--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:35:39 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0068/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -967.19 -970.17
2 -967.21 -974.80
--------------------------------------
TOTAL -967.20 -974.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903391 0.089606 0.384863 1.506467 0.872232 1486.60 1493.80 1.000
r(A<->C){all} 0.169995 0.019407 0.000012 0.443251 0.132653 239.82 253.68 1.001
r(A<->G){all} 0.166639 0.020717 0.000194 0.447702 0.129383 220.40 287.66 1.001
r(A<->T){all} 0.158909 0.016903 0.000064 0.414085 0.126557 222.66 233.41 1.000
r(C<->G){all} 0.155790 0.019169 0.000005 0.433337 0.117153 194.57 275.03 1.007
r(C<->T){all} 0.175934 0.021372 0.000141 0.469963 0.138480 194.50 207.88 1.001
r(G<->T){all} 0.172732 0.019232 0.000052 0.440106 0.138036 231.22 243.69 1.003
pi(A){all} 0.234894 0.000251 0.202014 0.264733 0.234609 1344.91 1422.96 1.000
pi(C){all} 0.322224 0.000319 0.288836 0.358708 0.321720 1290.68 1363.35 1.000
pi(G){all} 0.288511 0.000290 0.255717 0.321201 0.288116 1095.92 1217.37 1.000
pi(T){all} 0.154371 0.000189 0.128584 0.180956 0.154099 1264.01 1365.61 1.000
alpha{1,2} 0.438822 0.247566 0.000185 1.465335 0.264255 1329.43 1389.19 1.001
alpha{3} 0.445926 0.221098 0.000116 1.438182 0.291907 1294.39 1300.20 1.000
pinvar{all} 0.997909 0.000006 0.993418 1.000000 0.998723 1374.24 1400.24 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -940.071984
Model 2: PositiveSelection -940.071988
Model 0: one-ratio -940.072007
Model 7: beta -940.072007
Model 8: beta&w>1 -940.071978
Model 0 vs 1 4.5999999883861165E-5
Model 2 vs 1 7.999999979801942E-6
Model 8 vs 7 5.800000008093775E-5
>C1
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C2
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C3
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C4
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C5
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C6
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=238
C1 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C2 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C3 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C4 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C5 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C6 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
**************************************************
C1 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C2 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C3 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C4 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C5 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C6 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
**************************************************
C1 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C2 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C3 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C4 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C5 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C6 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
**************************************************
C1 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C2 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C3 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C4 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C5 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C6 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
**************************************************
C1 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C2 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C3 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C4 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C5 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C6 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7140]--->[7140]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.480 Mb, Max= 30.778 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C2 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C3 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C4 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C5 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C6 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
**************************************************
C1 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C2 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C3 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C4 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C5 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C6 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
**************************************************
C1 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C2 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C3 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C4 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C5 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C6 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
**************************************************
C1 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C2 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C3 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C4 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C5 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C6 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
**************************************************
C1 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C2 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C3 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C4 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C5 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C6 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
**************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C2 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C3 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C4 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C5 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C6 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
**************************************************
C1 CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C2 CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C3 CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C4 CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C5 CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C6 CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
**************************************************
C1 ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C2 ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C3 ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C4 ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C5 ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C6 ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
**************************************************
C1 AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C2 AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C3 AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C4 AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C5 AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C6 AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
**************************************************
C1 CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C2 CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C3 CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C4 CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C5 CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C6 CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
**************************************************
C1 CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C2 CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C3 CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C4 CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C5 CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C6 CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
**************************************************
C1 GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C2 GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C3 GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C4 GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C5 GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C6 GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
**************************************************
C1 GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C2 GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C3 GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C4 GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C5 GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C6 GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
**************************************************
C1 CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C2 CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C3 CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C4 CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C5 CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C6 CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
**************************************************
C1 GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C2 GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C3 GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C4 GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C5 GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C6 GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
**************************************************
C1 CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C2 CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C3 CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C4 CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C5 CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C6 CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
**************************************************
C1 CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C2 CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C3 CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C4 CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C5 CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C6 CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
**************************************************
C1 TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C2 TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C3 TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C4 TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C5 TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C6 TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
**************************************************
C1 TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C2 TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C3 TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C4 TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C5 TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C6 TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
**************************************************
C1 GGAAGGCAGCGACC
C2 GGAAGGCAGCGACC
C3 GGAAGGCAGCGACC
C4 GGAAGGCAGCGACC
C5 GGAAGGCAGCGACC
C6 GGAAGGCAGCGACC
**************
>C1
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C2
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C3
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C4
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C5
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C6
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C1
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C2
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C3
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C4
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C5
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C6
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 714 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790060
Setting output file names to "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1787256145
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0224910771
Seed = 1299738387
Swapseed = 1579790060
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1597.966145 -- -24.965149
Chain 2 -- -1597.966236 -- -24.965149
Chain 3 -- -1597.966236 -- -24.965149
Chain 4 -- -1597.966236 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1597.966236 -- -24.965149
Chain 2 -- -1597.966236 -- -24.965149
Chain 3 -- -1597.966236 -- -24.965149
Chain 4 -- -1597.966236 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1597.966] (-1597.966) (-1597.966) (-1597.966) * [-1597.966] (-1597.966) (-1597.966) (-1597.966)
500 -- (-980.918) [-976.243] (-998.883) (-980.673) * (-973.346) [-980.107] (-992.547) (-976.045) -- 0:00:00
1000 -- (-977.752) (-971.532) (-978.915) [-975.321] * (-974.551) (-973.486) (-977.202) [-978.824] -- 0:16:39
1500 -- (-974.896) (-974.187) (-978.196) [-976.578] * (-974.796) [-974.039] (-973.346) (-975.975) -- 0:11:05
2000 -- [-975.355] (-980.102) (-972.619) (-985.772) * (-975.004) (-976.972) [-971.693] (-971.185) -- 0:08:19
2500 -- (-976.131) [-978.002] (-979.949) (-973.500) * (-983.677) (-973.442) [-974.101] (-977.863) -- 0:06:39
3000 -- [-974.580] (-976.550) (-975.353) (-982.389) * (-973.592) (-988.915) [-980.405] (-972.485) -- 0:05:32
3500 -- (-978.800) (-971.056) [-973.623] (-977.024) * [-969.073] (-983.636) (-975.874) (-976.186) -- 0:04:44
4000 -- (-981.502) (-977.292) (-974.440) [-974.278] * (-985.234) (-978.591) [-978.883] (-984.708) -- 0:04:09
4500 -- (-981.226) [-976.028] (-979.468) (-976.647) * (-975.524) (-983.471) [-975.986] (-979.850) -- 0:03:41
5000 -- (-977.244) (-975.118) (-983.564) [-985.886] * (-977.167) (-980.169) [-977.248] (-980.496) -- 0:03:19
Average standard deviation of split frequencies: 0.109311
5500 -- [-972.414] (-975.682) (-982.867) (-976.865) * [-972.212] (-987.332) (-970.305) (-975.249) -- 0:03:00
6000 -- (-976.616) (-977.094) [-973.659] (-980.055) * (-981.146) (-982.802) [-971.079] (-973.615) -- 0:02:45
6500 -- [-985.862] (-977.042) (-977.401) (-975.091) * [-976.903] (-979.150) (-978.098) (-977.461) -- 0:02:32
7000 -- (-973.600) [-983.015] (-976.067) (-976.378) * [-978.461] (-976.143) (-976.570) (-979.590) -- 0:02:21
7500 -- (-974.210) (-979.659) [-979.518] (-977.159) * [-975.324] (-976.981) (-973.260) (-985.909) -- 0:02:12
8000 -- (-973.047) (-981.337) (-981.162) [-975.382] * (-971.336) (-974.091) [-978.089] (-980.266) -- 0:02:04
8500 -- (-979.589) [-975.080] (-980.671) (-979.941) * (-984.861) (-978.251) [-972.256] (-985.008) -- 0:01:56
9000 -- (-972.396) (-976.671) [-973.674] (-981.692) * (-981.566) (-985.789) (-978.349) [-974.232] -- 0:01:50
9500 -- [-982.672] (-988.311) (-989.670) (-973.955) * [-975.428] (-983.643) (-981.078) (-975.965) -- 0:01:44
10000 -- (-972.778) [-973.861] (-973.683) (-979.620) * (-978.537) (-981.995) [-971.302] (-979.639) -- 0:01:39
Average standard deviation of split frequencies: 0.057452
10500 -- (-981.091) (-977.181) (-977.285) [-975.424] * (-974.334) (-979.038) [-973.124] (-979.776) -- 0:01:34
11000 -- (-977.654) [-977.588] (-973.288) (-973.560) * (-985.247) (-976.713) [-971.642] (-974.484) -- 0:01:29
11500 -- (-977.996) (-976.682) [-966.216] (-975.145) * (-981.288) (-990.617) (-976.908) [-973.121] -- 0:01:25
12000 -- [-981.081] (-980.108) (-965.922) (-975.570) * (-975.309) (-966.605) [-975.088] (-981.861) -- 0:01:22
12500 -- (-976.037) (-979.055) [-967.487] (-976.830) * (-986.374) (-968.582) (-982.466) [-973.363] -- 0:01:19
13000 -- (-980.925) (-969.989) (-967.761) [-974.396] * [-973.446] (-967.242) (-982.999) (-980.789) -- 0:01:15
13500 -- (-975.941) [-980.953] (-967.552) (-976.762) * (-972.279) [-967.680] (-976.353) (-976.604) -- 0:01:13
14000 -- [-976.521] (-977.321) (-970.290) (-976.391) * (-970.736) [-965.989] (-984.753) (-978.324) -- 0:01:10
14500 -- (-978.567) [-979.273] (-965.915) (-973.302) * (-974.787) (-968.045) [-978.287] (-976.394) -- 0:01:07
15000 -- (-971.645) (-978.552) [-965.889] (-979.649) * (-969.481) (-966.746) [-977.859] (-975.856) -- 0:01:05
Average standard deviation of split frequencies: 0.068746
15500 -- (-978.488) (-971.762) (-968.027) [-971.146] * (-969.018) (-968.950) (-978.129) [-972.466] -- 0:02:07
16000 -- [-972.827] (-975.396) (-968.019) (-979.963) * (-967.710) [-967.091] (-971.633) (-981.312) -- 0:02:03
16500 -- (-978.297) (-973.968) [-969.062] (-971.825) * (-969.232) [-966.954] (-977.280) (-983.178) -- 0:01:59
17000 -- (-979.154) (-977.993) [-968.503] (-972.804) * (-969.448) [-970.202] (-974.000) (-980.347) -- 0:01:55
17500 -- (-981.387) (-977.563) (-966.743) [-978.522] * (-966.562) [-969.117] (-976.155) (-974.891) -- 0:01:52
