
84 G 1.000** 2.108
85 V 1.000** 2.108
86 R 1.000** 2.108
87 S 1.000** 2.108
88 F 1.000** 2.108
89 L 1.000** 2.108
90 G 1.000** 2.108
91 S 1.000** 2.108
92 R 1.000** 2.108
93 G 1.000** 2.108
94 I 1.000** 2.108
95 T 1.000** 2.108
96 L 1.000** 2.108
97 P 1.000** 2.108
98 E 1.000** 2.108
99 G 1.000** 2.108
100 S 1.000** 2.108
101 A 1.000** 2.108
102 D 1.000** 2.108
103 N 1.000** 2.108
104 S 1.000** 2.108
105 G 1.000** 2.108
106 D 1.000** 2.108
107 V 1.000** 2.108
108 E 1.000** 2.108
109 T 1.000** 2.108
110 I 1.000** 2.108
111 Y 1.000** 2.108
112 G 1.000** 2.108
113 L 1.000** 2.108
114 G 1.000** 2.108
115 N 1.000** 2.108
116 R 1.000** 2.108
117 K 1.000** 2.108
118 D 1.000** 2.108
119 D 1.000** 2.108
120 L 1.000** 2.108
121 F 1.000** 2.108
122 R 1.000** 2.108
123 Q 1.000** 2.108
124 V 1.000** 2.108
125 L 1.000** 2.108
126 K 1.000** 2.108
127 E 1.000** 2.108
128 H 1.000** 2.108
129 G 1.000** 2.108
130 I 1.000** 2.108
131 E 1.000** 2.108
132 V 1.000** 2.108
133 F 1.000** 2.108
134 D 1.000** 2.108
135 G 1.000** 2.108
136 S 1.000** 2.108
137 R 1.000** 2.108
138 R 1.000** 2.108
139 Y 1.000** 2.108
140 L 1.000** 2.108
141 E 1.000** 2.108
142 A 1.000** 2.108
143 I 1.000** 2.108
144 T 1.000** 2.108
145 Y 1.000** 2.108
146 A 1.000** 2.108
147 G 1.000** 2.108
148 L 1.000** 2.108
149 G 1.000** 2.108
150 V 1.000** 2.108
151 A 1.000** 2.108
152 V 1.000** 2.108
153 V 1.000** 2.108
154 S 1.000** 2.108
155 S 1.000** 2.108
156 S 1.000** 2.108
157 T 1.000** 2.108
158 N 1.000** 2.108
159 T 1.000** 2.108
160 R 1.000** 2.108
161 D 1.000** 2.108
162 V 1.000** 2.108
163 L 1.000** 2.108
164 K 1.000** 2.108
165 I 1.000** 2.108
166 T 1.000** 2.108
167 G 1.000** 2.108
168 L 1.000** 2.108
169 D 1.000** 2.108
170 R 1.000** 2.108
171 F 1.000** 2.108
172 V 1.000** 2.108
173 Q 1.000** 2.108
174 Q 1.000** 2.108
175 Q 1.000** 2.108
176 V 1.000** 2.108
177 D 1.000** 2.108
178 G 1.000** 2.108
179 I 1.000** 2.108
180 T 1.000** 2.108
181 L 1.000** 2.108
182 R 1.000** 2.108
183 E 1.000** 2.108
184 E 1.000** 2.108
185 H 1.000** 2.108
186 I 1.000** 2.108
187 A 1.000** 2.108
188 G 1.000** 2.108
189 K 1.000** 2.108
190 P 1.000** 2.108
191 A 1.000** 2.108
192 P 1.000** 2.108
193 D 1.000** 2.108
194 S 1.000** 2.108
195 Y 1.000** 2.108
196 L 1.000** 2.108
197 R 1.000** 2.108
198 G 1.000** 2.108
199 A 1.000** 2.108
200 Q 1.000** 2.108
201 L 1.000** 2.108
202 L 1.000** 2.108
203 D 1.000** 2.108
204 V 1.000** 2.108
205 A 1.000** 2.108
206 P 1.000** 2.108
207 D 1.000** 2.108
208 A 1.000** 2.108
209 A 1.000** 2.108
210 A 1.000** 2.108
211 V 1.000** 2.108
212 F 1.000** 2.108
213 E 1.000** 2.108
214 D 1.000** 2.108
215 A 1.000** 2.108
216 L 1.000** 2.108
217 S 1.000** 2.108
218 G 1.000** 2.108
219 V 1.000** 2.108
220 Q 1.000** 2.108
221 A 1.000** 2.108
222 G 1.000** 2.108
223 L 1.000** 2.108
224 S 1.000** 2.108
225 G 1.000** 2.108
226 H 1.000** 2.108
227 F 1.000** 2.108
228 G 1.000** 2.108
229 F 1.000** 2.108
230 V 1.000** 2.108
231 V 1.000** 2.108
232 G 1.000** 2.108
233 I 1.000** 2.108
234 N 1.000** 2.108
235 R 1.000** 2.108
236 T 1.000** 2.108
237 G 1.000** 2.108
238 R 1.000** 2.108
239 V 1.000** 2.108
240 D 1.000** 2.108
241 Q 1.000** 2.108
242 A 1.000** 2.108
243 E 1.000** 2.108
244 E 1.000** 2.108
245 L 1.000** 2.108
246 R 1.000** 2.108
247 R 1.000** 2.108
248 I 1.000** 2.108
249 G 1.000** 2.108
250 A 1.000** 2.108
251 N 1.000** 2.108
252 V 1.000** 2.108
253 V 1.000** 2.108
254 V 1.000** 2.108
255 T 1.000** 2.108
256 D 1.000** 2.108
257 L 1.000** 2.108
258 A 1.000** 2.108
259 E 1.000** 2.108
260 L 1.000** 2.108
261 L 1.000** 2.108
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907705_1_403_MLBR_RS01930)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Time used: 0:11
Model 1: NearlyNeutral -1018.367946 Model 2: PositiveSelection -1018.367955 Model 0: one-ratio -1018.367957 Model 7: beta -1018.367949 Model 8: beta&w>1 -1018.367943 Model 0 vs 1 2.2000000171829015E-5 Model 2 vs 1 1.8000000181928044E-5 Model 8 vs 7 1.1999999969702912E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