18000 -- (-977.254) [-973.365] (-969.775) (-974.890) * [-967.775] (-970.529) (-972.162) (-977.061) -- 0:01:49
18500 -- (-968.713) (-974.342) (-970.265) [-975.989] * (-967.779) (-968.540) (-975.612) [-972.322] -- 0:01:46
19000 -- (-976.848) (-979.790) (-969.362) [-977.594] * (-967.781) [-969.607] (-976.587) (-977.461) -- 0:01:43
19500 -- (-972.185) (-975.372) [-969.933] (-978.649) * [-966.438] (-967.987) (-971.438) (-981.424) -- 0:01:40
20000 -- (-982.746) (-978.648) (-967.573) [-980.962] * (-967.510) (-967.401) (-975.450) [-980.683] -- 0:01:38
Average standard deviation of split frequencies: 0.045620
20500 -- [-975.174] (-977.538) (-969.845) (-974.329) * [-967.078] (-972.550) (-976.556) (-985.462) -- 0:01:35
21000 -- [-972.413] (-974.836) (-967.124) (-972.901) * (-967.315) (-967.874) (-982.809) [-967.510] -- 0:01:33
21500 -- [-976.545] (-981.529) (-968.083) (-974.269) * (-966.734) (-973.003) [-974.792] (-966.727) -- 0:01:31
22000 -- (-980.029) [-975.184] (-969.155) (-981.749) * [-969.307] (-969.273) (-974.832) (-966.124) -- 0:01:28
22500 -- (-975.535) [-975.146] (-969.786) (-973.950) * [-966.569] (-969.562) (-974.985) (-966.132) -- 0:01:26
23000 -- (-975.388) (-972.982) (-969.113) [-977.668] * [-968.448] (-969.218) (-983.577) (-966.070) -- 0:01:24
23500 -- (-981.053) (-977.285) (-972.190) [-977.982] * (-966.308) (-970.575) (-977.235) [-966.966] -- 0:01:23
24000 -- [-980.503] (-975.287) (-967.722) (-972.816) * (-969.970) (-969.858) (-989.953) [-967.334] -- 0:01:21
24500 -- (-972.463) [-984.835] (-966.346) (-976.695) * (-968.846) (-969.036) (-983.261) [-968.272] -- 0:01:19
25000 -- [-978.597] (-980.700) (-967.048) (-971.448) * (-966.845) (-974.790) [-973.239] (-967.189) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- (-979.697) [-973.079] (-967.433) (-974.350) * (-966.950) (-968.683) [-977.748] (-966.451) -- 0:01:16
26000 -- [-977.249] (-979.109) (-966.183) (-980.773) * (-967.511) (-966.545) (-972.761) [-966.682] -- 0:01:14
26500 -- [-977.888] (-981.487) (-965.692) (-970.404) * (-968.955) [-969.217] (-981.599) (-967.570) -- 0:01:13
27000 -- [-978.115] (-973.697) (-966.897) (-981.409) * (-966.210) (-971.208) [-978.095] (-968.305) -- 0:01:12
27500 -- [-974.335] (-982.207) (-967.166) (-978.744) * [-967.434] (-971.208) (-980.588) (-968.246) -- 0:01:10
28000 -- [-975.814] (-977.990) (-966.031) (-981.656) * (-966.491) (-967.573) (-973.698) [-965.915] -- 0:01:09
28500 -- (-979.365) (-977.898) (-967.207) [-984.624] * (-966.949) [-970.403] (-979.464) (-966.362) -- 0:01:08
29000 -- [-975.028] (-979.160) (-966.907) (-982.202) * [-966.859] (-973.264) (-978.769) (-967.957) -- 0:01:06
29500 -- (-975.364) (-974.001) (-966.406) [-973.658] * (-967.053) [-971.523] (-977.614) (-969.406) -- 0:01:05
30000 -- (-974.337) (-984.091) [-969.459] (-977.817) * [-966.205] (-968.311) (-979.266) (-966.788) -- 0:01:04
Average standard deviation of split frequencies: 0.039198
30500 -- (-976.149) (-990.490) (-967.749) [-980.794] * (-968.352) [-966.936] (-974.032) (-966.822) -- 0:01:03
31000 -- (-975.954) [-982.406] (-967.178) (-1001.166) * (-967.371) [-966.515] (-984.964) (-968.820) -- 0:01:02
31500 -- [-973.438] (-975.645) (-972.057) (-966.456) * (-966.684) (-967.229) (-973.354) [-970.446] -- 0:01:32
32000 -- (-976.224) (-976.748) (-969.165) [-967.746] * [-966.644] (-967.423) (-976.596) (-968.761) -- 0:01:30
32500 -- (-975.565) (-967.907) [-966.984] (-967.517) * (-967.278) (-967.373) (-979.864) [-968.423] -- 0:01:29
33000 -- (-975.246) [-968.428] (-966.832) (-968.147) * (-966.830) (-968.979) (-979.577) [-966.667] -- 0:01:27
33500 -- (-973.811) [-967.635] (-967.398) (-967.096) * (-967.693) [-969.036] (-976.697) (-968.016) -- 0:01:26
34000 -- (-977.390) (-966.952) [-967.889] (-966.435) * (-968.754) (-970.138) (-973.910) [-968.365] -- 0:01:25
34500 -- (-973.497) (-969.656) [-966.752] (-968.614) * (-968.047) (-969.563) (-974.788) [-968.796] -- 0:01:23
35000 -- [-979.700] (-969.817) (-967.198) (-968.032) * (-967.296) (-967.416) [-982.330] (-966.188) -- 0:01:22
Average standard deviation of split frequencies: 0.035117
35500 -- (-972.339) (-966.870) [-967.737] (-967.534) * (-967.771) [-967.812] (-976.790) (-972.722) -- 0:01:21
36000 -- (-985.307) [-966.289] (-969.258) (-966.120) * (-968.218) [-966.260] (-976.011) (-967.998) -- 0:01:20
36500 -- [-977.276] (-967.226) (-967.701) (-970.710) * (-969.427) (-965.809) [-977.110] (-967.245) -- 0:01:19
37000 -- [-975.963] (-968.536) (-967.283) (-970.783) * (-968.443) [-966.074] (-978.661) (-968.254) -- 0:01:18
37500 -- [-977.872] (-967.229) (-966.087) (-971.714) * (-968.155) (-968.583) (-975.457) [-967.079] -- 0:01:17
38000 -- (-982.793) (-967.360) (-967.904) [-969.841] * (-971.237) (-968.866) (-979.076) [-968.089] -- 0:01:15
38500 -- (-981.227) (-968.768) [-968.509] (-968.637) * (-966.848) (-967.746) [-969.581] (-967.322) -- 0:01:14
39000 -- (-974.302) (-968.497) [-967.218] (-968.250) * [-967.113] (-968.059) (-981.419) (-968.524) -- 0:01:13
39500 -- (-977.183) (-968.272) (-968.286) [-967.432] * (-966.756) [-967.295] (-981.520) (-967.552) -- 0:01:12
40000 -- (-971.811) (-970.139) [-967.086] (-966.673) * (-967.230) (-972.373) (-985.498) [-969.487] -- 0:01:12
Average standard deviation of split frequencies: 0.034094
40500 -- (-969.781) [-968.238] (-967.304) (-967.215) * (-967.339) [-967.497] (-976.188) (-966.829) -- 0:01:11
41000 -- [-966.162] (-966.759) (-967.423) (-969.176) * (-966.160) (-967.101) [-977.539] (-967.410) -- 0:01:10
41500 -- (-967.048) (-966.792) [-967.425] (-967.653) * (-967.936) (-966.986) [-979.386] (-973.728) -- 0:01:09
42000 -- (-968.301) [-968.619] (-967.346) (-966.789) * (-969.213) (-967.966) (-978.046) [-969.088] -- 0:01:08
42500 -- (-968.302) [-968.446] (-970.483) (-966.247) * [-969.910] (-967.879) (-978.403) (-967.915) -- 0:01:07
43000 -- (-967.627) (-967.111) [-969.153] (-968.796) * (-974.550) (-967.503) [-974.843] (-966.555) -- 0:01:06
43500 -- [-967.583] (-966.661) (-967.873) (-968.614) * (-969.209) (-966.879) [-970.468] (-968.015) -- 0:01:05
44000 -- (-968.190) (-967.298) (-969.462) [-977.328] * [-970.557] (-969.222) (-982.408) (-966.797) -- 0:01:05
44500 -- [-966.792] (-966.338) (-967.942) (-969.470) * (-970.487) (-967.669) (-975.030) [-966.341] -- 0:01:04
45000 -- (-966.701) [-966.437] (-968.886) (-967.015) * [-969.120] (-972.766) (-983.248) (-968.061) -- 0:01:03
Average standard deviation of split frequencies: 0.028304
45500 -- [-966.423] (-967.087) (-966.310) (-967.032) * [-968.229] (-968.438) (-981.726) (-972.772) -- 0:01:02
46000 -- (-967.254) (-968.705) (-967.386) [-967.121] * (-968.268) (-968.225) (-977.293) [-966.865] -- 0:01:02
46500 -- [-971.085] (-967.014) (-967.682) (-967.374) * [-972.262] (-968.321) (-979.002) (-966.796) -- 0:01:01
47000 -- (-966.908) [-965.758] (-970.701) (-968.219) * [-969.123] (-966.196) (-973.775) (-967.312) -- 0:01:00
47500 -- (-970.338) [-966.056] (-973.457) (-968.002) * [-968.181] (-967.169) (-981.674) (-972.800) -- 0:01:00
48000 -- (-968.468) (-968.077) [-967.710] (-970.722) * (-969.787) [-966.195] (-979.338) (-971.274) -- 0:01:19
48500 -- [-969.989] (-968.945) (-971.039) (-972.452) * (-966.282) [-966.969] (-978.752) (-969.520) -- 0:01:18
49000 -- [-967.645] (-966.135) (-968.355) (-967.531) * (-966.108) (-965.963) (-980.400) [-967.205] -- 0:01:17
49500 -- (-969.068) (-966.041) (-966.927) [-968.749] * (-967.266) [-969.508] (-982.443) (-969.930) -- 0:01:16
50000 -- (-968.667) [-966.041] (-970.949) (-967.396) * [-966.303] (-966.464) (-969.549) (-968.746) -- 0:01:16
Average standard deviation of split frequencies: 0.032319
50500 -- (-971.668) (-966.993) (-969.372) [-967.977] * (-968.465) (-966.682) [-968.051] (-969.035) -- 0:01:15
51000 -- (-970.122) (-965.915) (-966.676) [-969.379] * [-966.640] (-966.946) (-967.016) (-972.922) -- 0:01:14
51500 -- (-969.889) [-967.172] (-968.150) (-965.871) * (-968.584) [-967.567] (-970.449) (-968.602) -- 0:01:13
52000 -- (-969.320) [-965.929] (-966.472) (-966.073) * (-968.212) (-969.212) [-968.703] (-969.502) -- 0:01:12
52500 -- (-968.772) (-971.365) (-967.114) [-966.233] * [-968.166] (-972.588) (-968.709) (-975.833) -- 0:01:12
53000 -- [-967.667] (-968.388) (-970.281) (-967.147) * (-969.021) (-968.602) [-968.602] (-970.205) -- 0:01:11
53500 -- (-968.670) [-970.198] (-969.175) (-972.143) * [-972.208] (-966.187) (-966.469) (-970.369) -- 0:01:10
54000 -- [-967.559] (-969.283) (-969.248) (-969.804) * (-970.005) [-967.003] (-966.465) (-970.485) -- 0:01:10
54500 -- (-970.636) [-969.534] (-966.849) (-968.644) * (-969.189) [-967.569] (-967.423) (-966.963) -- 0:01:09
55000 -- [-967.747] (-967.915) (-967.167) (-967.152) * (-970.272) (-968.027) [-966.816] (-968.532) -- 0:01:08
Average standard deviation of split frequencies: 0.031567
55500 -- (-967.140) (-967.873) [-966.859] (-969.772) * (-969.964) (-970.622) [-966.393] (-968.744) -- 0:01:08
56000 -- (-968.789) [-968.928] (-965.771) (-969.566) * (-968.927) [-969.337] (-970.046) (-969.455) -- 0:01:07
56500 -- (-966.586) (-972.218) [-968.410] (-970.186) * (-968.002) (-970.500) [-966.161] (-966.735) -- 0:01:06
57000 -- [-967.850] (-973.534) (-972.086) (-969.494) * [-966.023] (-969.655) (-966.507) (-966.497) -- 0:01:06
57500 -- (-966.061) [-967.778] (-967.204) (-967.277) * (-972.530) [-966.094] (-969.387) (-968.368) -- 0:01:05
58000 -- (-966.670) [-967.091] (-967.805) (-967.834) * [-967.119] (-970.267) (-966.430) (-966.059) -- 0:01:04
58500 -- (-972.563) [-973.672] (-966.481) (-969.744) * (-967.181) (-969.331) [-966.203] (-966.704) -- 0:01:04
59000 -- (-966.695) [-969.615] (-966.539) (-971.327) * (-969.297) (-969.001) [-967.801] (-966.496) -- 0:01:03
59500 -- [-966.506] (-970.307) (-966.961) (-969.402) * (-968.624) [-967.340] (-969.422) (-966.493) -- 0:01:03
60000 -- (-969.019) (-970.324) (-969.528) [-966.113] * [-969.050] (-968.786) (-970.373) (-970.147) -- 0:01:02
Average standard deviation of split frequencies: 0.030650
60500 -- (-967.513) (-968.495) (-970.382) [-968.178] * (-969.144) (-968.780) (-967.580) [-967.707] -- 0:01:02
61000 -- (-967.553) (-967.474) (-967.320) [-966.819] * (-968.306) [-966.628] (-966.638) (-968.147) -- 0:01:01
61500 -- [-966.097] (-966.061) (-968.000) (-970.062) * (-972.013) [-966.637] (-968.488) (-967.905) -- 0:01:01
62000 -- [-966.669] (-966.715) (-968.289) (-968.535) * (-968.288) (-968.745) [-969.101] (-967.049) -- 0:01:00
62500 -- [-967.171] (-967.229) (-966.239) (-969.257) * (-967.097) (-967.961) (-969.042) [-969.251] -- 0:01:00
63000 -- (-966.625) (-968.686) [-968.136] (-972.188) * [-967.818] (-967.615) (-968.406) (-969.109) -- 0:00:59
63500 -- (-968.438) (-966.140) (-968.092) [-966.369] * (-968.642) (-968.197) [-967.211] (-966.220) -- 0:01:13
64000 -- (-966.767) [-971.858] (-968.602) (-967.184) * [-967.884] (-966.486) (-972.384) (-971.192) -- 0:01:13
64500 -- [-969.597] (-973.400) (-968.765) (-969.507) * (-966.432) (-966.007) (-966.133) [-968.060] -- 0:01:12
65000 -- (-968.160) [-973.465] (-966.870) (-969.894) * (-966.424) (-968.348) [-968.864] (-970.047) -- 0:01:11
Average standard deviation of split frequencies: 0.029998
65500 -- (-976.835) [-970.714] (-966.874) (-966.812) * (-967.128) [-965.693] (-970.309) (-965.999) -- 0:01:11
66000 -- (-971.145) (-966.936) (-967.428) [-966.593] * [-968.181] (-966.943) (-968.155) (-968.599) -- 0:01:10
66500 -- (-968.828) [-970.126] (-969.005) (-968.993) * (-968.933) (-967.571) [-970.254] (-971.266) -- 0:01:10
67000 -- (-966.645) [-970.360] (-973.595) (-967.524) * (-968.200) [-966.828] (-967.770) (-970.636) -- 0:01:09
67500 -- (-965.757) (-967.462) [-966.447] (-968.507) * (-968.560) (-967.631) (-969.524) [-967.489] -- 0:01:09
68000 -- (-966.481) [-969.502] (-968.038) (-967.289) * [-966.560] (-968.208) (-970.746) (-968.066) -- 0:01:08
68500 -- (-971.336) [-969.419] (-969.349) (-972.487) * (-967.826) (-968.853) (-969.777) [-971.525] -- 0:01:07
69000 -- (-966.741) [-972.798] (-966.489) (-972.305) * (-967.377) [-967.358] (-971.331) (-969.645) -- 0:01:07
69500 -- (-967.819) [-969.990] (-968.320) (-968.672) * (-966.698) (-970.119) (-968.650) [-969.333] -- 0:01:06
70000 -- (-973.125) (-968.330) [-967.760] (-967.973) * [-967.757] (-969.740) (-969.990) (-968.886) -- 0:01:06
Average standard deviation of split frequencies: 0.026350
70500 -- (-965.585) [-969.808] (-972.254) (-970.590) * (-967.662) (-969.703) (-968.742) [-967.391] -- 0:01:05
71000 -- (-966.512) [-966.992] (-966.518) (-970.362) * (-971.545) [-965.878] (-970.093) (-966.711) -- 0:01:05
71500 -- (-968.070) [-966.383] (-966.449) (-968.163) * (-967.837) [-967.316] (-967.295) (-966.563) -- 0:01:04
72000 -- (-969.812) [-966.744] (-966.520) (-966.835) * (-970.470) (-970.190) (-968.857) [-967.594] -- 0:01:04
72500 -- (-968.460) [-966.577] (-966.695) (-969.475) * (-967.922) (-968.625) (-967.375) [-969.441] -- 0:01:03
73000 -- (-967.477) [-965.679] (-968.315) (-966.990) * (-966.795) (-968.650) (-968.150) [-966.550] -- 0:01:03
73500 -- (-968.767) (-968.051) (-967.476) [-966.743] * (-966.604) (-969.796) [-967.325] (-969.283) -- 0:01:03
74000 -- (-969.144) (-967.146) (-967.134) [-968.547] * [-968.054] (-969.493) (-966.320) (-971.372) -- 0:01:02
74500 -- (-967.586) [-967.775] (-967.380) (-968.627) * (-968.560) [-971.148] (-965.638) (-967.819) -- 0:01:02
75000 -- [-967.982] (-968.038) (-966.520) (-967.919) * (-967.990) (-968.126) (-967.316) [-967.065] -- 0:01:01
Average standard deviation of split frequencies: 0.024158
75500 -- (-968.018) [-967.278] (-970.585) (-967.970) * (-967.025) (-969.573) [-966.206] (-965.692) -- 0:01:01
76000 -- (-967.128) [-966.802] (-968.556) (-972.007) * (-966.982) [-969.537] (-968.145) (-969.749) -- 0:01:00
76500 -- (-970.095) [-967.606] (-970.112) (-967.534) * (-967.982) (-968.297) (-968.252) [-968.781] -- 0:01:00
77000 -- (-968.102) (-969.710) [-974.344] (-966.109) * (-966.809) [-967.741] (-966.683) (-968.441) -- 0:00:59
77500 -- (-966.929) (-968.361) (-969.472) [-966.505] * [-965.646] (-967.697) (-967.956) (-970.055) -- 0:00:59
78000 -- (-969.488) (-968.475) (-968.734) [-968.657] * (-966.335) [-967.080] (-968.971) (-968.509) -- 0:00:59
78500 -- [-967.276] (-967.736) (-969.211) (-969.914) * [-966.158] (-972.962) (-968.411) (-968.775) -- 0:00:58
79000 -- [-967.032] (-966.559) (-967.636) (-966.810) * [-966.209] (-973.171) (-968.245) (-968.037) -- 0:00:58
79500 -- (-966.140) [-966.234] (-971.654) (-970.499) * (-966.648) (-974.980) [-967.994] (-967.504) -- 0:00:57
80000 -- (-968.265) (-971.782) (-969.669) [-968.976] * [-966.011] (-970.321) (-968.050) (-968.202) -- 0:01:09
Average standard deviation of split frequencies: 0.030142
80500 -- (-970.641) [-966.971] (-970.353) (-968.292) * (-965.882) (-966.821) [-968.799] (-968.864) -- 0:01:08
81000 -- [-968.812] (-969.416) (-966.884) (-968.194) * (-969.550) (-968.590) (-969.022) [-968.829] -- 0:01:08
81500 -- (-968.100) (-967.847) (-967.022) [-967.333] * (-970.951) (-967.440) (-967.922) [-968.233] -- 0:01:07
82000 -- (-968.932) [-966.979] (-969.575) (-967.888) * (-970.997) [-967.773] (-966.371) (-968.881) -- 0:01:07
82500 -- (-968.445) [-966.907] (-969.952) (-968.323) * (-966.422) (-970.845) (-966.631) [-968.061] -- 0:01:06
83000 -- (-966.441) [-970.935] (-970.227) (-970.392) * (-966.228) (-967.720) (-967.829) [-966.927] -- 0:01:06
83500 -- (-967.032) (-969.017) (-968.284) [-968.836] * (-966.289) (-972.472) [-966.755] (-967.511) -- 0:01:05
84000 -- (-967.294) (-970.552) (-968.767) [-968.419] * [-966.985] (-971.254) (-966.578) (-968.941) -- 0:01:05
84500 -- (-967.145) [-966.650] (-968.682) (-968.581) * (-970.695) (-972.414) [-971.427] (-969.280) -- 0:01:05
85000 -- (-966.694) [-971.752] (-967.232) (-970.142) * [-966.813] (-969.513) (-970.620) (-970.721) -- 0:01:04
Average standard deviation of split frequencies: 0.029874
85500 -- (-966.574) [-968.233] (-970.807) (-966.999) * (-970.627) [-969.377] (-968.446) (-971.686) -- 0:01:04
86000 -- (-965.924) [-970.046] (-966.374) (-969.503) * [-968.763] (-967.463) (-970.582) (-970.113) -- 0:01:03
86500 -- [-965.641] (-966.688) (-966.322) (-970.679) * (-970.344) (-967.516) [-968.363] (-968.042) -- 0:01:03
87000 -- (-967.068) [-966.757] (-974.139) (-968.616) * (-966.446) (-966.549) [-969.078] (-971.005) -- 0:01:02
87500 -- (-965.627) (-972.230) [-966.377] (-968.806) * (-966.599) [-968.157] (-966.775) (-967.416) -- 0:01:02
88000 -- (-967.027) [-971.275] (-966.946) (-974.258) * (-966.876) (-967.849) (-967.399) [-968.082] -- 0:01:02
88500 -- (-968.029) (-967.461) [-967.516] (-970.727) * [-967.539] (-967.840) (-966.898) (-967.781) -- 0:01:01
89000 -- (-967.223) (-968.684) [-966.911] (-968.740) * (-968.309) [-969.723] (-968.531) (-971.569) -- 0:01:01
89500 -- (-967.135) (-970.147) (-977.023) [-967.070] * (-967.648) (-966.224) (-969.999) [-969.866] -- 0:01:01
90000 -- (-967.010) [-970.485] (-968.055) (-968.049) * (-965.724) (-967.086) [-969.412] (-969.404) -- 0:01:00
Average standard deviation of split frequencies: 0.024697
90500 -- (-970.211) [-967.847] (-967.139) (-968.759) * [-965.891] (-970.226) (-967.552) (-969.348) -- 0:01:00
91000 -- (-969.676) (-967.655) (-967.868) [-968.022] * (-967.898) (-966.484) [-965.969] (-966.772) -- 0:00:59
91500 -- (-969.024) (-970.096) [-968.155] (-969.974) * (-966.166) [-967.205] (-966.052) (-966.826) -- 0:00:59
92000 -- (-969.606) [-968.562] (-970.435) (-969.691) * (-967.490) (-966.003) (-966.109) [-968.581] -- 0:00:59
92500 -- (-969.468) (-967.760) [-968.052] (-968.172) * (-967.576) (-970.079) (-967.652) [-967.938] -- 0:00:58
93000 -- (-968.569) (-967.736) [-967.587] (-968.812) * (-970.936) (-969.175) (-967.055) [-966.920] -- 0:00:58
93500 -- (-966.750) [-967.263] (-967.222) (-969.814) * (-967.235) (-966.070) [-967.234] (-968.347) -- 0:00:58
94000 -- [-971.145] (-967.608) (-966.662) (-969.979) * [-966.783] (-965.924) (-966.912) (-967.115) -- 0:00:57
94500 -- (-966.310) (-966.320) (-967.807) [-967.238] * (-968.679) (-967.539) [-966.693] (-967.909) -- 0:00:57
95000 -- (-967.570) [-966.331] (-967.925) (-967.373) * [-971.999] (-969.637) (-967.282) (-967.066) -- 0:00:57
Average standard deviation of split frequencies: 0.024307
95500 -- (-969.861) (-968.349) (-966.549) [-966.662] * (-970.286) (-970.452) [-973.285] (-968.378) -- 0:00:56
96000 -- (-968.191) (-972.053) [-967.317] (-966.997) * (-969.539) (-966.748) [-972.137] (-969.237) -- 0:00:56
96500 -- (-970.064) [-967.330] (-966.576) (-966.514) * (-966.736) (-968.209) (-966.315) [-971.244] -- 0:01:05
97000 -- (-968.434) [-966.198] (-968.368) (-966.446) * (-968.100) (-968.517) (-969.570) [-968.618] -- 0:01:05
97500 -- (-968.142) (-966.782) [-967.284] (-967.260) * [-967.940] (-967.364) (-970.355) (-967.374) -- 0:01:04
98000 -- (-969.035) [-967.819] (-967.340) (-965.879) * (-970.393) (-971.949) [-969.489] (-966.390) -- 0:01:04
98500 -- (-966.864) [-967.181] (-966.746) (-967.932) * [-966.673] (-974.864) (-966.452) (-965.818) -- 0:01:04
99000 -- (-966.858) [-966.904] (-967.207) (-967.518) * (-969.890) (-974.824) [-966.722] (-967.286) -- 0:01:03
99500 -- [-965.685] (-966.630) (-968.292) (-967.122) * (-967.386) (-969.491) [-967.795] (-966.669) -- 0:01:03
100000 -- (-973.876) (-965.776) (-966.882) [-967.704] * (-969.219) [-967.695] (-968.434) (-966.740) -- 0:01:02
Average standard deviation of split frequencies: 0.027316
100500 -- (-970.990) [-965.929] (-971.518) (-967.454) * [-967.271] (-967.210) (-969.959) (-967.135) -- 0:01:02
101000 -- (-966.850) [-965.930] (-976.223) (-968.743) * (-967.614) [-966.663] (-969.939) (-967.365) -- 0:01:02
101500 -- [-968.464] (-967.170) (-973.233) (-966.870) * [-966.723] (-970.403) (-967.684) (-965.761) -- 0:01:01
102000 -- (-966.792) (-966.789) (-973.239) [-968.651] * [-967.818] (-969.213) (-968.426) (-966.952) -- 0:01:01
102500 -- (-971.270) (-966.611) (-969.943) [-966.699] * (-967.220) (-968.548) (-968.626) [-966.756] -- 0:01:01
103000 -- [-966.933] (-970.351) (-969.635) (-967.690) * [-967.638] (-966.623) (-967.282) (-966.276) -- 0:01:00
103500 -- [-968.226] (-966.057) (-968.650) (-967.829) * (-969.384) (-967.929) (-966.309) [-967.669] -- 0:01:00
104000 -- [-965.901] (-967.316) (-966.679) (-969.090) * [-967.255] (-969.699) (-975.370) (-967.245) -- 0:01:00
104500 -- (-965.805) [-966.406] (-965.994) (-968.341) * (-967.555) (-969.520) (-969.854) [-966.285] -- 0:00:59
105000 -- (-967.696) (-969.139) [-967.373] (-970.855) * [-968.088] (-967.724) (-969.016) (-967.203) -- 0:00:59
Average standard deviation of split frequencies: 0.024989
105500 -- (-969.200) (-967.959) [-965.616] (-968.607) * [-968.331] (-971.496) (-969.653) (-969.348) -- 0:00:59
106000 -- [-968.174] (-967.276) (-968.042) (-968.120) * (-971.089) [-967.263] (-968.166) (-967.082) -- 0:00:59
106500 -- (-970.297) [-968.234] (-967.937) (-968.256) * (-970.461) (-968.514) (-969.115) [-968.069] -- 0:00:58
107000 -- (-974.327) [-967.392] (-970.439) (-968.969) * [-969.839] (-968.700) (-968.579) (-967.573) -- 0:00:58
107500 -- (-967.775) [-969.749] (-971.283) (-968.364) * (-969.363) (-968.715) [-967.087] (-967.456) -- 0:00:58
108000 -- (-967.220) [-973.867] (-972.188) (-969.207) * (-968.964) (-971.462) (-967.014) [-966.500] -- 0:00:57
108500 -- (-970.964) (-968.942) [-970.898] (-970.363) * (-970.139) (-969.719) [-966.838] (-965.780) -- 0:00:57
109000 -- (-970.269) (-968.713) (-970.687) [-969.124] * (-970.898) (-969.526) (-968.051) [-966.534] -- 0:00:57
109500 -- (-967.517) (-967.974) (-968.817) [-967.577] * (-967.914) [-967.161] (-968.051) (-966.786) -- 0:00:56
110000 -- (-967.827) [-966.553] (-969.999) (-966.702) * (-966.534) [-969.272] (-968.051) (-966.786) -- 0:00:56
Average standard deviation of split frequencies: 0.026231
110500 -- [-966.900] (-966.288) (-972.004) (-966.125) * (-966.534) (-967.322) [-967.371] (-968.623) -- 0:00:56
111000 -- (-968.285) [-967.693] (-969.147) (-969.102) * (-967.269) [-967.572] (-967.947) (-967.213) -- 0:00:56
111500 -- (-970.082) [-967.163] (-968.559) (-967.674) * (-969.525) (-965.883) [-967.403] (-967.812) -- 0:00:55
112000 -- (-971.780) [-967.534] (-967.039) (-966.214) * (-971.700) (-966.203) [-966.227] (-967.759) -- 0:00:55
112500 -- (-968.586) [-967.140] (-970.162) (-966.551) * (-965.788) (-966.152) (-966.196) [-966.926] -- 0:00:55
113000 -- (-971.021) (-966.473) [-969.391] (-968.016) * [-968.061] (-970.418) (-966.711) (-968.254) -- 0:01:02
113500 -- (-967.169) (-966.620) [-968.028] (-966.058) * (-973.969) [-966.534] (-966.615) (-967.173) -- 0:01:02
114000 -- (-967.909) (-967.738) [-965.862] (-968.617) * (-973.916) [-966.355] (-972.543) (-966.268) -- 0:01:02
114500 -- [-969.963] (-966.180) (-966.002) (-967.384) * (-971.127) (-965.528) (-966.731) [-966.966] -- 0:01:01
115000 -- (-968.182) (-966.208) [-966.722] (-969.164) * (-967.255) (-969.881) (-967.890) [-966.181] -- 0:01:01
Average standard deviation of split frequencies: 0.023977
115500 -- (-966.587) (-968.439) (-970.591) [-966.164] * (-966.755) (-967.352) [-970.956] (-970.009) -- 0:01:01
116000 -- (-966.415) (-967.839) (-967.225) [-966.299] * [-966.706] (-970.912) (-973.014) (-966.080) -- 0:01:00
116500 -- (-969.185) (-968.008) (-969.755) [-965.951] * (-967.731) [-966.105] (-968.573) (-966.483) -- 0:01:00
117000 -- (-971.355) (-967.097) [-972.182] (-978.064) * [-966.321] (-967.810) (-967.000) (-966.198) -- 0:01:00
117500 -- [-966.185] (-968.003) (-969.694) (-968.038) * (-968.961) (-967.375) [-967.545] (-966.169) -- 0:01:00
118000 -- (-966.078) (-967.321) (-970.972) [-966.268] * (-968.158) (-967.031) (-967.646) [-967.459] -- 0:00:59
118500 -- (-967.362) (-966.336) (-970.400) [-966.115] * (-968.135) (-969.643) [-966.380] (-967.112) -- 0:00:59
119000 -- (-966.277) [-966.033] (-974.742) (-966.136) * [-969.927] (-968.453) (-967.189) (-970.308) -- 0:00:59
119500 -- (-967.964) [-967.251] (-969.295) (-972.362) * (-971.937) (-968.487) (-967.468) [-965.995] -- 0:00:58
120000 -- (-966.431) [-965.896] (-967.677) (-966.795) * (-969.440) (-970.105) (-970.446) [-965.848] -- 0:00:58
Average standard deviation of split frequencies: 0.024468
120500 -- (-969.168) [-966.077] (-968.838) (-967.084) * (-968.690) (-969.941) (-970.066) [-968.116] -- 0:00:58
121000 -- (-967.633) (-967.374) (-968.100) [-966.266] * [-969.459] (-967.962) (-972.304) (-967.993) -- 0:00:58
121500 -- [-968.847] (-967.191) (-970.287) (-969.048) * (-971.653) [-967.648] (-975.199) (-969.257) -- 0:00:57
122000 -- (-969.152) (-967.390) [-967.035] (-971.419) * (-970.520) [-965.929] (-968.866) (-968.637) -- 0:00:57
122500 -- (-968.381) (-967.597) (-965.918) [-967.660] * (-969.654) (-966.090) (-968.648) [-966.701] -- 0:00:57
123000 -- (-967.785) (-966.405) (-968.420) [-969.122] * (-967.437) (-966.194) (-967.766) [-968.421] -- 0:00:57
123500 -- [-967.432] (-968.293) (-966.438) (-971.413) * (-967.016) (-966.183) [-967.645] (-966.602) -- 0:00:56
124000 -- (-967.871) (-967.646) (-966.351) [-967.813] * (-968.633) [-966.382] (-967.704) (-967.862) -- 0:00:56
124500 -- [-966.401] (-968.431) (-967.460) (-968.833) * (-968.619) [-966.002] (-967.751) (-967.028) -- 0:00:56
125000 -- [-968.202] (-968.258) (-968.271) (-966.998) * (-969.850) (-967.280) [-971.747] (-968.273) -- 0:00:56
Average standard deviation of split frequencies: 0.022842
125500 -- (-966.414) [-968.149] (-968.320) (-967.465) * (-974.883) (-968.039) [-969.884] (-968.352) -- 0:00:55
126000 -- [-966.057] (-969.300) (-966.514) (-970.712) * (-967.638) (-966.868) (-970.360) [-965.909] -- 0:00:55
126500 -- (-967.694) (-968.025) (-966.642) [-968.304] * (-966.453) [-968.960] (-966.584) (-966.894) -- 0:00:55
127000 -- (-969.092) (-968.404) [-966.096] (-969.732) * (-968.028) (-966.673) (-966.100) [-969.571] -- 0:00:54
127500 -- (-965.880) (-966.858) (-968.887) [-966.989] * (-966.236) [-968.345] (-966.183) (-968.220) -- 0:00:54
128000 -- (-969.470) (-970.551) [-970.075] (-965.715) * [-968.163] (-966.189) (-967.032) (-972.456) -- 0:00:54
128500 -- (-968.801) (-967.387) (-968.351) [-968.267] * (-968.673) [-967.454] (-967.734) (-969.737) -- 0:00:54
129000 -- (-968.890) (-969.568) (-966.929) [-966.406] * (-968.712) (-968.818) (-968.949) [-972.038] -- 0:00:54
129500 -- (-969.097) (-968.465) [-966.225] (-965.528) * (-968.255) [-967.608] (-966.382) (-969.854) -- 0:01:00
130000 -- (-971.033) (-968.859) [-965.781] (-968.016) * (-967.836) (-968.655) (-968.181) [-967.908] -- 0:01:00
Average standard deviation of split frequencies: 0.023250
130500 -- (-969.408) (-967.927) (-966.714) [-967.480] * (-966.893) (-969.963) (-968.482) [-968.254] -- 0:00:59
131000 -- [-965.820] (-969.085) (-967.602) (-966.569) * [-966.160] (-968.244) (-967.845) (-971.738) -- 0:00:59
131500 -- (-966.114) (-967.930) [-966.945] (-966.881) * [-969.591] (-966.177) (-968.337) (-969.082) -- 0:00:59
132000 -- (-967.282) [-967.252] (-965.901) (-968.026) * (-968.376) (-965.765) [-968.129] (-968.939) -- 0:00:59
132500 -- (-966.948) [-966.896] (-966.522) (-967.024) * (-966.888) [-965.745] (-968.115) (-967.368) -- 0:00:58
133000 -- (-966.025) (-969.235) [-966.417] (-971.408) * (-966.564) (-966.029) (-968.640) [-969.155] -- 0:00:58
133500 -- (-967.535) [-966.316] (-966.121) (-971.881) * (-967.618) (-967.917) [-967.432] (-967.980) -- 0:00:58
134000 -- (-970.568) [-966.114] (-966.891) (-969.133) * [-967.798] (-966.703) (-967.155) (-972.168) -- 0:00:58
134500 -- (-971.063) (-965.623) [-966.692] (-970.093) * (-967.191) [-969.160] (-969.051) (-968.327) -- 0:00:57
135000 -- (-972.842) (-966.731) (-966.355) [-967.717] * (-966.748) (-966.582) [-968.814] (-972.598) -- 0:00:57
Average standard deviation of split frequencies: 0.023108
135500 -- (-969.502) [-966.558] (-968.469) (-967.430) * (-966.296) (-966.895) [-968.061] (-968.280) -- 0:00:57
136000 -- (-970.672) [-969.844] (-967.537) (-966.953) * [-966.295] (-966.658) (-973.870) (-969.105) -- 0:00:57
136500 -- (-970.507) (-967.406) [-967.272] (-969.760) * (-967.062) [-966.226] (-969.935) (-968.550) -- 0:00:56
137000 -- (-966.286) (-966.635) [-967.504] (-966.975) * [-970.376] (-966.856) (-966.791) (-968.794) -- 0:00:56
137500 -- (-966.569) [-966.561] (-967.892) (-969.839) * (-968.129) (-969.993) [-966.333] (-968.946) -- 0:00:56
138000 -- [-969.104] (-966.411) (-968.729) (-970.017) * (-969.896) (-969.305) (-969.282) [-969.807] -- 0:00:56
138500 -- [-968.051] (-966.154) (-966.324) (-971.872) * [-970.085] (-972.785) (-966.091) (-974.950) -- 0:00:55
139000 -- [-967.868] (-966.054) (-968.586) (-971.117) * (-969.256) (-975.058) (-966.096) [-970.789] -- 0:00:55
139500 -- (-967.356) (-967.109) [-972.705] (-970.335) * (-968.680) (-969.721) (-968.106) [-966.951] -- 0:00:55
140000 -- (-969.023) (-967.680) [-970.980] (-967.831) * (-973.493) [-968.029] (-968.444) (-968.257) -- 0:00:55
Average standard deviation of split frequencies: 0.021783
140500 -- (-965.657) [-966.268] (-968.909) (-970.049) * (-968.066) (-967.224) [-968.747] (-968.447) -- 0:00:55
141000 -- (-969.384) (-967.766) [-967.822] (-972.648) * [-968.349] (-968.069) (-969.230) (-970.286) -- 0:00:54
141500 -- [-968.973] (-970.280) (-971.857) (-970.723) * (-967.807) [-967.287] (-969.075) (-968.379) -- 0:00:54
142000 -- (-970.451) [-967.400] (-969.033) (-968.164) * (-967.220) (-967.264) [-966.569] (-968.651) -- 0:00:54
142500 -- (-966.213) [-967.159] (-968.385) (-971.212) * (-965.961) (-966.541) [-966.783] (-971.487) -- 0:00:54
143000 -- [-966.449] (-967.014) (-969.262) (-967.026) * (-972.401) [-966.456] (-966.844) (-968.490) -- 0:00:53
143500 -- (-966.581) [-968.243] (-969.316) (-969.871) * (-968.494) [-968.667] (-966.779) (-968.430) -- 0:00:53
144000 -- (-966.889) [-967.322] (-967.259) (-968.321) * (-967.916) (-970.219) [-967.599] (-970.004) -- 0:00:53
144500 -- (-969.530) [-968.084] (-967.136) (-967.921) * (-970.269) [-966.262] (-966.250) (-971.597) -- 0:00:53
145000 -- (-966.546) (-967.545) [-970.238] (-967.329) * [-971.081] (-967.733) (-967.344) (-967.328) -- 0:00:53
Average standard deviation of split frequencies: 0.020503
145500 -- (-969.736) (-966.875) (-967.890) [-966.118] * [-969.612] (-971.195) (-966.742) (-966.814) -- 0:00:58
146000 -- (-966.828) (-968.670) [-970.110] (-966.281) * (-969.032) (-968.582) (-970.921) [-966.593] -- 0:00:58
146500 -- (-970.457) (-965.879) [-967.162] (-968.095) * (-970.096) [-967.548] (-967.793) (-966.749) -- 0:00:58
147000 -- (-968.176) (-967.989) [-969.072] (-967.387) * [-971.014] (-968.463) (-968.638) (-966.139) -- 0:00:58
147500 -- (-968.301) (-966.384) [-967.878] (-967.827) * [-969.809] (-970.058) (-974.517) (-965.881) -- 0:00:57
148000 -- (-968.397) (-969.599) (-969.908) [-968.099] * (-969.492) (-972.305) [-974.742] (-967.513) -- 0:00:57
148500 -- (-966.150) (-967.925) (-967.152) [-967.729] * (-969.609) [-970.110] (-969.569) (-966.986) -- 0:00:57
149000 -- [-967.066] (-967.229) (-968.125) (-967.054) * [-968.806] (-967.307) (-967.037) (-968.977) -- 0:00:57
149500 -- (-970.334) (-967.142) [-968.820] (-967.832) * (-968.533) [-966.642] (-968.773) (-969.676) -- 0:00:56
150000 -- (-966.328) (-966.317) (-968.140) [-965.824] * (-968.207) (-966.722) (-968.167) [-968.306] -- 0:00:56
Average standard deviation of split frequencies: 0.020806
150500 -- (-965.537) (-969.389) (-968.632) [-965.691] * (-968.755) [-967.461] (-971.777) (-969.942) -- 0:00:56
151000 -- (-965.517) (-967.972) [-968.617] (-969.703) * (-971.194) [-967.491] (-968.578) (-971.979) -- 0:00:56
151500 -- (-966.148) (-971.489) (-967.276) [-969.807] * (-969.811) (-966.154) [-966.842] (-968.880) -- 0:00:56
152000 -- (-965.871) (-966.645) [-969.295] (-969.423) * (-970.261) (-966.682) [-966.266] (-967.533) -- 0:00:55
152500 -- (-966.617) (-967.076) (-966.581) [-968.666] * (-970.037) (-967.355) [-966.285] (-968.353) -- 0:00:55
153000 -- [-967.566] (-967.468) (-969.918) (-970.134) * (-967.326) (-967.909) [-967.091] (-969.422) -- 0:00:55
153500 -- [-967.257] (-968.157) (-965.831) (-968.849) * [-966.945] (-973.312) (-967.275) (-968.425) -- 0:00:55
154000 -- [-967.790] (-970.467) (-969.890) (-966.963) * [-967.290] (-971.258) (-967.214) (-967.194) -- 0:00:54
154500 -- (-966.104) (-968.172) (-968.269) [-966.871] * (-968.509) (-965.980) [-969.138] (-967.728) -- 0:00:54
155000 -- (-966.377) (-968.534) [-967.194] (-968.015) * (-966.064) [-966.259] (-968.205) (-968.117) -- 0:00:54
Average standard deviation of split frequencies: 0.019037
155500 -- (-968.486) (-970.634) [-966.492] (-967.548) * (-968.209) (-966.524) (-966.432) [-968.308] -- 0:00:54
156000 -- (-967.708) (-969.382) (-967.317) [-967.254] * (-967.016) [-965.667] (-966.675) (-976.270) -- 0:00:54
156500 -- (-968.357) (-967.312) [-966.545] (-969.256) * (-971.755) (-966.974) (-970.868) [-973.169] -- 0:00:53
157000 -- (-967.894) (-969.071) (-966.187) [-966.603] * (-971.311) (-966.657) (-967.311) [-968.278] -- 0:00:53
157500 -- (-966.851) [-966.963] (-966.162) (-966.059) * [-966.408] (-968.874) (-970.079) (-967.759) -- 0:00:53
158000 -- (-966.644) [-967.222] (-965.777) (-967.886) * [-971.775] (-966.145) (-966.855) (-971.405) -- 0:00:53
158500 -- (-966.884) (-970.220) (-970.417) [-967.981] * [-967.494] (-971.404) (-970.424) (-972.282) -- 0:00:53
159000 -- (-967.120) (-967.919) (-965.841) [-966.107] * (-967.015) (-969.830) [-967.402] (-970.626) -- 0:00:52
159500 -- (-966.678) (-970.448) [-966.605] (-968.030) * [-968.105] (-972.543) (-970.045) (-973.751) -- 0:00:52
160000 -- [-967.638] (-968.317) (-966.863) (-973.168) * (-968.726) (-968.549) (-971.197) [-968.847] -- 0:00:52
Average standard deviation of split frequencies: 0.020049
160500 -- [-966.619] (-966.061) (-968.568) (-971.830) * (-967.389) [-968.375] (-968.214) (-968.704) -- 0:00:52
161000 -- (-966.837) (-969.569) (-967.297) [-967.466] * [-967.821] (-967.862) (-966.958) (-966.054) -- 0:00:52
161500 -- (-966.503) (-966.701) (-968.628) [-966.151] * (-966.821) (-968.733) (-969.010) [-967.478] -- 0:00:57
162000 -- (-966.838) (-966.683) [-967.926] (-969.270) * (-967.660) (-966.491) [-967.792] (-967.162) -- 0:00:56
162500 -- (-966.707) (-968.063) [-967.635] (-970.362) * (-968.407) (-966.270) [-968.528] (-967.782) -- 0:00:56
163000 -- (-966.430) [-972.398] (-969.728) (-968.177) * (-969.801) (-970.260) (-966.447) [-968.777] -- 0:00:56
163500 -- (-965.973) (-968.131) (-966.310) [-967.981] * (-970.102) (-968.448) (-966.434) [-968.699] -- 0:00:56
164000 -- (-966.299) [-970.816] (-967.857) (-966.428) * (-970.190) (-967.019) [-967.430] (-968.126) -- 0:00:56
164500 -- (-967.199) [-968.119] (-968.942) (-967.260) * (-966.925) [-967.188] (-967.035) (-968.756) -- 0:00:55
165000 -- (-969.489) (-968.816) [-970.288] (-967.330) * (-969.381) (-971.738) [-966.961] (-968.299) -- 0:00:55
Average standard deviation of split frequencies: 0.017786
165500 -- (-969.658) (-972.735) (-968.769) [-968.424] * (-970.317) (-966.785) (-966.796) [-966.354] -- 0:00:55
166000 -- [-967.387] (-966.882) (-968.751) (-966.649) * (-969.441) (-966.954) [-966.397] (-966.107) -- 0:00:55
166500 -- (-966.086) (-971.192) [-967.190] (-968.598) * [-967.752] (-968.589) (-967.628) (-968.470) -- 0:00:55
167000 -- (-970.286) (-971.658) [-968.499] (-968.935) * (-967.764) (-968.218) (-967.346) [-971.833] -- 0:00:54
167500 -- (-967.594) (-970.263) [-965.665] (-966.024) * [-971.271] (-968.268) (-971.251) (-967.802) -- 0:00:54
168000 -- (-972.104) [-967.591] (-967.268) (-966.989) * [-968.040] (-971.413) (-972.608) (-966.357) -- 0:00:54
168500 -- [-968.677] (-967.305) (-966.546) (-966.934) * (-966.880) (-968.390) [-969.076] (-966.264) -- 0:00:54
169000 -- (-966.743) [-966.842] (-965.799) (-967.999) * (-966.678) (-968.898) [-968.873] (-966.805) -- 0:00:54
169500 -- [-965.889] (-967.392) (-966.716) (-966.657) * [-966.580] (-968.877) (-971.351) (-967.949) -- 0:00:53
170000 -- [-967.905] (-966.531) (-966.716) (-968.237) * (-968.377) (-968.877) [-968.983] (-967.378) -- 0:00:53
Average standard deviation of split frequencies: 0.017033
170500 -- (-966.731) [-969.255] (-967.801) (-966.899) * (-966.708) [-967.439] (-974.056) (-966.024) -- 0:00:53
171000 -- (-967.093) (-968.902) (-967.167) [-967.178] * [-969.798] (-968.951) (-971.235) (-968.671) -- 0:00:53
171500 -- (-969.505) [-967.596] (-967.525) (-969.306) * (-971.550) [-968.807] (-971.951) (-967.706) -- 0:00:53
172000 -- (-966.360) (-969.906) [-966.490] (-972.120) * [-973.781] (-966.482) (-967.136) (-972.624) -- 0:00:52
172500 -- [-965.941] (-966.176) (-966.782) (-970.279) * (-968.147) (-966.519) (-967.921) [-966.886] -- 0:00:52
173000 -- (-965.975) (-967.426) (-968.049) [-968.554] * (-966.126) [-966.995] (-967.264) (-971.541) -- 0:00:52
173500 -- (-966.282) (-969.651) [-966.676] (-968.785) * (-967.140) (-968.427) [-966.468] (-968.282) -- 0:00:52
174000 -- (-966.173) (-972.390) (-970.296) [-969.405] * (-965.705) (-966.177) [-967.835] (-968.726) -- 0:00:52
174500 -- (-966.226) (-969.009) (-967.470) [-969.054] * (-969.385) [-966.077] (-967.641) (-968.130) -- 0:00:52
175000 -- (-966.913) (-972.618) [-969.804] (-967.795) * (-967.217) [-966.347] (-966.649) (-970.754) -- 0:00:51
Average standard deviation of split frequencies: 0.018185
175500 -- [-966.833] (-974.273) (-968.020) (-967.670) * [-969.777] (-967.251) (-967.403) (-968.493) -- 0:00:51
176000 -- (-966.763) (-973.039) [-969.613] (-968.739) * (-965.891) (-967.222) [-968.915] (-973.612) -- 0:00:51
176500 -- (-973.274) (-970.586) (-968.427) [-968.237] * (-967.481) [-967.222] (-974.043) (-970.441) -- 0:00:51
177000 -- (-967.123) (-969.783) (-967.819) [-966.906] * [-966.893] (-968.590) (-968.532) (-970.547) -- 0:00:51
177500 -- (-967.690) (-967.555) (-966.894) [-967.481] * [-968.479] (-968.658) (-968.842) (-968.134) -- 0:00:50
178000 -- (-966.871) (-972.094) (-971.875) [-970.258] * (-969.451) [-968.501] (-967.423) (-967.868) -- 0:00:50
178500 -- (-968.517) [-968.264] (-968.040) (-965.958) * (-966.731) [-969.487] (-966.011) (-967.063) -- 0:00:55
179000 -- (-966.030) (-968.545) (-966.422) [-966.895] * (-966.804) [-969.465] (-968.466) (-967.370) -- 0:00:55
179500 -- (-967.394) (-969.178) [-966.383] (-967.616) * (-966.885) [-967.604] (-968.092) (-967.834) -- 0:00:54
180000 -- (-970.798) (-965.827) (-966.397) [-966.082] * (-968.792) (-968.631) (-966.751) [-968.117] -- 0:00:54
Average standard deviation of split frequencies: 0.018555
180500 -- [-968.664] (-968.915) (-968.264) (-966.637) * (-968.379) [-966.370] (-965.996) (-968.378) -- 0:00:54
181000 -- (-965.772) (-969.899) (-966.570) [-967.344] * (-970.332) (-966.655) [-967.483] (-970.134) -- 0:00:54
181500 -- (-965.809) [-972.712] (-968.885) (-973.686) * [-970.807] (-966.983) (-968.227) (-966.399) -- 0:00:54
182000 -- [-967.678] (-969.202) (-967.796) (-966.053) * (-967.928) [-967.665] (-967.294) (-969.612) -- 0:00:53
182500 -- [-966.691] (-971.481) (-968.968) (-967.447) * [-967.578] (-971.336) (-970.321) (-969.683) -- 0:00:53
183000 -- (-967.209) (-970.252) [-966.171] (-970.639) * [-966.631] (-967.869) (-967.028) (-973.227) -- 0:00:53
183500 -- (-967.625) (-967.609) [-966.683] (-967.451) * (-971.964) [-968.011] (-970.541) (-968.357) -- 0:00:53
184000 -- (-971.118) (-967.898) [-969.041] (-968.989) * (-968.111) (-967.665) (-967.235) [-971.118] -- 0:00:53
184500 -- [-969.227] (-966.785) (-966.607) (-969.387) * (-966.733) (-967.625) (-967.304) [-966.535] -- 0:00:53
185000 -- [-967.603] (-967.813) (-966.607) (-973.522) * (-967.076) (-970.112) [-967.132] (-966.530) -- 0:00:52
Average standard deviation of split frequencies: 0.017319
185500 -- (-966.633) (-966.874) [-967.781] (-968.282) * (-967.794) (-970.054) (-966.852) [-969.157] -- 0:00:52
186000 -- [-968.036] (-967.689) (-970.347) (-971.773) * (-967.222) (-967.277) (-969.226) [-966.868] -- 0:00:52
186500 -- [-967.615] (-968.178) (-969.149) (-970.132) * (-971.483) (-966.959) [-967.468] (-967.220) -- 0:00:52
187000 -- (-967.457) (-966.528) [-965.551] (-972.983) * (-967.727) [-968.710] (-967.242) (-968.839) -- 0:00:52
187500 -- (-968.292) (-969.312) [-966.787] (-966.182) * (-969.064) [-967.785] (-968.553) (-967.288) -- 0:00:52
188000 -- (-966.466) (-965.836) (-966.487) [-967.876] * (-970.155) [-972.872] (-968.291) (-968.392) -- 0:00:51
188500 -- (-967.638) (-966.555) (-967.839) [-967.901] * (-968.577) (-970.119) (-968.133) [-969.647] -- 0:00:51
189000 -- (-968.548) [-967.854] (-967.757) (-970.973) * (-971.736) (-966.460) (-971.487) [-965.830] -- 0:00:51
189500 -- (-970.976) [-966.493] (-969.406) (-967.328) * [-970.732] (-967.574) (-967.054) (-965.863) -- 0:00:51
190000 -- (-969.249) (-970.010) (-970.337) [-967.488] * (-971.777) (-965.814) [-966.634] (-966.454) -- 0:00:51
Average standard deviation of split frequencies: 0.016757
190500 -- (-971.054) (-965.973) (-968.063) [-966.248] * [-967.042] (-967.271) (-967.216) (-967.212) -- 0:00:50
191000 -- [-972.250] (-967.101) (-966.608) (-965.554) * (-967.295) (-965.912) [-969.009] (-967.199) -- 0:00:50
191500 -- [-969.716] (-967.762) (-970.721) (-969.886) * (-967.610) [-965.785] (-971.359) (-970.954) -- 0:00:50
192000 -- [-965.837] (-966.339) (-969.323) (-967.046) * (-967.412) (-968.255) [-970.285] (-968.533) -- 0:00:50
192500 -- [-965.760] (-965.736) (-968.971) (-966.969) * (-969.398) (-968.429) [-967.092] (-967.056) -- 0:00:50
193000 -- (-966.301) (-966.456) (-970.720) [-969.447] * (-969.244) [-968.313] (-967.755) (-966.347) -- 0:00:50
193500 -- [-966.790] (-975.223) (-969.326) (-966.203) * [-966.348] (-969.539) (-967.270) (-967.488) -- 0:00:50
194000 -- [-966.739] (-967.329) (-969.592) (-965.940) * [-966.458] (-967.748) (-966.976) (-968.528) -- 0:00:49
194500 -- (-972.256) (-969.345) (-967.758) [-965.819] * (-968.087) [-966.663] (-969.631) (-967.344) -- 0:00:53
195000 -- (-968.869) (-969.127) [-971.039] (-966.506) * (-974.676) (-967.471) (-965.967) [-967.567] -- 0:00:53
Average standard deviation of split frequencies: 0.015500
195500 -- (-967.781) (-966.928) (-968.247) [-967.214] * (-965.811) [-967.252] (-967.953) (-967.687) -- 0:00:53
196000 -- (-969.978) (-967.832) [-971.192] (-966.544) * (-968.221) (-966.537) [-966.086] (-966.321) -- 0:00:53
196500 -- (-969.679) (-969.737) (-970.214) [-967.935] * [-969.534] (-970.019) (-966.047) (-971.789) -- 0:00:53
197000 -- [-968.344] (-969.061) (-968.963) (-967.123) * [-967.201] (-970.715) (-968.255) (-967.313) -- 0:00:52
197500 -- [-968.278] (-968.285) (-968.603) (-967.229) * (-971.502) (-967.862) (-967.166) [-969.376] -- 0:00:52
198000 -- (-970.412) (-967.919) [-969.065] (-966.408) * [-972.853] (-967.712) (-967.378) (-967.315) -- 0:00:52
198500 -- (-968.450) (-968.260) (-966.485) [-968.486] * (-966.650) (-970.150) (-971.011) [-968.189] -- 0:00:52
199000 -- [-968.985] (-968.680) (-967.438) (-966.997) * (-969.461) [-966.943] (-970.941) (-967.276) -- 0:00:52
199500 -- [-968.092] (-968.676) (-967.057) (-966.873) * (-974.188) [-967.003] (-966.146) (-968.807) -- 0:00:52
200000 -- (-967.645) [-967.638] (-971.412) (-967.616) * [-967.609] (-966.494) (-969.855) (-967.290) -- 0:00:51
Average standard deviation of split frequencies: 0.014095
200500 -- (-966.539) [-967.810] (-967.817) (-970.864) * (-968.806) [-967.992] (-968.678) (-967.737) -- 0:00:51
201000 -- [-966.981] (-967.300) (-968.582) (-966.031) * (-966.482) (-968.792) (-966.840) [-967.865] -- 0:00:51
201500 -- (-966.407) [-969.929] (-967.482) (-970.091) * (-967.585) (-972.137) [-966.207] (-968.689) -- 0:00:51
202000 -- [-965.787] (-971.970) (-968.320) (-968.086) * (-969.927) (-973.832) (-967.849) [-969.045] -- 0:00:51
202500 -- (-968.303) (-972.069) [-970.019] (-976.876) * (-968.424) (-973.496) [-968.492] (-970.109) -- 0:00:51
203000 -- [-970.578] (-971.110) (-966.676) (-969.409) * (-971.263) [-972.894] (-966.403) (-972.187) -- 0:00:51
203500 -- [-968.753] (-969.742) (-968.188) (-971.470) * [-973.541] (-969.197) (-969.465) (-969.932) -- 0:00:50
204000 -- [-966.980] (-970.027) (-966.789) (-970.338) * (-974.458) [-967.115] (-967.866) (-967.934) -- 0:00:50
204500 -- [-967.032] (-971.898) (-970.838) (-966.428) * (-970.851) (-969.278) (-969.686) [-966.503] -- 0:00:50
205000 -- (-970.519) [-968.013] (-966.461) (-965.975) * [-966.408] (-966.505) (-970.285) (-968.112) -- 0:00:50
Average standard deviation of split frequencies: 0.013730
205500 -- (-969.820) [-967.471] (-969.484) (-968.497) * (-967.866) (-969.115) (-970.892) [-968.976] -- 0:00:50
206000 -- (-968.959) (-967.548) [-969.974] (-966.291) * (-970.619) (-969.278) [-969.709] (-966.757) -- 0:00:50
206500 -- (-968.757) (-966.095) (-970.451) [-965.934] * [-969.266] (-967.843) (-968.306) (-970.945) -- 0:00:49
207000 -- (-967.336) (-968.347) [-967.526] (-966.738) * (-968.704) (-967.677) (-969.959) [-968.048] -- 0:00:49
207500 -- [-969.523] (-969.776) (-971.458) (-969.962) * [-967.553] (-966.520) (-973.843) (-971.018) -- 0:00:49
208000 -- [-967.568] (-968.279) (-970.323) (-968.615) * [-968.214] (-966.947) (-974.233) (-967.794) -- 0:00:49
208500 -- (-971.156) (-965.942) [-968.189] (-970.442) * [-966.325] (-966.475) (-971.966) (-967.401) -- 0:00:49
209000 -- (-968.029) [-965.942] (-978.378) (-966.476) * (-968.076) (-972.472) [-970.549] (-968.714) -- 0:00:49
209500 -- (-966.458) (-969.280) [-968.183] (-967.822) * (-966.107) (-968.441) (-973.788) [-968.340] -- 0:00:49
210000 -- (-967.876) (-966.327) [-967.177] (-968.499) * [-970.683] (-967.648) (-968.016) (-969.102) -- 0:00:48
Average standard deviation of split frequencies: 0.013426
210500 -- (-969.435) (-966.279) (-968.061) [-967.410] * (-968.381) (-967.808) [-968.396] (-969.075) -- 0:00:48
211000 -- (-967.823) (-966.969) (-967.678) [-967.275] * [-967.449] (-973.164) (-968.323) (-970.074) -- 0:00:52
211500 -- (-969.209) (-966.542) (-967.665) [-966.500] * (-966.299) (-968.440) [-966.711] (-969.759) -- 0:00:52
212000 -- (-967.568) [-966.538] (-967.128) (-966.730) * (-965.937) (-967.434) [-970.739] (-968.426) -- 0:00:52
212500 -- (-967.372) (-966.176) (-966.748) [-966.848] * [-965.796] (-969.313) (-969.031) (-966.508) -- 0:00:51
213000 -- [-968.549] (-972.067) (-967.061) (-969.761) * (-968.321) (-968.359) (-966.193) [-969.203] -- 0:00:51
213500 -- [-967.690] (-970.719) (-968.628) (-966.177) * [-967.965] (-967.288) (-968.226) (-965.937) -- 0:00:51
214000 -- (-965.517) (-967.800) [-967.691] (-965.900) * [-967.113] (-968.345) (-971.895) (-965.733) -- 0:00:51
214500 -- (-965.556) (-968.182) [-967.206] (-966.385) * (-968.014) (-971.549) (-969.599) [-967.496] -- 0:00:51
215000 -- (-966.021) [-967.145] (-970.631) (-966.911) * (-974.716) [-967.892] (-966.630) (-970.963) -- 0:00:51
Average standard deviation of split frequencies: 0.013784
215500 -- [-966.841] (-967.191) (-968.233) (-967.355) * [-968.888] (-966.150) (-967.129) (-968.474) -- 0:00:50
216000 -- (-968.874) (-970.321) (-966.738) [-966.477] * (-968.177) (-966.630) (-966.531) [-967.751] -- 0:00:50
216500 -- (-967.371) (-969.408) [-969.493] (-968.427) * (-970.559) (-968.270) [-966.703] (-966.270) -- 0:00:50
217000 -- (-969.206) (-968.355) [-967.843] (-968.438) * (-970.053) (-967.942) [-967.307] (-971.298) -- 0:00:50
217500 -- (-969.803) [-968.233] (-975.168) (-969.494) * (-968.333) (-969.471) [-966.802] (-968.986) -- 0:00:50
218000 -- [-967.998] (-965.697) (-969.195) (-969.027) * (-967.204) (-969.175) (-968.319) [-966.351] -- 0:00:50
218500 -- (-967.609) (-971.846) (-966.636) [-970.478] * (-968.664) (-967.985) [-968.374] (-967.258) -- 0:00:50
219000 -- [-966.816] (-967.932) (-966.664) (-967.258) * (-965.964) (-971.572) [-967.968] (-967.689) -- 0:00:49
219500 -- (-967.457) [-966.759] (-968.482) (-969.166) * (-966.152) [-967.833] (-969.985) (-967.170) -- 0:00:49
220000 -- (-970.621) [-966.894] (-971.987) (-967.715) * (-965.937) (-967.453) (-969.354) [-967.108] -- 0:00:49
Average standard deviation of split frequencies: 0.013767
220500 -- (-967.603) (-965.932) (-968.862) [-965.918] * [-965.929] (-966.238) (-970.442) (-969.469) -- 0:00:49
221000 -- (-967.551) (-969.605) [-967.293] (-968.207) * (-965.852) (-966.607) (-968.621) [-966.230] -- 0:00:49
221500 -- [-967.412] (-966.177) (-967.414) (-969.255) * [-966.476] (-965.582) (-966.260) (-966.133) -- 0:00:49
222000 -- (-968.981) [-966.678] (-968.096) (-967.755) * (-966.599) (-967.276) [-968.760] (-969.571) -- 0:00:49
222500 -- (-968.115) [-968.629] (-973.683) (-968.247) * (-969.949) [-966.216] (-966.205) (-966.125) -- 0:00:48
223000 -- (-966.516) [-966.559] (-974.751) (-966.800) * (-968.959) (-968.981) [-966.645] (-966.800) -- 0:00:48
223500 -- (-967.302) (-965.972) [-968.056] (-967.747) * (-969.901) [-971.512] (-966.541) (-966.708) -- 0:00:48
224000 -- (-967.395) [-967.500] (-966.362) (-968.143) * [-969.386] (-967.591) (-972.085) (-968.594) -- 0:00:48
224500 -- (-969.754) (-968.335) (-968.978) [-967.732] * (-969.326) (-967.424) (-967.710) [-967.648] -- 0:00:48
225000 -- [-969.847] (-968.359) (-969.391) (-966.493) * (-974.265) (-968.384) [-966.896] (-966.863) -- 0:00:48
Average standard deviation of split frequencies: 0.013871
225500 -- (-969.764) (-968.888) [-971.161] (-966.259) * [-968.351] (-967.826) (-966.896) (-966.751) -- 0:00:48
226000 -- (-966.783) [-968.025] (-970.996) (-966.366) * (-967.747) (-967.859) [-966.118] (-970.606) -- 0:00:47
226500 -- (-969.718) (-970.021) [-967.835] (-968.576) * [-967.056] (-971.029) (-966.863) (-966.981) -- 0:00:47
227000 -- (-970.026) [-966.380] (-967.229) (-966.689) * (-966.978) [-969.848] (-966.053) (-967.829) -- 0:00:47
227500 -- (-968.721) [-966.452] (-969.157) (-967.226) * [-966.340] (-965.865) (-969.723) (-966.936) -- 0:00:50
228000 -- [-966.860] (-966.353) (-968.692) (-967.204) * (-967.137) [-966.663] (-970.308) (-969.014) -- 0:00:50
228500 -- [-968.703] (-967.716) (-966.718) (-968.203) * (-968.118) [-967.647] (-968.156) (-967.200) -- 0:00:50
229000 -- (-967.625) [-967.102] (-967.021) (-966.634) * [-969.323] (-967.884) (-970.356) (-967.629) -- 0:00:50
229500 -- [-966.841] (-965.681) (-966.977) (-967.555) * (-965.638) [-966.335] (-969.675) (-968.737) -- 0:00:50
230000 -- [-967.861] (-965.689) (-967.297) (-971.537) * [-966.728] (-966.845) (-966.007) (-967.812) -- 0:00:50
Average standard deviation of split frequencies: 0.015381
230500 -- (-968.851) (-968.307) (-969.603) [-968.743] * [-965.775] (-966.807) (-966.684) (-966.375) -- 0:00:50
231000 -- (-968.852) [-969.626] (-969.520) (-969.444) * (-966.260) (-966.755) (-967.412) [-966.873] -- 0:00:49
231500 -- (-968.711) (-968.017) [-968.979] (-970.978) * (-967.014) (-967.906) (-966.623) [-966.810] -- 0:00:49
232000 -- [-967.597] (-967.143) (-970.141) (-967.908) * (-966.499) (-967.205) [-967.152] (-967.856) -- 0:00:49
232500 -- [-966.463] (-967.794) (-967.741) (-966.835) * [-975.351] (-965.718) (-967.951) (-968.389) -- 0:00:49
233000 -- [-968.990] (-968.514) (-968.542) (-969.130) * (-969.512) [-966.055] (-967.049) (-969.394) -- 0:00:49
233500 -- (-968.876) [-966.974] (-968.630) (-967.665) * [-968.966] (-967.634) (-967.282) (-970.191) -- 0:00:49
234000 -- [-969.497] (-967.575) (-967.211) (-967.425) * (-968.623) [-965.680] (-967.500) (-966.639) -- 0:00:49
234500 -- [-967.175] (-967.239) (-967.553) (-968.473) * (-966.626) (-967.875) (-967.773) [-967.258] -- 0:00:48
235000 -- (-970.002) (-965.854) [-967.547] (-966.721) * (-968.548) [-971.419] (-966.445) (-969.083) -- 0:00:48
Average standard deviation of split frequencies: 0.016190
235500 -- [-968.631] (-967.509) (-971.675) (-967.021) * (-970.009) (-975.698) [-970.200] (-967.200) -- 0:00:48
236000 -- (-965.976) (-968.816) (-968.979) [-966.398] * (-968.025) (-967.667) [-967.850] (-968.776) -- 0:00:48
236500 -- (-966.223) (-966.230) (-976.665) [-968.526] * (-969.947) [-971.321] (-972.258) (-967.930) -- 0:00:48
237000 -- (-967.775) [-967.515] (-968.803) (-966.443) * (-966.534) [-969.512] (-968.323) (-969.569) -- 0:00:48
237500 -- [-967.364] (-971.280) (-968.994) (-967.287) * (-968.015) (-969.973) [-966.239] (-967.399) -- 0:00:48
238000 -- (-966.978) [-967.655] (-968.050) (-975.713) * (-968.162) (-969.898) (-966.915) [-966.424] -- 0:00:48
238500 -- (-967.889) [-966.435] (-971.524) (-968.966) * (-968.378) [-968.538] (-967.581) (-966.227) -- 0:00:47
239000 -- (-967.824) [-967.099] (-971.236) (-967.773) * [-968.107] (-967.108) (-969.226) (-968.931) -- 0:00:47
239500 -- (-967.464) (-968.247) [-969.371] (-967.069) * (-968.232) (-969.634) (-968.675) [-966.696] -- 0:00:47
240000 -- (-969.198) (-968.241) (-967.089) [-967.115] * (-967.332) (-973.397) [-968.883] (-967.168) -- 0:00:47
Average standard deviation of split frequencies: 0.015343
240500 -- (-968.448) [-971.107] (-967.810) (-967.304) * (-968.526) [-966.992] (-966.593) (-967.347) -- 0:00:47
241000 -- (-970.700) (-967.339) (-967.277) [-966.925] * [-966.282] (-967.976) (-966.015) (-965.916) -- 0:00:47
241500 -- (-968.524) [-967.375] (-968.000) (-968.017) * (-966.282) [-969.095] (-967.661) (-972.655) -- 0:00:47
242000 -- [-968.724] (-970.074) (-968.987) (-972.337) * [-967.121] (-970.294) (-970.748) (-970.795) -- 0:00:46
242500 -- (-967.640) [-969.250] (-966.554) (-970.183) * (-966.793) [-969.006] (-967.857) (-971.477) -- 0:00:46
243000 -- (-974.559) (-969.476) (-969.520) [-967.487] * [-966.805] (-972.380) (-969.282) (-969.108) -- 0:00:46
243500 -- [-971.988] (-966.322) (-969.899) (-967.204) * (-967.282) (-968.011) (-969.669) [-966.182] -- 0:00:46
244000 -- (-969.686) (-969.452) (-967.730) [-970.605] * (-969.439) (-968.289) (-967.207) [-966.147] -- 0:00:49
244500 -- (-975.703) (-967.137) (-967.391) [-966.976] * [-969.160] (-968.612) (-967.538) (-965.727) -- 0:00:49
245000 -- (-968.922) [-967.514] (-967.005) (-966.543) * (-967.938) (-968.054) (-969.904) [-967.656] -- 0:00:49
Average standard deviation of split frequencies: 0.015734
245500 -- [-967.074] (-968.058) (-968.447) (-968.297) * [-966.495] (-971.420) (-970.725) (-966.178) -- 0:00:49
246000 -- (-967.461) (-970.590) (-972.463) [-967.489] * (-968.374) [-968.443] (-966.739) (-967.467) -- 0:00:49
246500 -- (-967.969) (-971.711) (-968.808) [-967.679] * (-967.935) (-968.280) [-967.475] (-966.265) -- 0:00:48
247000 -- [-966.695] (-966.294) (-968.287) (-967.756) * (-967.027) (-967.172) [-967.056] (-968.313) -- 0:00:48
247500 -- (-966.760) (-974.010) (-967.335) [-966.494] * (-967.248) [-967.398] (-966.930) (-967.503) -- 0:00:48
248000 -- (-969.126) [-971.613] (-967.536) (-968.187) * [-966.410] (-967.739) (-968.318) (-965.826) -- 0:00:48
248500 -- (-972.275) [-966.166] (-969.283) (-967.789) * (-972.080) (-965.783) (-970.827) [-966.976] -- 0:00:48
249000 -- (-968.226) [-966.864] (-968.588) (-967.789) * (-968.236) (-967.427) (-966.340) [-967.703] -- 0:00:48
249500 -- (-970.293) [-966.370] (-970.559) (-968.746) * [-967.046] (-969.531) (-965.868) (-970.891) -- 0:00:48
250000 -- [-967.928] (-968.648) (-968.297) (-966.736) * (-965.966) (-969.714) (-968.030) [-970.004] -- 0:00:48
Average standard deviation of split frequencies: 0.015342
250500 -- (-967.818) (-968.288) (-968.667) [-966.396] * (-968.466) [-969.687] (-971.197) (-966.326) -- 0:00:47
251000 -- (-967.838) (-971.444) [-968.307] (-967.008) * (-967.892) (-970.690) [-974.429] (-966.390) -- 0:00:47
251500 -- [-967.874] (-968.810) (-967.983) (-965.984) * [-967.474] (-966.808) (-972.881) (-968.535) -- 0:00:47
252000 -- (-967.312) [-968.903] (-969.045) (-965.974) * (-969.394) (-967.905) (-968.013) [-970.181] -- 0:00:47
252500 -- (-967.440) [-966.687] (-968.648) (-966.244) * [-968.443] (-968.774) (-968.510) (-966.710) -- 0:00:47
253000 -- (-970.407) (-968.255) [-968.557] (-967.857) * [-966.416] (-969.289) (-970.851) (-970.267) -- 0:00:47
253500 -- [-974.605] (-968.257) (-968.318) (-969.360) * (-966.733) (-970.596) (-968.234) [-968.129] -- 0:00:47
254000 -- (-969.558) [-967.857] (-969.972) (-969.164) * (-966.577) (-966.035) (-967.050) [-971.794] -- 0:00:46
254500 -- (-969.263) (-965.971) [-969.668] (-966.528) * (-969.221) (-968.183) [-967.473] (-970.559) -- 0:00:46
255000 -- (-969.423) [-968.114] (-967.255) (-966.035) * (-970.039) [-968.001] (-967.535) (-966.946) -- 0:00:46
Average standard deviation of split frequencies: 0.014731
255500 -- (-966.907) (-967.412) (-967.752) [-968.112] * (-972.321) [-966.728] (-969.042) (-966.468) -- 0:00:46
256000 -- (-968.561) [-967.337] (-967.470) (-968.503) * (-968.323) (-968.919) [-966.990] (-968.749) -- 0:00:46
256500 -- (-968.771) (-967.510) (-966.347) [-968.460] * (-966.052) (-970.107) (-971.819) [-968.612] -- 0:00:46
257000 -- (-969.626) [-967.838] (-970.605) (-972.090) * [-966.906] (-971.647) (-967.421) (-969.815) -- 0:00:46
257500 -- (-969.960) (-969.786) [-967.467] (-968.370) * (-966.682) (-973.128) (-968.686) [-969.163] -- 0:00:46
258000 -- (-967.669) (-967.494) (-967.924) [-969.200] * (-968.572) [-967.084] (-968.556) (-968.354) -- 0:00:46
258500 -- (-967.510) (-970.331) [-967.184] (-968.742) * [-968.692] (-965.750) (-968.753) (-969.676) -- 0:00:45
259000 -- (-969.535) [-971.061] (-968.681) (-967.618) * (-969.280) (-965.457) [-967.856] (-970.672) -- 0:00:45
259500 -- (-971.308) (-966.528) [-969.368] (-968.930) * (-968.054) (-968.080) [-967.062] (-970.492) -- 0:00:45
260000 -- (-966.792) (-966.153) (-974.051) [-968.192] * (-970.152) (-965.918) [-971.773] (-971.209) -- 0:00:45
Average standard deviation of split frequencies: 0.014574
260500 -- (-967.810) [-969.572] (-974.599) (-968.565) * (-967.320) (-967.239) [-970.700] (-966.011) -- 0:00:48
261000 -- (-969.210) (-968.713) [-966.653] (-974.465) * (-970.372) (-969.009) (-969.336) [-966.321] -- 0:00:48
261500 -- (-966.454) (-967.194) (-971.216) [-968.235] * (-971.585) [-967.081] (-971.376) (-969.951) -- 0:00:48
262000 -- [-966.271] (-966.762) (-967.116) (-980.415) * (-968.012) (-966.972) (-969.884) [-970.706] -- 0:00:47
262500 -- (-966.579) (-968.326) (-966.603) [-968.322] * [-966.233] (-966.974) (-966.789) (-967.471) -- 0:00:47
263000 -- (-966.579) [-967.474] (-969.584) (-967.837) * (-968.385) (-968.030) [-966.571] (-967.746) -- 0:00:47
263500 -- (-967.484) [-969.728] (-968.967) (-966.610) * [-967.349] (-967.351) (-971.729) (-967.776) -- 0:00:47
264000 -- (-966.783) (-968.930) [-969.067] (-967.702) * (-968.408) [-967.187] (-969.850) (-966.883) -- 0:00:47
264500 -- [-969.411] (-975.695) (-972.002) (-966.353) * [-966.786] (-968.160) (-967.265) (-966.114) -- 0:00:47
265000 -- (-966.510) (-967.701) (-967.379) [-966.074] * (-970.223) [-967.923] (-969.283) (-968.362) -- 0:00:47
Average standard deviation of split frequencies: 0.015556
265500 -- (-966.646) (-966.196) (-969.179) [-970.441] * (-966.938) (-969.340) [-966.519] (-967.380) -- 0:00:47
266000 -- (-970.054) [-969.743] (-970.886) (-969.267) * (-966.135) (-966.788) (-966.532) [-966.810] -- 0:00:46
266500 -- (-967.590) (-967.802) [-972.428] (-971.929) * (-969.602) (-966.410) [-966.432] (-967.223) -- 0:00:46
267000 -- (-966.300) (-967.593) (-970.349) [-967.650] * (-968.147) [-966.829] (-966.600) (-968.998) -- 0:00:46
267500 -- (-973.913) (-966.455) [-969.528] (-965.848) * (-971.516) [-969.850] (-967.408) (-971.240) -- 0:00:46
268000 -- (-967.913) (-966.457) [-969.474] (-966.684) * (-970.396) (-969.968) [-966.876] (-967.927) -- 0:00:46
268500 -- (-967.106) (-966.501) (-968.554) [-967.759] * (-968.559) (-967.073) [-966.784] (-966.846) -- 0:00:46
269000 -- (-967.200) [-966.733] (-968.289) (-967.326) * (-969.416) [-966.491] (-967.451) (-966.961) -- 0:00:46
269500 -- (-967.636) (-969.259) (-966.384) [-967.583] * (-968.972) (-966.412) [-966.844] (-970.521) -- 0:00:46
270000 -- (-966.521) (-973.166) [-968.536] (-968.500) * (-969.702) [-970.507] (-967.453) (-970.088) -- 0:00:45
Average standard deviation of split frequencies: 0.015675
270500 -- (-966.357) (-967.491) (-966.876) [-967.876] * (-967.716) (-967.737) [-968.389] (-966.860) -- 0:00:45
271000 -- (-969.383) [-967.286] (-968.482) (-966.932) * [-967.603] (-969.101) (-967.325) (-967.964) -- 0:00:45
271500 -- (-967.251) (-966.894) (-971.929) [-966.718] * (-968.479) [-971.770] (-969.322) (-971.675) -- 0:00:45
272000 -- [-967.835] (-966.702) (-968.282) (-968.383) * (-970.650) (-968.355) [-968.534] (-967.897) -- 0:00:45
272500 -- (-968.143) (-967.362) [-970.041] (-971.014) * (-968.290) (-967.591) [-968.106] (-970.166) -- 0:00:45
273000 -- (-967.214) (-967.370) [-966.935] (-968.392) * (-971.839) (-967.875) (-967.054) [-968.248] -- 0:00:45
273500 -- [-967.370] (-967.275) (-967.468) (-968.094) * (-969.173) (-968.466) [-968.966] (-969.096) -- 0:00:45
274000 -- [-968.678] (-967.293) (-966.103) (-966.109) * (-969.389) [-968.210] (-969.806) (-970.269) -- 0:00:45
274500 -- (-971.367) (-971.768) (-966.260) [-967.519] * (-969.621) [-966.713] (-966.912) (-968.792) -- 0:00:44
275000 -- [-970.199] (-969.362) (-966.718) (-967.343) * (-968.128) (-967.928) [-967.829] (-967.728) -- 0:00:44
Average standard deviation of split frequencies: 0.016276
275500 -- [-970.045] (-968.020) (-967.469) (-967.015) * (-972.142) (-965.570) (-968.376) [-967.778] -- 0:00:44
276000 -- (-976.315) (-967.867) (-967.235) [-968.220] * [-966.330] (-966.967) (-973.843) (-966.963) -- 0:00:44
276500 -- (-972.087) (-966.950) (-969.062) [-970.420] * [-965.995] (-967.808) (-969.017) (-967.254) -- 0:00:44
277000 -- (-967.968) [-971.370] (-967.023) (-971.054) * [-969.333] (-966.159) (-967.911) (-967.410) -- 0:00:46
277500 -- [-967.365] (-966.959) (-967.225) (-968.561) * (-967.250) (-968.951) (-967.964) [-966.195] -- 0:00:46
278000 -- (-970.245) (-969.613) [-968.371] (-968.235) * (-967.783) [-966.449] (-966.828) (-967.042) -- 0:00:46
278500 -- [-968.397] (-967.271) (-972.069) (-967.370) * (-967.339) (-966.233) [-967.033] (-970.900) -- 0:00:46
279000 -- [-968.214] (-967.719) (-968.410) (-966.793) * [-967.182] (-968.665) (-966.388) (-971.790) -- 0:00:46
279500 -- [-968.070] (-969.282) (-969.302) (-969.611) * [-966.552] (-966.407) (-967.176) (-969.832) -- 0:00:46
280000 -- (-966.581) (-968.530) [-966.715] (-966.957) * [-966.480] (-970.366) (-966.807) (-975.767) -- 0:00:46
Average standard deviation of split frequencies: 0.015011
280500 -- [-966.052] (-966.772) (-968.306) (-967.223) * (-967.837) (-967.268) (-967.626) [-969.536] -- 0:00:46
281000 -- (-966.821) (-970.830) (-967.005) [-967.660] * [-970.567] (-965.759) (-969.146) (-970.155) -- 0:00:46
281500 -- (-966.564) (-974.193) [-967.008] (-968.320) * (-966.974) [-966.781] (-968.584) (-969.216) -- 0:00:45
282000 -- [-966.160] (-969.655) (-966.745) (-967.188) * (-966.514) (-968.342) (-967.840) [-966.784] -- 0:00:45
282500 -- (-967.159) (-970.229) [-967.318] (-970.262) * (-966.514) (-967.306) (-967.094) [-966.805] -- 0:00:45
283000 -- (-967.391) (-970.908) (-967.326) [-969.056] * (-968.933) (-967.771) [-967.110] (-966.566) -- 0:00:45
283500 -- (-969.490) (-966.072) [-967.911] (-971.497) * (-967.152) (-967.717) [-966.757] (-966.152) -- 0:00:45
284000 -- [-967.149] (-967.602) (-967.105) (-966.613) * (-967.933) (-967.679) (-969.362) [-966.144] -- 0:00:45
284500 -- (-966.617) (-968.099) [-966.768] (-967.349) * (-970.957) (-976.866) [-968.799] (-966.795) -- 0:00:45
285000 -- (-969.355) (-968.807) [-966.733] (-969.503) * (-970.069) (-971.318) (-971.103) [-966.788] -- 0:00:45
Average standard deviation of split frequencies: 0.015143
285500 -- (-970.871) (-969.642) (-966.632) [-967.959] * (-970.239) [-968.049] (-969.824) (-966.387) -- 0:00:45
286000 -- (-968.453) [-966.186] (-966.454) (-968.866) * (-967.692) (-967.626) (-968.264) [-970.058] -- 0:00:44
286500 -- (-970.388) [-967.983] (-970.342) (-970.135) * (-966.392) (-968.009) [-967.536] (-969.353) -- 0:00:44
287000 -- (-968.699) (-969.392) (-966.624) [-968.419] * (-967.986) [-970.144] (-966.807) (-968.738) -- 0:00:44
287500 -- (-967.233) [-967.062] (-966.635) (-968.201) * (-965.872) (-971.537) [-968.429] (-970.784) -- 0:00:44
288000 -- (-967.052) (-968.450) [-967.389] (-967.124) * (-966.722) (-971.572) (-969.892) [-967.249] -- 0:00:44
288500 -- (-968.775) [-967.845] (-967.247) (-967.714) * [-966.931] (-971.157) (-972.688) (-967.019) -- 0:00:44
289000 -- [-967.132] (-966.487) (-968.501) (-968.030) * [-967.104] (-971.389) (-967.151) (-970.945) -- 0:00:44
289500 -- [-966.881] (-966.474) (-966.876) (-968.229) * (-966.582) [-966.944] (-966.643) (-970.312) -- 0:00:44
290000 -- (-970.094) (-966.296) [-969.462] (-967.656) * (-967.099) (-969.227) (-966.515) [-968.846] -- 0:00:44
Average standard deviation of split frequencies: 0.014596
290500 -- (-968.293) [-968.870] (-966.824) (-968.277) * [-966.422] (-968.804) (-969.443) (-969.806) -- 0:00:43
291000 -- (-970.225) [-969.061] (-967.443) (-967.450) * (-968.751) (-966.306) [-967.916] (-969.244) -- 0:00:43
291500 -- (-967.024) (-971.043) [-969.190] (-967.578) * [-966.810] (-966.106) (-968.805) (-970.483) -- 0:00:43
292000 -- (-966.047) [-968.127] (-973.141) (-966.429) * (-966.338) (-966.446) [-968.217] (-968.066) -- 0:00:43
292500 -- [-966.920] (-973.345) (-966.374) (-966.742) * [-971.990] (-969.280) (-967.268) (-968.841) -- 0:00:43
293000 -- (-966.766) (-969.080) [-967.106] (-970.971) * (-980.031) [-970.439] (-967.014) (-967.509) -- 0:00:43
293500 -- (-970.452) (-968.076) (-966.090) [-968.228] * [-972.671] (-966.600) (-967.331) (-969.657) -- 0:00:45
294000 -- (-971.391) (-967.067) [-966.715] (-967.018) * (-969.371) (-970.500) (-965.597) [-970.681] -- 0:00:45
294500 -- (-971.069) (-966.277) (-966.711) [-966.904] * (-971.505) [-968.825] (-965.813) (-967.982) -- 0:00:45
295000 -- [-966.971] (-967.028) (-966.869) (-967.675) * [-968.076] (-968.750) (-967.214) (-969.208) -- 0:00:45
Average standard deviation of split frequencies: 0.014895
295500 -- (-966.909) (-968.873) [-967.503] (-970.191) * (-966.583) (-968.684) (-969.262) [-966.863] -- 0:00:45
296000 -- [-967.769] (-966.243) (-966.480) (-970.465) * [-966.047] (-968.656) (-967.708) (-970.654) -- 0:00:45
296500 -- (-967.572) (-966.118) (-966.808) [-969.233] * (-968.100) [-968.231] (-967.237) (-968.286) -- 0:00:45
297000 -- (-967.284) (-966.068) (-966.606) [-967.465] * (-967.935) (-969.345) (-966.535) [-969.517] -- 0:00:44
297500 -- (-967.136) (-968.662) (-967.696) [-967.160] * (-970.994) [-968.311] (-967.380) (-968.711) -- 0:00:44
298000 -- [-969.120] (-969.615) (-968.768) (-969.268) * (-968.531) (-967.731) (-968.318) [-967.225] -- 0:00:44
298500 -- [-969.616] (-970.685) (-968.161) (-969.392) * (-966.944) [-967.680] (-969.005) (-965.950) -- 0:00:44
299000 -- (-968.316) [-969.339] (-967.660) (-969.195) * (-970.050) (-967.061) (-967.521) [-968.008] -- 0:00:44
299500 -- (-968.194) (-970.136) [-966.871] (-969.664) * (-966.266) [-966.659] (-966.718) (-970.128) -- 0:00:44
300000 -- (-965.863) (-969.878) [-966.334] (-967.059) * (-967.569) [-970.517] (-965.745) (-967.294) -- 0:00:44
Average standard deviation of split frequencies: 0.014797
300500 -- (-967.065) (-966.192) [-966.773] (-969.598) * (-967.937) (-967.301) (-969.362) [-968.111] -- 0:00:44
301000 -- (-973.223) (-968.375) [-965.922] (-969.358) * [-965.984] (-967.380) (-969.919) (-970.402) -- 0:00:44
301500 -- (-970.215) (-968.453) (-965.690) [-968.085] * (-967.912) (-970.110) (-970.011) [-967.249] -- 0:00:44
302000 -- [-970.658] (-966.851) (-967.754) (-970.624) * (-967.827) (-969.617) [-967.515] (-967.836) -- 0:00:43
302500 -- [-966.763] (-967.211) (-967.519) (-967.080) * (-966.694) [-966.970] (-970.239) (-969.447) -- 0:00:43
303000 -- (-972.114) (-967.757) [-967.705] (-967.589) * (-966.413) [-967.097] (-970.399) (-969.167) -- 0:00:43
303500 -- (-968.113) [-968.358] (-968.423) (-967.607) * (-968.120) (-970.339) (-967.769) [-967.613] -- 0:00:43
304000 -- (-966.637) [-968.150] (-968.237) (-967.711) * [-966.771] (-971.516) (-968.539) (-967.795) -- 0:00:43
304500 -- (-969.865) (-967.431) (-966.905) [-967.659] * (-968.358) (-970.859) (-971.398) [-966.698] -- 0:00:43
305000 -- (-967.668) [-967.753] (-968.726) (-967.866) * [-967.807] (-967.525) (-969.179) (-967.977) -- 0:00:43
Average standard deviation of split frequencies: 0.012868
305500 -- (-967.979) (-970.811) [-966.088] (-968.110) * (-966.976) (-967.226) (-970.280) [-970.993] -- 0:00:43
306000 -- [-967.132] (-971.561) (-970.738) (-971.134) * [-969.699] (-968.032) (-970.559) (-970.678) -- 0:00:43
306500 -- [-968.873] (-967.387) (-970.001) (-967.719) * (-968.821) (-967.695) [-967.547] (-968.898) -- 0:00:42
307000 -- [-966.792] (-966.640) (-966.979) (-967.805) * (-965.786) (-967.244) (-967.440) [-967.200] -- 0:00:42
307500 -- [-966.111] (-967.442) (-965.930) (-967.490) * [-967.354] (-972.690) (-969.547) (-968.478) -- 0:00:42
308000 -- (-969.218) (-966.312) [-966.019] (-968.416) * (-967.862) (-968.058) (-968.438) [-967.468] -- 0:00:42
308500 -- (-969.452) (-966.372) (-966.977) [-969.093] * (-968.774) (-969.914) [-967.637] (-968.395) -- 0:00:42
309000 -- (-969.402) (-968.048) (-967.655) [-966.913] * [-968.404] (-970.748) (-968.934) (-968.486) -- 0:00:42
309500 -- (-970.411) (-966.560) (-967.967) [-966.925] * (-970.998) (-966.592) [-970.585] (-966.580) -- 0:00:42
310000 -- (-970.590) (-968.376) [-967.698] (-966.987) * (-968.092) (-967.772) [-972.425] (-967.843) -- 0:00:44
Average standard deviation of split frequencies: 0.012050
310500 -- [-969.044] (-969.873) (-969.181) (-966.130) * (-974.955) (-971.033) [-966.330] (-966.947) -- 0:00:44
311000 -- (-969.145) (-970.833) (-969.644) [-968.637] * [-970.709] (-966.920) (-966.898) (-967.448) -- 0:00:44
311500 -- [-968.217] (-967.989) (-968.385) (-971.812) * (-967.898) (-969.509) [-966.398] (-967.610) -- 0:00:44
312000 -- (-966.676) (-967.361) (-968.082) [-967.653] * (-970.785) (-973.239) [-966.871] (-969.666) -- 0:00:44
312500 -- [-967.238] (-970.773) (-967.752) (-965.911) * [-971.173] (-973.447) (-966.417) (-967.511) -- 0:00:44
313000 -- (-969.800) (-968.738) [-968.771] (-972.515) * [-968.818] (-967.452) (-967.553) (-968.378) -- 0:00:43
313500 -- (-971.522) (-967.561) [-968.192] (-969.973) * (-967.375) [-970.439] (-967.781) (-971.264) -- 0:00:43
314000 -- (-969.339) (-967.300) [-969.266] (-971.016) * (-965.903) (-968.227) [-968.224] (-966.818) -- 0:00:43
314500 -- [-968.931] (-966.663) (-968.724) (-969.424) * (-967.800) (-968.881) [-969.215] (-967.843) -- 0:00:43
315000 -- (-967.205) [-967.950] (-968.676) (-968.095) * [-967.109] (-968.192) (-969.155) (-968.243) -- 0:00:43
Average standard deviation of split frequencies: 0.012987
315500 -- (-967.797) (-970.428) [-970.026] (-969.574) * [-971.200] (-967.377) (-973.383) (-970.546) -- 0:00:43
316000 -- (-966.866) (-967.017) [-966.637] (-969.826) * [-968.679] (-966.795) (-974.494) (-967.243) -- 0:00:43
316500 -- (-967.449) (-965.769) [-966.980] (-969.810) * [-967.232] (-967.823) (-970.582) (-968.007) -- 0:00:43
317000 -- (-967.573) (-966.994) (-967.062) [-966.615] * [-967.295] (-967.216) (-965.915) (-966.596) -- 0:00:43
317500 -- (-969.776) (-967.203) (-971.098) [-968.726] * (-966.975) (-966.934) [-965.883] (-966.139) -- 0:00:42
318000 -- (-966.406) (-967.381) [-966.997] (-968.561) * (-969.005) [-965.847] (-965.819) (-968.539) -- 0:00:42
318500 -- (-966.155) (-966.515) (-971.224) [-968.259] * (-966.389) (-966.493) [-968.195] (-965.809) -- 0:00:42
319000 -- (-966.695) (-966.572) (-968.684) [-966.727] * (-966.505) (-966.054) (-968.195) [-966.374] -- 0:00:42
319500 -- (-970.935) (-969.896) [-966.153] (-966.860) * [-970.743] (-970.870) (-968.605) (-967.988) -- 0:00:42
320000 -- [-966.458] (-966.814) (-966.927) (-966.630) * (-968.311) (-970.775) (-966.836) [-967.858] -- 0:00:42
Average standard deviation of split frequencies: 0.011944
320500 -- (-969.672) [-969.525] (-969.262) (-972.875) * [-969.541] (-971.515) (-966.555) (-967.551) -- 0:00:42
321000 -- (-966.921) (-967.567) [-967.123] (-975.855) * (-966.425) (-970.358) [-967.468] (-966.357) -- 0:00:42
321500 -- [-965.934] (-966.922) (-970.496) (-970.300) * [-966.457] (-969.114) (-968.470) (-969.319) -- 0:00:42
322000 -- (-968.415) [-966.585] (-965.940) (-967.648) * (-966.304) (-968.854) [-968.479] (-968.848) -- 0:00:42
322500 -- (-968.533) [-965.975] (-966.008) (-967.253) * (-971.246) (-968.339) [-967.466] (-966.895) -- 0:00:42
323000 -- (-967.052) (-966.657) (-967.315) [-966.361] * (-965.778) (-971.619) [-965.965] (-966.894) -- 0:00:41
323500 -- [-966.979] (-968.398) (-969.573) (-966.331) * (-966.955) (-971.003) [-968.073] (-966.146) -- 0:00:41
324000 -- [-966.781] (-967.658) (-967.285) (-970.224) * (-967.698) (-967.711) (-972.348) [-970.651] -- 0:00:41
324500 -- (-970.197) [-966.167] (-966.917) (-971.369) * (-971.868) [-966.193] (-974.862) (-969.430) -- 0:00:41
325000 -- (-972.379) (-966.426) [-967.747] (-968.110) * [-965.986] (-969.597) (-968.030) (-969.928) -- 0:00:41
Average standard deviation of split frequencies: 0.012291
325500 -- (-968.708) [-966.830] (-969.200) (-966.581) * (-965.590) (-967.285) (-968.540) [-970.492] -- 0:00:41
326000 -- (-967.978) (-970.728) [-967.621] (-967.984) * (-966.270) (-966.747) [-967.741] (-972.277) -- 0:00:41
326500 -- (-966.378) [-969.022] (-965.992) (-970.088) * (-970.721) (-967.656) (-966.708) [-967.846] -- 0:00:43
327000 -- (-967.304) (-969.300) [-967.280] (-967.376) * (-967.677) (-966.505) [-966.028] (-969.397) -- 0:00:43
327500 -- (-967.218) (-967.152) (-967.260) [-967.678] * (-967.259) (-966.667) [-967.622] (-967.131) -- 0:00:43
328000 -- (-966.259) (-968.345) (-966.951) [-968.860] * [-967.752] (-966.004) (-969.331) (-967.134) -- 0:00:43
328500 -- (-966.260) [-967.145] (-966.353) (-969.196) * (-967.750) (-975.139) [-969.237] (-966.824) -- 0:00:42
329000 -- (-967.951) (-966.298) [-967.066] (-969.061) * (-967.253) (-967.921) [-967.528] (-968.574) -- 0:00:42
329500 -- (-967.343) (-966.100) [-966.434] (-968.349) * (-966.264) (-966.036) (-968.127) [-968.553] -- 0:00:42
330000 -- [-966.850] (-971.998) (-969.238) (-971.819) * (-966.650) (-966.191) [-970.003] (-967.831) -- 0:00:42
Average standard deviation of split frequencies: 0.010818
330500 -- [-967.206] (-970.187) (-965.770) (-968.362) * (-966.164) (-972.513) (-970.615) [-967.059] -- 0:00:42
331000 -- [-967.401] (-966.643) (-968.646) (-968.533) * (-967.926) (-966.996) (-966.925) [-968.680] -- 0:00:42
331500 -- (-967.920) [-966.911] (-969.705) (-970.099) * (-969.170) [-967.953] (-965.816) (-968.522) -- 0:00:42
332000 -- (-967.980) [-968.088] (-970.678) (-968.736) * (-967.662) (-968.563) [-967.367] (-969.048) -- 0:00:42
332500 -- (-966.932) (-974.169) (-968.305) [-966.551] * (-966.957) [-967.224] (-966.563) (-966.730) -- 0:00:42
333000 -- (-967.468) [-967.268] (-970.703) (-970.863) * (-966.505) (-975.727) (-967.662) [-968.961] -- 0:00:42
333500 -- (-966.695) (-967.805) [-966.645] (-967.637) * (-969.463) (-971.780) [-967.076] (-970.334) -- 0:00:41
334000 -- [-970.109] (-966.232) (-968.854) (-966.235) * (-967.893) [-969.492] (-970.020) (-969.390) -- 0:00:41
334500 -- (-968.546) (-967.981) (-968.130) [-967.015] * (-970.596) (-968.200) (-969.808) [-967.659] -- 0:00:41
335000 -- (-969.742) (-973.267) [-967.693] (-967.575) * (-971.224) (-971.013) [-968.758] (-967.659) -- 0:00:41
Average standard deviation of split frequencies: 0.010151
335500 -- [-965.758] (-970.276) (-967.302) (-969.239) * (-968.765) (-967.076) (-969.485) [-967.490] -- 0:00:41
336000 -- (-969.483) (-970.221) (-968.441) [-967.649] * (-967.861) (-968.210) [-968.468] (-970.524) -- 0:00:41
336500 -- (-971.939) (-967.164) (-967.896) [-968.843] * (-968.735) [-968.492] (-967.720) (-969.586) -- 0:00:41
337000 -- (-969.669) (-967.159) [-968.910] (-967.681) * (-967.651) (-972.775) [-970.469] (-966.443) -- 0:00:41
337500 -- (-969.678) [-969.663] (-967.227) (-967.307) * [-967.716] (-967.231) (-969.959) (-967.873) -- 0:00:41
338000 -- (-969.076) (-968.990) [-966.699] (-968.031) * (-967.615) (-967.610) [-971.800] (-967.764) -- 0:00:41
338500 -- (-968.365) [-969.753] (-969.861) (-966.854) * [-966.475] (-967.753) (-969.231) (-967.969) -- 0:00:41
339000 -- (-968.225) (-970.325) (-968.409) [-965.841] * (-966.165) (-966.971) (-970.303) [-966.996] -- 0:00:40
339500 -- [-967.012] (-967.827) (-967.465) (-965.850) * (-967.478) [-967.190] (-968.424) (-967.504) -- 0:00:40
340000 -- [-967.008] (-967.997) (-970.566) (-966.161) * [-968.572] (-966.600) (-966.259) (-967.440) -- 0:00:40
Average standard deviation of split frequencies: 0.008710
340500 -- [-966.952] (-967.937) (-970.184) (-966.745) * (-970.595) [-966.547] (-967.427) (-967.766) -- 0:00:40
341000 -- [-967.331] (-968.003) (-968.053) (-966.349) * (-969.025) [-966.739] (-966.313) (-967.397) -- 0:00:40
341500 -- (-967.610) (-968.398) (-966.783) [-966.404] * (-967.276) (-966.820) (-966.767) [-965.786] -- 0:00:40
342000 -- (-966.435) [-965.879] (-967.426) (-966.918) * (-966.963) (-967.967) (-968.923) [-965.575] -- 0:00:40
342500 -- (-973.208) [-965.942] (-967.952) (-968.205) * (-966.783) (-968.667) (-970.321) [-967.060] -- 0:00:40
343000 -- (-968.711) (-966.714) [-965.857] (-968.291) * (-967.035) (-967.516) (-969.515) [-966.850] -- 0:00:42
343500 -- [-968.159] (-967.916) (-965.978) (-967.957) * (-972.124) [-967.410] (-967.862) (-970.159) -- 0:00:42
344000 -- [-966.765] (-968.599) (-975.932) (-970.055) * (-970.722) (-968.151) [-966.149] (-970.493) -- 0:00:41
344500 -- (-970.108) [-967.797] (-968.723) (-967.836) * (-968.615) (-968.752) [-966.645] (-969.139) -- 0:00:41
345000 -- (-967.339) (-968.594) [-967.235] (-975.560) * (-968.375) (-970.405) [-969.289] (-966.190) -- 0:00:41
Average standard deviation of split frequencies: 0.009697
345500 -- [-966.865] (-967.211) (-969.759) (-969.304) * [-968.390] (-966.797) (-967.202) (-968.231) -- 0:00:41
346000 -- (-969.242) (-967.679) (-970.515) [-967.562] * (-966.971) (-968.032) (-966.938) [-966.917] -- 0:00:41
346500 -- (-968.624) (-966.543) [-966.539] (-966.947) * [-969.032] (-968.714) (-966.348) (-969.553) -- 0:00:41
347000 -- [-969.270] (-967.470) (-967.546) (-969.903) * (-967.245) (-969.090) [-966.640] (-969.365) -- 0:00:41
347500 -- [-971.201] (-968.871) (-967.096) (-972.264) * (-967.467) (-967.606) [-966.609] (-967.432) -- 0:00:41
348000 -- [-966.292] (-969.887) (-971.411) (-969.074) * [-967.031] (-970.472) (-965.922) (-968.553) -- 0:00:41
348500 -- (-968.263) (-968.687) [-966.172] (-966.665) * [-967.912] (-968.592) (-968.377) (-969.684) -- 0:00:41
349000 -- (-967.303) (-969.463) [-967.236] (-966.787) * (-966.566) (-971.278) [-965.625] (-972.685) -- 0:00:41
349500 -- (-967.338) [-968.635] (-966.091) (-965.829) * (-969.825) [-968.817] (-966.641) (-969.166) -- 0:00:40
350000 -- (-967.690) (-967.667) (-965.979) [-966.863] * (-968.741) (-973.458) (-966.847) [-967.693] -- 0:00:40
Average standard deviation of split frequencies: 0.009331
350500 -- [-967.363] (-968.319) (-969.134) (-966.052) * [-966.887] (-968.655) (-967.890) (-966.645) -- 0:00:40
351000 -- (-970.334) (-969.788) [-969.081] (-966.838) * [-968.071] (-967.881) (-968.777) (-967.288) -- 0:00:40
351500 -- (-967.620) (-969.895) [-966.985] (-966.730) * [-967.880] (-967.166) (-968.350) (-966.477) -- 0:00:40
352000 -- (-967.374) [-968.763] (-968.470) (-966.368) * (-967.663) [-967.807] (-967.653) (-968.211) -- 0:00:40
352500 -- (-970.064) (-970.472) (-967.662) [-968.821] * (-967.353) (-969.582) (-967.927) [-969.308] -- 0:00:40
353000 -- (-967.090) (-966.272) (-969.045) [-966.363] * (-966.949) (-970.313) (-971.206) [-967.433] -- 0:00:40
353500 -- [-967.571] (-969.807) (-968.476) (-967.519) * [-967.693] (-967.916) (-967.774) (-967.605) -- 0:00:40
354000 -- (-970.388) [-969.563] (-972.230) (-969.639) * (-968.169) [-970.173] (-967.433) (-967.669) -- 0:00:40
354500 -- [-966.991] (-967.013) (-965.948) (-968.610) * (-967.151) (-971.952) (-970.021) [-966.336] -- 0:00:40
355000 -- (-967.127) [-969.284] (-969.137) (-966.516) * [-967.011] (-971.324) (-969.963) (-968.420) -- 0:00:39
Average standard deviation of split frequencies: 0.008313
355500 -- (-967.131) [-965.994] (-969.227) (-968.363) * (-967.085) [-967.150] (-966.488) (-967.931) -- 0:00:39
356000 -- (-968.603) [-966.496] (-967.907) (-970.053) * [-970.717] (-967.066) (-966.565) (-968.088) -- 0:00:39
356500 -- [-969.914] (-970.847) (-966.906) (-968.127) * (-968.647) (-967.548) (-968.345) [-967.963] -- 0:00:39
357000 -- (-968.866) (-968.356) [-967.204] (-967.402) * [-966.116] (-970.008) (-969.125) (-970.585) -- 0:00:39
357500 -- (-967.541) [-967.955] (-966.992) (-972.375) * (-972.334) (-968.719) [-967.401] (-965.796) -- 0:00:39
358000 -- (-970.028) (-971.015) (-967.968) [-969.949] * (-966.808) (-967.334) [-969.261] (-967.069) -- 0:00:39
358500 -- (-969.649) (-968.208) (-968.527) [-970.338] * (-975.417) (-966.979) [-969.576] (-968.463) -- 0:00:39
359000 -- (-968.827) [-967.900] (-973.619) (-967.492) * (-966.167) (-968.962) (-967.480) [-968.797] -- 0:00:39
359500 -- (-969.418) [-966.385] (-973.922) (-970.953) * (-970.721) (-966.463) (-966.861) [-967.250] -- 0:00:40
360000 -- [-969.674] (-965.986) (-967.922) (-967.289) * [-969.211] (-966.848) (-966.067) (-967.234) -- 0:00:40
Average standard deviation of split frequencies: 0.008227
360500 -- (-967.840) (-967.347) [-966.809] (-966.764) * (-967.920) [-967.438] (-968.769) (-967.840) -- 0:00:40
361000 -- [-971.067] (-968.553) (-966.064) (-968.531) * (-970.433) (-967.618) [-967.924] (-966.677) -- 0:00:40
361500 -- (-967.741) [-968.019] (-968.665) (-968.765) * (-969.238) (-968.295) [-968.586] (-967.929) -- 0:00:40
362000 -- (-967.881) (-967.963) (-968.818) [-968.698] * (-966.245) (-967.468) [-966.018] (-968.035) -- 0:00:40
362500 -- [-969.832] (-968.515) (-968.294) (-967.348) * (-966.447) [-969.827] (-967.012) (-968.441) -- 0:00:40
363000 -- (-969.787) (-968.777) (-968.720) [-966.666] * (-966.368) (-966.848) [-966.646] (-972.953) -- 0:00:40
363500 -- (-967.602) (-967.679) [-968.820] (-968.477) * [-968.290] (-968.910) (-967.091) (-970.081) -- 0:00:40
364000 -- (-967.096) (-967.637) [-970.402] (-966.236) * (-967.685) (-968.240) (-969.134) [-969.155] -- 0:00:40
364500 -- (-968.759) [-969.614] (-968.277) (-969.368) * (-968.069) [-966.297] (-967.522) (-969.414) -- 0:00:40
365000 -- (-968.757) (-970.142) (-966.368) [-966.997] * (-969.368) (-966.846) (-968.602) [-966.031] -- 0:00:40
Average standard deviation of split frequencies: 0.009016
365500 -- (-966.582) [-969.525] (-967.584) (-966.253) * (-970.692) (-967.143) [-967.556] (-967.664) -- 0:00:39
366000 -- [-966.248] (-975.214) (-967.284) (-968.175) * (-967.790) (-966.692) (-969.093) [-969.125] -- 0:00:39
366500 -- (-966.072) (-968.915) (-967.390) [-966.546] * (-966.912) (-966.566) [-970.195] (-966.171) -- 0:00:39
367000 -- (-966.317) (-972.555) (-966.782) [-971.614] * [-968.181] (-969.230) (-972.631) (-971.418) -- 0:00:39
367500 -- (-966.083) (-966.211) (-966.731) [-972.508] * [-965.781] (-965.969) (-969.894) (-971.035) -- 0:00:39
368000 -- (-968.249) (-968.168) [-968.135] (-966.662) * [-965.844] (-968.171) (-967.554) (-969.317) -- 0:00:39
368500 -- [-967.772] (-967.656) (-966.600) (-965.714) * (-965.941) [-967.308] (-967.072) (-968.132) -- 0:00:39
369000 -- (-968.502) (-969.044) [-968.179] (-967.034) * (-966.910) [-967.792] (-966.102) (-970.630) -- 0:00:39
369500 -- (-967.112) (-969.318) [-968.267] (-967.111) * (-967.481) (-967.567) [-965.810] (-970.531) -- 0:00:39
370000 -- (-968.848) (-966.353) [-967.518] (-965.919) * (-968.970) (-968.960) [-966.589] (-967.233) -- 0:00:39
Average standard deviation of split frequencies: 0.008902
370500 -- (-970.692) (-967.866) [-967.714] (-965.943) * (-966.905) (-966.663) [-966.969] (-966.660) -- 0:00:39
371000 -- [-969.121] (-968.373) (-970.254) (-966.013) * [-966.915] (-967.733) (-969.215) (-969.787) -- 0:00:38
371500 -- (-972.960) [-967.159] (-967.707) (-967.378) * (-967.619) (-967.753) (-967.471) [-969.186] -- 0:00:38
372000 -- [-968.334] (-967.515) (-967.412) (-970.734) * (-967.369) (-966.867) [-967.196] (-967.604) -- 0:00:38
372500 -- (-969.207) (-969.392) [-968.839] (-967.498) * (-967.313) (-966.701) (-966.903) [-966.299] -- 0:00:38
373000 -- (-968.988) (-967.411) [-967.412] (-969.320) * (-973.197) (-969.290) [-966.987] (-968.737) -- 0:00:38
373500 -- (-966.895) (-966.248) [-968.973] (-966.842) * (-970.862) [-967.123] (-966.190) (-968.639) -- 0:00:38
374000 -- (-969.393) [-966.070] (-968.235) (-967.458) * (-968.929) (-967.012) (-968.923) [-966.894] -- 0:00:38
374500 -- (-966.448) [-967.438] (-969.854) (-967.575) * (-969.156) (-970.772) [-969.591] (-975.713) -- 0:00:38
375000 -- [-968.654] (-974.290) (-967.473) (-967.571) * (-969.161) (-970.664) [-966.639] (-969.619) -- 0:00:38
Average standard deviation of split frequencies: 0.008850
375500 -- (-969.055) [-969.934] (-965.542) (-969.222) * (-969.534) (-969.526) (-967.951) [-968.417] -- 0:00:38
376000 -- (-971.229) (-968.550) [-966.623] (-971.815) * (-968.626) (-967.819) (-968.160) [-966.268] -- 0:00:39
376500 -- (-966.365) (-967.697) (-967.846) [-968.935] * (-967.985) (-968.494) [-966.068] (-968.871) -- 0:00:39
377000 -- (-966.051) (-972.449) [-966.950] (-967.780) * (-968.192) (-967.446) (-967.426) [-966.369] -- 0:00:39
377500 -- [-966.898] (-967.150) (-967.258) (-965.756) * (-968.745) [-967.286] (-966.324) (-967.179) -- 0:00:39
378000 -- [-966.288] (-967.797) (-968.062) (-968.347) * (-968.369) [-967.192] (-967.371) (-967.786) -- 0:00:39
378500 -- (-966.819) [-967.797] (-966.353) (-968.482) * [-971.521] (-966.880) (-967.286) (-968.089) -- 0:00:39
379000 -- (-968.399) (-967.852) (-967.440) [-967.327] * (-969.848) (-967.006) [-969.819] (-967.823) -- 0:00:39
379500 -- [-968.256] (-967.385) (-966.735) (-966.912) * (-969.545) (-967.350) (-970.983) [-967.366] -- 0:00:39
380000 -- (-973.733) (-966.024) (-967.000) [-968.067] * (-966.254) (-970.525) [-968.333] (-968.441) -- 0:00:39
Average standard deviation of split frequencies: 0.008282
380500 -- (-969.710) (-966.294) [-966.503] (-969.310) * [-967.059] (-969.655) (-970.405) (-969.489) -- 0:00:39
381000 -- (-967.297) (-966.359) (-966.321) [-967.317] * [-966.297] (-967.106) (-967.051) (-969.059) -- 0:00:38
381500 -- [-968.057] (-970.793) (-967.632) (-967.182) * (-967.344) (-966.760) [-966.430] (-967.970) -- 0:00:38
382000 -- (-968.460) (-968.042) [-967.052] (-969.045) * [-967.737] (-966.385) (-967.730) (-969.055) -- 0:00:38
382500 -- (-967.141) [-967.762] (-969.352) (-970.481) * (-967.344) [-967.371] (-971.261) (-968.875) -- 0:00:38
383000 -- [-967.531] (-966.440) (-968.203) (-971.205) * (-968.488) (-968.534) [-966.398] (-968.184) -- 0:00:38
383500 -- (-969.049) (-968.035) (-967.883) [-967.040] * [-965.643] (-965.723) (-968.168) (-970.795) -- 0:00:38
384000 -- [-965.809] (-967.303) (-966.175) (-970.766) * (-968.481) (-966.388) (-969.658) [-967.872] -- 0:00:38
384500 -- (-965.809) (-966.917) (-967.382) [-968.564] * [-968.588] (-967.124) (-969.989) (-970.818) -- 0:00:38
385000 -- (-966.175) (-967.798) [-967.634] (-972.744) * (-969.476) (-967.549) (-968.457) [-966.714] -- 0:00:38
Average standard deviation of split frequencies: 0.008625
385500 -- (-967.639) [-968.747] (-967.612) (-970.723) * (-969.708) [-966.739] (-967.382) (-968.358) -- 0:00:38
386000 -- (-966.799) (-972.042) [-967.597] (-966.085) * (-970.940) [-965.774] (-967.164) (-968.499) -- 0:00:38
386500 -- (-966.145) (-971.752) [-967.504] (-966.387) * (-971.432) (-966.224) [-967.607] (-967.226) -- 0:00:38
387000 -- [-968.857] (-971.353) (-966.420) (-966.946) * (-970.121) (-968.221) [-969.458] (-967.614) -- 0:00:38
387500 -- (-967.592) [-969.540] (-969.381) (-972.772) * (-967.613) (-967.475) (-967.276) [-968.974] -- 0:00:37
388000 -- (-967.127) (-968.341) (-969.423) [-970.239] * (-967.030) (-970.785) (-966.199) [-966.960] -- 0:00:37
388500 -- (-967.690) [-967.159] (-967.420) (-967.399) * (-967.772) (-967.452) (-966.410) [-967.344] -- 0:00:37
389000 -- (-968.882) (-967.833) (-966.352) [-967.201] * (-970.380) (-969.552) [-967.035] (-968.259) -- 0:00:37
389500 -- (-967.596) (-969.252) (-969.806) [-967.053] * (-968.676) (-970.218) (-966.611) [-967.816] -- 0:00:37
390000 -- (-967.179) (-966.987) [-967.402] (-968.115) * (-970.270) [-967.528] (-967.483) (-968.550) -- 0:00:37
Average standard deviation of split frequencies: 0.008220
390500 -- (-966.234) (-968.694) (-968.493) [-970.545] * (-973.519) [-967.166] (-967.570) (-968.453) -- 0:00:37
391000 -- (-966.495) (-968.372) [-968.597] (-968.162) * (-974.233) (-966.208) (-966.958) [-967.683] -- 0:00:37
391500 -- (-966.374) (-970.965) [-966.326] (-970.202) * (-973.425) (-968.115) [-970.945] (-967.923) -- 0:00:37
392000 -- (-966.417) (-973.199) (-966.408) [-970.065] * (-968.345) (-969.058) (-967.974) [-972.063] -- 0:00:37
392500 -- (-968.599) (-971.104) [-966.931] (-967.945) * (-968.224) [-968.958] (-967.511) (-966.876) -- 0:00:38
393000 -- (-969.586) (-972.315) [-968.095] (-966.882) * (-967.942) (-968.826) [-966.733] (-967.489) -- 0:00:38
393500 -- (-970.612) [-969.940] (-967.374) (-966.450) * (-967.725) [-967.165] (-968.577) (-973.334) -- 0:00:38
394000 -- (-965.881) (-969.719) [-967.538] (-966.289) * (-966.914) (-970.896) (-969.944) [-967.594] -- 0:00:38
394500 -- (-969.283) (-968.463) [-969.387] (-968.084) * [-969.288] (-968.236) (-968.235) (-968.127) -- 0:00:38
395000 -- (-968.085) (-969.688) [-966.772] (-966.576) * (-969.279) [-969.118] (-970.192) (-967.028) -- 0:00:38
Average standard deviation of split frequencies: 0.009375
395500 -- (-967.492) (-969.591) (-966.699) [-969.727] * (-968.044) [-968.177] (-969.395) (-968.795) -- 0:00:38
396000 -- [-967.717] (-969.591) (-967.300) (-966.334) * (-966.585) [-968.887] (-970.300) (-969.280) -- 0:00:38
396500 -- (-969.635) (-965.700) (-973.462) [-965.855] * (-966.969) [-973.296] (-966.043) (-970.546) -- 0:00:38
397000 -- (-967.639) (-967.668) [-968.081] (-967.605) * [-967.163] (-972.959) (-966.404) (-969.235) -- 0:00:37
397500 -- (-966.595) (-967.995) (-966.054) [-969.265] * (-967.855) (-969.566) (-966.690) [-970.270] -- 0:00:37
398000 -- (-966.366) (-965.649) [-968.386] (-966.794) * (-968.620) (-973.451) [-966.842] (-969.285) -- 0:00:37
398500 -- (-968.126) (-967.301) (-967.975) [-965.753] * (-968.989) [-972.682] (-969.193) (-969.040) -- 0:00:37
399000 -- (-968.247) (-966.571) [-968.695] (-965.929) * [-968.413] (-966.433) (-969.135) (-966.399) -- 0:00:37
399500 -- (-969.308) (-968.027) (-968.468) [-969.543] * (-969.866) [-975.714] (-971.312) (-968.737) -- 0:00:37
400000 -- [-965.710] (-970.812) (-970.141) (-968.903) * (-968.241) (-966.329) (-969.932) [-967.521] -- 0:00:37
Average standard deviation of split frequencies: 0.009334
400500 -- [-967.056] (-968.686) (-971.152) (-966.705) * (-966.918) (-965.953) (-968.627) [-969.538] -- 0:00:37
401000 -- [-966.589] (-965.747) (-967.939) (-967.590) * [-966.926] (-965.950) (-967.362) (-982.562) -- 0:00:37
401500 -- (-966.985) (-966.221) (-968.198) [-966.104] * (-966.737) (-966.249) (-967.474) [-968.153] -- 0:00:37
402000 -- (-966.914) (-967.571) (-968.151) [-966.354] * (-966.769) (-966.736) [-971.392] (-970.108) -- 0:00:37
402500 -- (-968.236) [-966.541] (-969.084) (-965.534) * (-966.951) [-967.841] (-967.735) (-968.637) -- 0:00:37
403000 -- (-968.353) (-967.785) (-967.231) [-966.454] * (-967.163) (-967.926) [-970.044] (-974.090) -- 0:00:37
403500 -- [-968.294] (-968.992) (-967.344) (-969.172) * (-966.899) [-966.873] (-968.424) (-966.604) -- 0:00:36
404000 -- (-968.107) (-969.595) [-967.102] (-967.214) * (-966.270) (-967.248) [-967.236] (-971.092) -- 0:00:36
404500 -- [-969.010] (-967.639) (-971.325) (-966.427) * (-971.831) [-967.366] (-969.306) (-969.038) -- 0:00:36
405000 -- (-967.143) [-969.269] (-967.683) (-967.086) * [-965.992] (-967.176) (-966.237) (-972.057) -- 0:00:36
Average standard deviation of split frequencies: 0.008998
405500 -- [-966.751] (-966.926) (-966.716) (-968.571) * (-966.950) (-969.884) [-967.285] (-969.807) -- 0:00:36
406000 -- (-966.479) [-966.367] (-967.620) (-968.343) * (-969.219) [-975.107] (-967.373) (-966.343) -- 0:00:36
406500 -- (-967.226) (-966.133) [-966.176] (-968.809) * (-970.290) (-977.435) [-966.761] (-966.233) -- 0:00:36
407000 -- (-969.606) (-967.041) (-968.276) [-965.870] * (-968.394) [-966.360] (-968.899) (-965.672) -- 0:00:36
407500 -- (-966.372) (-972.018) (-968.935) [-966.330] * [-970.036] (-967.003) (-966.993) (-966.514) -- 0:00:36
408000 -- (-970.308) (-966.837) (-970.350) [-966.832] * (-970.717) (-973.478) [-967.022] (-967.843) -- 0:00:36
408500 -- (-969.927) (-967.348) [-969.361] (-968.059) * [-966.186] (-973.376) (-970.647) (-969.652) -- 0:00:36
409000 -- (-968.295) [-968.030] (-970.750) (-972.226) * (-966.991) [-966.925] (-971.014) (-969.658) -- 0:00:37
409500 -- (-968.153) (-972.260) [-969.368] (-968.397) * (-966.509) (-967.022) (-965.998) [-966.536] -- 0:00:37
410000 -- (-968.526) (-971.875) [-969.438] (-967.566) * (-969.244) (-970.408) (-965.998) [-967.647] -- 0:00:37
Average standard deviation of split frequencies: 0.009030
410500 -- (-968.237) [-969.919] (-973.789) (-968.919) * (-969.657) (-969.705) [-966.969] (-967.313) -- 0:00:37
411000 -- (-968.318) (-968.595) (-969.466) [-968.407] * (-972.464) (-970.544) (-967.421) [-968.257] -- 0:00:37
411500 -- (-966.564) (-969.331) [-971.041] (-969.361) * (-969.532) (-970.962) (-966.874) [-966.447] -- 0:00:37
412000 -- (-966.831) (-971.431) [-969.790] (-966.592) * (-969.725) (-970.996) (-966.836) [-966.356] -- 0:00:37
412500 -- (-966.851) (-968.921) (-969.543) [-970.985] * (-967.998) (-968.344) [-966.687] (-967.927) -- 0:00:37
413000 -- (-965.881) (-968.191) (-972.599) [-969.908] * (-965.783) (-968.137) [-967.301] (-967.163) -- 0:00:36
413500 -- [-968.006] (-967.744) (-971.743) (-970.304) * (-966.965) [-966.884] (-967.543) (-967.897) -- 0:00:36
414000 -- (-967.967) [-967.751] (-970.652) (-968.325) * (-972.486) [-966.225] (-966.454) (-968.152) -- 0:00:36
414500 -- [-966.688] (-967.655) (-967.515) (-967.402) * (-968.456) (-971.457) (-969.036) [-967.796] -- 0:00:36
415000 -- [-968.404] (-966.513) (-967.624) (-965.902) * (-968.791) (-969.502) [-968.508] (-968.693) -- 0:00:36
Average standard deviation of split frequencies: 0.009490
415500 -- (-968.444) [-966.209] (-968.729) (-968.328) * [-968.102] (-968.595) (-966.319) (-967.841) -- 0:00:36
416000 -- (-967.847) (-966.534) (-966.151) [-965.970] * (-969.560) (-966.988) [-968.208] (-970.004) -- 0:00:36
416500 -- (-970.093) (-971.960) [-966.238] (-969.598) * (-969.709) (-966.560) (-967.814) [-968.865] -- 0:00:36
417000 -- (-966.887) (-966.313) [-966.554] (-968.288) * (-966.827) (-966.837) (-974.493) [-965.696] -- 0:00:36
417500 -- [-970.156] (-968.681) (-966.694) (-967.269) * [-966.849] (-966.171) (-968.644) (-966.631) -- 0:00:36
418000 -- [-968.956] (-967.580) (-965.776) (-971.230) * [-966.610] (-966.332) (-968.050) (-968.843) -- 0:00:36
418500 -- (-967.965) [-966.030] (-974.359) (-967.080) * (-967.427) (-966.373) (-970.929) [-968.413] -- 0:00:36
419000 -- (-969.611) (-966.067) (-966.579) [-967.004] * (-966.851) [-968.784] (-965.634) (-967.692) -- 0:00:36
419500 -- (-966.841) (-966.067) [-966.739] (-967.405) * [-967.928] (-966.639) (-967.180) (-967.668) -- 0:00:35
420000 -- (-967.061) [-968.657] (-973.498) (-967.166) * (-966.742) (-970.633) (-969.099) [-967.694] -- 0:00:35
Average standard deviation of split frequencies: 0.009875
420500 -- [-966.826] (-968.772) (-966.384) (-968.108) * (-965.591) (-969.427) [-965.565] (-967.749) -- 0:00:35
421000 -- [-967.906] (-966.015) (-967.863) (-966.439) * (-969.075) (-967.337) [-965.971] (-967.660) -- 0:00:35
421500 -- (-967.749) [-966.720] (-968.935) (-968.494) * (-971.964) [-966.626] (-966.993) (-967.745) -- 0:00:35
422000 -- (-968.676) (-967.322) [-967.360] (-970.742) * (-966.048) (-967.283) [-967.478] (-968.079) -- 0:00:35
422500 -- (-969.358) (-967.323) (-966.774) [-970.443] * (-967.361) [-966.604] (-966.436) (-969.371) -- 0:00:35
423000 -- [-967.219] (-967.757) (-967.089) (-968.873) * [-967.167] (-970.062) (-966.500) (-970.696) -- 0:00:35
423500 -- (-969.283) (-965.802) (-968.250) [-966.535] * [-966.790] (-966.962) (-966.231) (-966.591) -- 0:00:35
424000 -- (-970.337) (-968.875) (-968.118) [-967.259] * (-966.805) (-966.998) [-966.641] (-967.432) -- 0:00:35
424500 -- (-968.502) [-970.039] (-967.342) (-966.208) * (-967.721) [-965.886] (-966.641) (-967.519) -- 0:00:35
425000 -- (-967.783) (-968.912) [-968.180] (-966.355) * (-966.769) (-966.268) (-965.916) [-968.733] -- 0:00:35
Average standard deviation of split frequencies: 0.009683
425500 -- (-967.286) [-967.872] (-966.331) (-968.624) * (-966.729) [-968.023] (-965.755) (-968.483) -- 0:00:35
426000 -- (-967.786) (-968.884) [-965.654] (-967.903) * (-969.115) (-968.830) [-966.386] (-965.788) -- 0:00:36
426500 -- (-968.271) (-968.738) [-967.199] (-966.964) * (-967.302) (-968.899) (-969.398) [-968.367] -- 0:00:36
427000 -- (-969.558) (-969.810) (-969.115) [-967.070] * (-965.714) (-975.547) [-966.240] (-968.670) -- 0:00:36
427500 -- (-969.553) (-967.774) [-967.953] (-966.671) * (-969.751) [-967.324] (-966.253) (-968.106) -- 0:00:36
428000 -- (-967.861) (-966.529) [-970.282] (-968.867) * (-968.015) (-970.432) (-967.061) [-966.314] -- 0:00:36
428500 -- (-967.724) [-969.140] (-968.743) (-967.432) * (-968.781) [-966.296] (-967.082) (-966.104) -- 0:00:36
429000 -- (-968.676) (-969.379) (-969.378) [-967.618] * (-967.424) [-969.604] (-968.522) (-970.303) -- 0:00:35
429500 -- (-968.984) [-967.018] (-967.845) (-967.703) * (-968.334) (-970.504) (-967.959) [-967.288] -- 0:00:35
430000 -- (-970.397) (-967.410) [-967.506] (-970.325) * (-970.374) (-966.017) [-966.990] (-967.817) -- 0:00:35
Average standard deviation of split frequencies: 0.009167
430500 -- (-966.660) (-967.659) [-971.602] (-969.291) * (-969.516) [-968.301] (-968.372) (-966.942) -- 0:00:35
431000 -- (-969.297) [-966.693] (-970.770) (-967.021) * (-967.483) (-970.360) (-971.665) [-965.737] -- 0:00:35
431500 -- (-971.735) (-966.867) (-966.830) [-968.171] * [-966.262] (-968.268) (-971.098) (-965.776) -- 0:00:35
432000 -- (-974.432) [-970.442] (-969.948) (-967.232) * (-968.388) [-967.604] (-968.015) (-971.830) -- 0:00:35
432500 -- (-966.867) (-966.496) (-968.277) [-968.887] * (-965.765) (-968.880) (-969.043) [-971.128] -- 0:00:35
433000 -- [-967.775] (-968.858) (-967.568) (-968.756) * (-965.731) (-966.068) [-967.004] (-968.137) -- 0:00:35
433500 -- (-969.309) (-968.310) (-968.543) [-968.572] * [-966.613] (-967.307) (-972.282) (-968.391) -- 0:00:35
434000 -- (-966.638) (-971.504) [-966.767] (-967.938) * [-970.086] (-967.922) (-968.096) (-968.237) -- 0:00:35
434500 -- (-969.133) [-974.125] (-965.629) (-967.636) * (-969.578) (-968.602) [-968.394] (-967.506) -- 0:00:35
435000 -- (-973.356) (-974.062) (-965.733) [-969.152] * (-969.308) (-967.691) (-968.927) [-967.342] -- 0:00:35
Average standard deviation of split frequencies: 0.008717
435500 -- [-971.900] (-969.344) (-966.406) (-967.200) * (-966.569) (-970.256) [-970.163] (-969.508) -- 0:00:34
436000 -- (-967.329) [-969.317] (-968.480) (-968.502) * (-966.832) (-967.088) (-968.210) [-967.359] -- 0:00:34
436500 -- (-969.146) [-970.295] (-967.850) (-968.510) * (-966.826) (-968.033) (-966.970) [-967.236] -- 0:00:34
437000 -- [-967.300] (-967.235) (-967.336) (-968.841) * [-967.531] (-975.654) (-966.570) (-966.939) -- 0:00:34
437500 -- [-967.348] (-967.693) (-967.943) (-967.346) * [-966.557] (-971.421) (-969.532) (-967.607) -- 0:00:34
438000 -- (-971.037) (-967.971) (-971.064) [-969.347] * (-966.376) [-967.322] (-970.521) (-968.989) -- 0:00:34
438500 -- [-966.500] (-967.763) (-972.370) (-969.503) * (-967.124) (-969.745) (-966.735) [-968.869] -- 0:00:34
439000 -- (-968.353) (-968.003) [-969.446] (-971.755) * [-967.282] (-973.353) (-969.390) (-967.634) -- 0:00:34
439500 -- (-967.879) (-967.886) [-968.075] (-968.396) * [-968.225] (-973.147) (-968.778) (-968.176) -- 0:00:34
440000 -- (-968.887) (-968.189) [-967.358] (-968.611) * (-967.222) (-969.197) (-968.263) [-966.492] -- 0:00:34
Average standard deviation of split frequencies: 0.008692
440500 -- (-967.909) [-966.781] (-972.306) (-968.266) * (-966.162) [-966.497] (-972.355) (-967.656) -- 0:00:34
441000 -- (-968.173) (-968.305) (-970.987) [-968.199] * [-966.629] (-969.010) (-967.904) (-968.394) -- 0:00:34
441500 -- [-967.269] (-967.456) (-968.341) (-966.960) * (-966.200) [-967.219] (-970.361) (-967.812) -- 0:00:34
442000 -- [-967.207] (-969.201) (-966.671) (-967.961) * [-966.203] (-969.760) (-967.172) (-973.194) -- 0:00:34
442500 -- (-973.763) [-968.149] (-966.396) (-967.430) * (-968.678) [-967.253] (-967.351) (-968.404) -- 0:00:35
443000 -- (-970.076) (-966.732) (-966.667) [-968.811] * [-967.175] (-967.385) (-967.261) (-969.092) -- 0:00:35
443500 -- (-973.527) (-967.740) [-967.077] (-969.355) * (-966.522) (-971.324) [-968.864] (-969.104) -- 0:00:35
444000 -- (-973.760) (-967.437) [-967.149] (-966.019) * [-966.225] (-971.125) (-966.532) (-972.645) -- 0:00:35
444500 -- (-975.900) (-968.489) [-967.286] (-968.859) * (-966.717) [-972.585] (-968.367) (-967.977) -- 0:00:34
445000 -- (-967.096) [-966.210] (-968.327) (-965.973) * (-967.893) [-970.750] (-968.805) (-968.039) -- 0:00:34
Average standard deviation of split frequencies: 0.008654
445500 -- (-969.242) (-967.305) (-970.270) [-967.229] * (-969.695) (-973.850) (-971.664) [-966.998] -- 0:00:34
446000 -- (-966.586) (-967.363) (-967.564) [-967.949] * (-967.096) (-967.822) [-970.383] (-970.703) -- 0:00:34
446500 -- (-966.589) (-967.718) [-969.864] (-969.166) * (-967.368) (-965.903) [-969.116] (-967.209) -- 0:00:34
447000 -- (-967.679) (-966.074) (-967.869) [-968.434] * (-968.360) (-965.703) (-970.106) [-967.208] -- 0:00:34
447500 -- (-969.885) (-969.966) (-966.728) [-967.508] * (-971.367) (-966.847) [-968.957] (-969.138) -- 0:00:34
448000 -- [-966.906] (-967.639) (-969.026) (-965.733) * (-968.455) (-967.513) (-965.999) [-966.426] -- 0:00:34
448500 -- [-966.188] (-967.363) (-969.458) (-967.384) * (-970.048) (-967.075) [-968.401] (-967.022) -- 0:00:34
449000 -- (-967.332) (-967.210) [-970.196] (-968.174) * [-967.884] (-966.804) (-971.051) (-966.555) -- 0:00:34
449500 -- (-967.529) (-966.824) (-968.362) [-967.246] * (-967.332) (-969.218) (-969.720) [-969.106] -- 0:00:34
450000 -- (-968.467) (-974.267) (-969.139) [-968.267] * (-967.867) (-966.795) (-968.434) [-967.394] -- 0:00:34
Average standard deviation of split frequencies: 0.008303
450500 -- (-971.119) (-968.718) [-971.056] (-968.906) * (-967.195) (-968.047) (-969.042) [-970.743] -- 0:00:34
451000 -- (-966.614) [-966.946] (-967.344) (-968.690) * (-966.878) [-969.692] (-968.726) (-967.635) -- 0:00:34
451500 -- (-968.052) (-967.231) [-966.762] (-969.107) * (-966.082) (-967.680) (-966.768) [-969.373] -- 0:00:34
452000 -- (-968.111) [-967.397] (-966.752) (-967.520) * [-965.790] (-972.612) (-967.999) (-969.377) -- 0:00:33
452500 -- (-966.466) [-968.248] (-968.002) (-967.683) * (-966.417) [-972.303] (-968.233) (-970.389) -- 0:00:33
453000 -- (-966.427) [-966.238] (-966.927) (-966.964) * [-969.034] (-967.626) (-968.085) (-971.919) -- 0:00:33
453500 -- (-966.943) [-966.575] (-967.314) (-965.906) * (-973.149) [-968.135] (-966.135) (-971.947) -- 0:00:33
454000 -- (-968.688) (-966.408) [-967.483] (-971.564) * (-971.061) (-968.659) (-968.622) [-966.536] -- 0:00:33
454500 -- (-966.881) (-970.099) [-967.389] (-969.431) * (-968.837) (-967.139) [-970.080] (-965.701) -- 0:00:33
455000 -- (-968.273) [-967.793] (-966.781) (-968.148) * (-966.006) [-967.155] (-966.603) (-967.213) -- 0:00:33
Average standard deviation of split frequencies: 0.008753
455500 -- (-967.433) (-971.349) [-967.230] (-973.243) * [-969.036] (-968.160) (-969.340) (-966.617) -- 0:00:33
456000 -- [-967.493] (-968.057) (-969.647) (-969.987) * (-969.817) (-967.814) [-966.438] (-968.513) -- 0:00:33
456500 -- [-967.431] (-967.777) (-967.596) (-965.824) * (-969.628) (-968.613) [-968.345] (-968.432) -- 0:00:33
457000 -- (-968.422) (-966.578) (-968.243) [-966.426] * (-970.668) (-968.632) (-966.667) [-966.582] -- 0:00:33
457500 -- (-970.684) (-966.998) [-966.864] (-966.226) * (-966.119) (-970.608) (-968.314) [-967.195] -- 0:00:33
458000 -- (-968.996) (-966.130) [-966.281] (-966.200) * [-966.137] (-969.194) (-966.108) (-967.119) -- 0:00:33
458500 -- (-966.152) (-966.265) [-967.251] (-969.497) * (-966.880) (-968.364) (-970.234) [-966.032] -- 0:00:33
459000 -- [-967.425] (-966.253) (-965.894) (-967.901) * (-966.301) (-966.767) [-965.788] (-969.139) -- 0:00:34
459500 -- (-966.196) (-968.074) (-966.017) [-969.796] * (-966.552) (-967.317) (-965.639) [-966.188] -- 0:00:34
460000 -- [-968.355] (-967.636) (-967.022) (-967.246) * (-973.426) (-966.464) (-965.669) [-970.409] -- 0:00:34
Average standard deviation of split frequencies: 0.008255
460500 -- (-967.437) (-971.154) (-966.174) [-966.374] * (-967.619) (-967.170) (-965.906) [-968.720] -- 0:00:33
461000 -- [-967.576] (-970.573) (-966.470) (-967.073) * (-966.424) (-968.886) [-965.735] (-972.646) -- 0:00:33
461500 -- (-966.463) [-967.460] (-966.742) (-973.610) * (-966.590) [-967.743] (-966.605) (-968.431) -- 0:00:33
462000 -- [-968.578] (-970.520) (-966.901) (-967.121) * (-966.235) [-967.865] (-966.373) (-968.011) -- 0:00:33
462500 -- (-968.335) [-967.936] (-968.566) (-967.956) * [-967.184] (-972.595) (-966.339) (-967.831) -- 0:00:33
463000 -- [-969.165] (-967.587) (-967.087) (-968.007) * [-967.880] (-967.167) (-966.244) (-969.001) -- 0:00:33
463500 -- (-968.204) (-972.488) [-966.321] (-977.060) * (-966.904) (-968.744) [-969.604] (-967.923) -- 0:00:33
464000 -- (-970.743) [-967.726] (-967.133) (-974.892) * (-966.393) (-972.776) [-969.765] (-967.012) -- 0:00:33
464500 -- (-968.898) (-968.450) (-970.001) [-967.251] * [-966.865] (-968.186) (-975.575) (-966.969) -- 0:00:33
465000 -- (-967.872) (-967.849) (-972.705) [-971.516] * [-967.419] (-968.809) (-972.148) (-969.430) -- 0:00:33
Average standard deviation of split frequencies: 0.008565
465500 -- (-967.048) (-966.416) (-971.072) [-969.113] * (-969.245) (-966.646) [-966.084] (-969.152) -- 0:00:33
466000 -- (-966.677) (-969.119) [-966.300] (-969.330) * [-967.277] (-967.833) (-967.922) (-967.632) -- 0:00:33
466500 -- (-967.438) (-969.604) [-967.395] (-969.108) * [-966.955] (-968.975) (-968.766) (-967.413) -- 0:00:33
467000 -- (-966.317) (-967.265) (-966.222) [-967.592] * (-966.161) (-968.254) (-969.217) [-967.239] -- 0:00:33
467500 -- (-970.604) (-967.248) (-968.504) [-966.460] * [-969.286] (-968.201) (-968.873) (-969.028) -- 0:00:33
468000 -- [-969.903] (-970.985) (-970.047) (-968.925) * (-968.489) [-967.364] (-972.503) (-967.967) -- 0:00:32
468500 -- (-967.660) (-969.198) [-969.678] (-967.340) * (-968.690) (-969.214) (-968.657) [-971.179] -- 0:00:32
469000 -- (-967.898) (-966.550) (-971.044) [-967.380] * (-968.680) (-970.903) [-967.810] (-968.052) -- 0:00:32
469500 -- (-967.240) (-966.973) [-968.978] (-968.381) * (-965.936) [-969.326] (-972.030) (-971.843) -- 0:00:32
470000 -- (-967.820) (-975.175) [-968.486] (-967.823) * (-966.414) (-968.869) [-966.728] (-966.782) -- 0:00:32
Average standard deviation of split frequencies: 0.009214
470500 -- (-969.729) (-966.867) (-968.022) [-967.023] * (-970.629) (-965.594) (-967.127) [-968.042] -- 0:00:32
471000 -- [-967.931] (-970.544) (-968.075) (-967.869) * (-969.113) [-965.597] (-966.680) (-967.971) -- 0:00:32
471500 -- (-967.680) [-966.669] (-966.866) (-966.570) * (-967.067) (-969.850) (-967.332) [-968.487] -- 0:00:32
472000 -- (-973.902) (-969.230) [-969.707] (-966.804) * (-968.866) [-968.565] (-966.784) (-967.569) -- 0:00:32
472500 -- (-973.248) [-966.186] (-968.827) (-969.771) * (-970.227) (-971.656) (-968.554) [-968.337] -- 0:00:32
473000 -- (-973.507) (-966.498) [-966.157] (-967.964) * [-969.856] (-974.381) (-966.782) (-966.238) -- 0:00:32
473500 -- (-966.214) (-966.570) [-966.085] (-968.920) * (-967.369) [-971.277] (-968.100) (-966.064) -- 0:00:32
474000 -- (-966.535) [-969.446] (-970.105) (-966.103) * (-966.501) (-971.274) (-971.344) [-969.861] -- 0:00:32
474500 -- [-966.284] (-968.831) (-970.086) (-965.853) * (-966.153) (-973.586) [-968.313] (-966.560) -- 0:00:32
475000 -- (-967.559) (-969.997) [-971.794] (-966.595) * [-965.918] (-967.634) (-968.956) (-966.891) -- 0:00:32
Average standard deviation of split frequencies: 0.008480
475500 -- (-965.938) (-968.522) (-966.860) [-967.976] * (-968.009) (-967.778) [-967.124] (-967.468) -- 0:00:33
476000 -- [-969.204] (-970.206) (-967.207) (-966.193) * [-966.427] (-966.241) (-969.509) (-966.951) -- 0:00:33
476500 -- [-966.894] (-968.265) (-966.146) (-967.685) * (-969.319) (-967.325) (-971.089) [-971.829] -- 0:00:32
477000 -- (-967.238) (-967.801) (-969.102) [-975.852] * [-966.152] (-966.623) (-969.798) (-968.321) -- 0:00:32
477500 -- (-968.312) [-967.143] (-969.709) (-970.853) * (-967.028) [-968.861] (-971.028) (-967.358) -- 0:00:32
478000 -- [-965.755] (-966.019) (-969.178) (-971.323) * (-966.133) (-970.128) (-966.410) [-968.100] -- 0:00:32
478500 -- (-966.128) (-972.178) [-967.038] (-966.660) * (-965.637) (-967.061) (-966.924) [-969.998] -- 0:00:32
479000 -- [-966.095] (-968.506) (-967.416) (-970.181) * (-967.297) (-975.956) [-968.544] (-970.318) -- 0:00:32
479500 -- (-967.530) (-969.679) (-967.227) [-969.578] * (-969.364) (-968.889) (-968.748) [-971.561] -- 0:00:32
480000 -- (-967.392) (-968.364) (-966.500) [-967.192] * (-967.337) (-968.012) (-968.822) [-968.554] -- 0:00:32
Average standard deviation of split frequencies: 0.008238
480500 -- [-969.004] (-966.536) (-966.524) (-968.038) * (-972.465) [-966.586] (-967.765) (-971.036) -- 0:00:32
481000 -- (-969.128) (-968.102) [-966.676] (-966.169) * [-966.787] (-967.210) (-966.271) (-966.471) -- 0:00:32
481500 -- (-966.573) [-968.588] (-968.902) (-966.796) * [-969.368] (-966.236) (-966.426) (-969.441) -- 0:00:32
482000 -- (-968.923) (-970.560) [-967.570] (-965.782) * (-968.138) (-967.903) (-967.207) [-969.196] -- 0:00:32
482500 -- (-967.954) (-967.652) [-970.888] (-966.529) * (-968.351) (-967.451) (-966.034) [-967.075] -- 0:00:32
483000 -- [-969.301] (-966.073) (-965.907) (-965.682) * (-970.814) [-967.924] (-969.124) (-968.468) -- 0:00:32
483500 -- (-967.685) [-966.136] (-966.471) (-965.682) * (-966.643) (-967.628) (-968.380) [-967.824] -- 0:00:32
484000 -- (-966.723) (-967.870) [-965.696] (-967.251) * (-968.118) (-969.994) (-972.082) [-966.391] -- 0:00:31
484500 -- [-965.950] (-967.126) (-966.645) (-966.463) * (-970.779) (-971.429) (-968.962) [-968.067] -- 0:00:31
485000 -- (-967.501) [-967.152] (-967.375) (-972.818) * (-970.230) [-970.466] (-968.266) (-970.332) -- 0:00:31
Average standard deviation of split frequencies: 0.007578
485500 -- (-966.955) (-968.237) [-967.098] (-969.403) * (-969.259) [-969.715] (-968.953) (-967.016) -- 0:00:31
486000 -- (-966.767) (-969.685) [-965.886] (-969.033) * (-968.278) (-969.488) [-966.178] (-971.500) -- 0:00:31
486500 -- (-970.504) (-972.461) [-967.329] (-969.812) * (-967.835) (-968.056) (-966.889) [-969.022] -- 0:00:31
487000 -- (-968.875) (-971.630) (-968.532) [-967.270] * (-967.882) (-968.165) [-973.756] (-973.602) -- 0:00:31
487500 -- [-967.591] (-968.985) (-966.449) (-967.690) * (-967.012) [-968.703] (-969.882) (-967.091) -- 0:00:31
488000 -- (-972.194) (-967.059) (-966.773) [-967.388] * (-968.111) (-966.845) [-967.059] (-966.290) -- 0:00:31
488500 -- (-966.040) (-966.281) [-968.144] (-965.947) * (-969.583) (-969.358) (-969.281) [-967.010] -- 0:00:31
489000 -- (-967.584) (-966.281) (-967.905) [-966.253] * (-968.512) (-969.123) (-966.986) [-966.549] -- 0:00:31
489500 -- (-966.783) [-966.854] (-969.017) (-967.421) * (-967.724) [-966.059] (-966.174) (-971.323) -- 0:00:31
490000 -- [-966.851] (-969.844) (-966.584) (-967.996) * (-967.234) (-965.894) [-966.862] (-966.116) -- 0:00:31
Average standard deviation of split frequencies: 0.007085
490500 -- (-967.606) (-970.893) [-968.817] (-968.507) * (-966.971) (-967.124) (-967.880) [-973.110] -- 0:00:31
491000 -- [-969.036] (-968.630) (-966.396) (-968.503) * (-968.235) (-966.590) [-970.398] (-969.341) -- 0:00:31
491500 -- [-967.003] (-967.044) (-969.782) (-967.733) * (-972.936) [-966.500] (-967.454) (-969.909) -- 0:00:32
492000 -- (-969.049) (-968.918) (-967.301) [-967.499] * (-966.520) (-968.093) [-967.736] (-969.131) -- 0:00:32
492500 -- (-969.285) [-972.904] (-968.945) (-966.653) * [-968.515] (-971.456) (-967.772) (-969.075) -- 0:00:31
493000 -- (-969.319) (-966.525) [-967.582] (-969.820) * (-966.646) [-968.371] (-968.417) (-967.051) -- 0:00:31
493500 -- [-966.867] (-967.671) (-970.086) (-969.015) * [-967.481] (-969.216) (-965.979) (-966.359) -- 0:00:31
494000 -- [-966.518] (-973.170) (-969.988) (-967.656) * (-967.897) (-968.709) [-969.208] (-969.236) -- 0:00:31
494500 -- [-967.799] (-973.550) (-967.240) (-968.684) * [-966.472] (-966.659) (-970.362) (-970.924) -- 0:00:31
495000 -- (-969.709) (-968.360) [-969.348] (-966.371) * (-967.405) [-967.596] (-969.725) (-969.034) -- 0:00:31
Average standard deviation of split frequencies: 0.007484
495500 -- (-968.820) (-967.175) (-970.537) [-971.398] * (-965.685) (-969.782) (-967.951) [-965.989] -- 0:00:31
496000 -- (-968.477) (-967.080) (-967.670) [-967.370] * (-966.259) [-966.659] (-968.478) (-965.953) -- 0:00:31
496500 -- (-966.809) [-967.510] (-966.450) (-966.337) * (-969.621) [-967.749] (-966.137) (-966.815) -- 0:00:31
497000 -- [-965.925] (-967.371) (-969.677) (-968.166) * (-968.953) (-968.943) [-966.488] (-972.657) -- 0:00:31
497500 -- (-965.516) (-966.896) [-969.242] (-967.171) * (-968.831) (-967.406) (-966.505) [-969.934] -- 0:00:31
498000 -- [-969.029] (-970.411) (-966.178) (-968.750) * (-968.048) [-967.480] (-967.391) (-966.377) -- 0:00:31
498500 -- (-966.851) (-970.842) (-971.072) [-967.919] * (-966.701) (-968.443) (-966.694) [-966.467] -- 0:00:31
499000 -- (-967.212) (-966.553) (-971.873) [-967.041] * (-968.474) (-967.118) [-966.782] (-967.323) -- 0:00:31
499500 -- (-968.872) (-966.681) (-967.454) [-969.062] * (-968.520) (-966.343) [-967.939] (-967.032) -- 0:00:31
500000 -- (-967.662) [-970.818] (-970.712) (-968.538) * (-970.556) [-969.210] (-968.519) (-966.393) -- 0:00:31
Average standard deviation of split frequencies: 0.008062
500500 -- [-967.689] (-969.152) (-967.303) (-968.831) * (-968.723) (-966.260) [-967.817] (-966.874) -- 0:00:30
501000 -- [-967.054] (-966.832) (-969.795) (-967.659) * (-967.746) (-968.287) [-968.176] (-966.683) -- 0:00:30
501500 -- (-968.512) (-968.689) (-969.688) [-966.440] * [-966.135] (-966.259) (-970.599) (-967.599) -- 0:00:30
502000 -- (-968.977) [-967.838] (-967.531) (-967.996) * (-970.419) (-965.976) [-967.341] (-968.062) -- 0:00:30
502500 -- [-967.258] (-967.273) (-967.288) (-966.368) * (-967.647) (-968.388) (-969.419) [-967.375] -- 0:00:30
503000 -- [-966.208] (-969.205) (-967.764) (-969.804) * [-966.037] (-967.369) (-971.155) (-967.504) -- 0:00:30
503500 -- (-969.171) (-968.011) (-966.540) [-970.323] * [-968.407] (-966.257) (-968.332) (-969.978) -- 0:00:30
504000 -- [-966.112] (-967.355) (-970.881) (-969.393) * [-967.887] (-969.334) (-967.908) (-970.646) -- 0:00:30
504500 -- (-966.364) [-969.083] (-971.845) (-971.604) * (-967.358) [-967.160] (-971.456) (-967.449) -- 0:00:30
505000 -- (-967.250) [-966.117] (-969.518) (-968.534) * [-966.277] (-968.219) (-967.647) (-968.412) -- 0:00:30
Average standard deviation of split frequencies: 0.008210
505500 -- (-967.417) (-969.696) (-967.180) [-966.189] * (-966.395) (-968.467) (-966.061) [-972.064] -- 0:00:30
506000 -- (-974.131) (-966.387) (-967.489) [-966.867] * [-966.303] (-966.843) (-967.846) (-972.409) -- 0:00:30
506500 -- (-971.766) (-967.495) [-969.577] (-967.770) * [-973.127] (-965.961) (-970.614) (-967.499) -- 0:00:30
507000 -- (-969.310) (-968.921) (-968.380) [-967.285] * [-967.187] (-966.126) (-967.757) (-967.851) -- 0:00:30
507500 -- (-967.687) (-967.575) [-968.777] (-970.074) * (-966.893) (-967.531) [-966.551] (-966.608) -- 0:00:30
508000 -- (-968.744) (-967.173) [-967.566] (-968.964) * (-967.282) (-968.611) [-966.416] (-969.526) -- 0:00:30
508500 -- (-967.897) (-967.525) (-966.543) [-967.699] * (-966.753) (-967.573) [-966.059] (-971.303) -- 0:00:30
509000 -- (-966.754) (-965.917) [-965.948] (-967.931) * [-967.733] (-968.964) (-965.640) (-967.663) -- 0:00:30
509500 -- (-966.930) [-968.947] (-966.184) (-967.164) * (-974.160) (-968.123) (-968.811) [-968.396] -- 0:00:30
510000 -- (-966.833) [-967.664] (-967.812) (-968.363) * (-968.222) (-967.830) (-968.808) [-968.770] -- 0:00:30
Average standard deviation of split frequencies: 0.008943
510500 -- (-967.659) (-971.905) (-968.007) [-966.709] * (-966.320) [-967.176] (-974.678) (-970.568) -- 0:00:30
511000 -- (-971.260) [-967.677] (-966.341) (-969.506) * (-965.824) (-971.222) (-976.263) [-966.599] -- 0:00:30
511500 -- (-968.626) [-968.531] (-966.663) (-969.645) * (-968.538) (-971.078) [-973.096] (-968.317) -- 0:00:30
512000 -- (-967.939) (-969.120) [-966.265] (-967.448) * (-966.462) [-968.212] (-970.005) (-966.725) -- 0:00:30
512500 -- (-968.231) [-968.879] (-967.134) (-967.552) * (-970.350) (-968.131) [-966.363] (-969.154) -- 0:00:30
513000 -- [-967.726] (-969.527) (-969.170) (-967.394) * (-966.375) [-967.323] (-970.929) (-968.533) -- 0:00:30
513500 -- (-969.354) (-968.749) (-971.407) [-966.728] * [-967.648] (-967.491) (-968.571) (-967.638) -- 0:00:30
514000 -- [-969.822] (-971.447) (-966.708) (-966.850) * [-970.470] (-969.564) (-971.003) (-968.132) -- 0:00:30
514500 -- (-970.865) (-973.441) [-969.092] (-968.943) * (-968.310) (-970.132) [-969.012] (-972.448) -- 0:00:30
515000 -- (-969.351) (-969.932) (-973.259) [-971.919] * (-966.270) [-967.988] (-966.562) (-968.123) -- 0:00:30
Average standard deviation of split frequencies: 0.008222
515500 -- [-967.987] (-966.652) (-967.408) (-969.853) * [-968.021] (-966.429) (-966.836) (-967.013) -- 0:00:30
516000 -- (-968.710) [-967.150] (-973.755) (-967.236) * [-967.780] (-966.021) (-967.984) (-968.064) -- 0:00:30
516500 -- (-969.920) (-967.129) [-968.376] (-967.932) * [-968.979] (-966.415) (-966.830) (-968.367) -- 0:00:29
517000 -- (-968.140) (-968.272) (-970.453) [-968.956] * [-966.313] (-968.539) (-968.192) (-966.263) -- 0:00:29
517500 -- (-967.080) (-968.102) [-967.064] (-967.689) * (-966.774) (-968.184) (-970.275) [-969.096] -- 0:00:29
518000 -- (-967.328) (-966.601) [-970.626] (-966.823) * (-969.781) (-968.576) (-966.539) [-966.172] -- 0:00:29
518500 -- (-968.522) (-968.989) (-971.144) [-968.377] * (-967.524) (-967.990) [-966.996] (-969.132) -- 0:00:29
519000 -- (-971.439) (-968.820) (-973.734) [-970.639] * (-966.053) [-967.903] (-970.666) (-973.936) -- 0:00:29
519500 -- (-966.297) (-968.789) (-972.203) [-968.051] * (-966.710) [-969.720] (-975.786) (-973.399) -- 0:00:29
520000 -- (-966.293) (-966.877) (-966.750) [-968.461] * (-968.178) (-971.186) (-972.555) [-974.000] -- 0:00:29
Average standard deviation of split frequencies: 0.008488
520500 -- [-968.360] (-966.349) (-968.801) (-971.377) * [-966.031] (-967.358) (-968.271) (-970.890) -- 0:00:29
521000 -- [-968.127] (-966.840) (-969.741) (-969.494) * (-968.038) (-967.175) [-968.101] (-970.843) -- 0:00:29
521500 -- (-969.652) [-967.572] (-966.986) (-968.331) * (-970.705) [-967.317] (-969.638) (-968.505) -- 0:00:29
522000 -- (-967.679) (-966.114) (-967.557) [-967.914] * (-965.914) [-968.572] (-969.287) (-966.187) -- 0:00:29
522500 -- [-969.403] (-968.185) (-967.147) (-969.343) * [-968.453] (-966.976) (-968.568) (-969.138) -- 0:00:29
523000 -- (-974.082) [-965.993] (-965.974) (-968.937) * (-967.202) [-965.731] (-965.895) (-968.548) -- 0:00:29
523500 -- [-967.054] (-973.138) (-969.842) (-968.334) * [-971.463] (-970.421) (-967.242) (-968.567) -- 0:00:29
524000 -- (-970.906) (-969.133) (-970.727) [-965.764] * (-968.727) [-966.266] (-969.118) (-967.962) -- 0:00:29
524500 -- (-969.409) (-969.715) (-966.688) [-968.141] * (-970.205) (-967.614) (-970.688) [-966.735] -- 0:00:29
525000 -- (-967.964) (-972.525) (-969.548) [-966.792] * (-966.986) (-966.758) (-970.567) [-966.675] -- 0:00:29
Average standard deviation of split frequencies: 0.009410
525500 -- (-969.387) [-972.354] (-970.221) (-968.375) * [-971.393] (-966.626) (-966.678) (-968.252) -- 0:00:29
526000 -- (-967.536) [-969.641] (-965.819) (-967.800) * (-972.294) (-967.568) (-966.699) [-967.170] -- 0:00:29
526500 -- [-969.645] (-969.498) (-966.642) (-966.612) * [-966.951] (-968.289) (-967.301) (-965.875) -- 0:00:29
527000 -- (-969.134) (-967.074) [-967.583] (-967.060) * (-967.287) (-970.129) (-967.477) [-967.636] -- 0:00:29
527500 -- (-970.734) (-968.329) (-967.165) [-967.380] * (-967.339) (-967.322) (-968.054) [-966.891] -- 0:00:29
528000 -- (-967.278) (-970.341) [-967.461] (-970.457) * (-970.477) (-970.770) (-968.793) [-969.400] -- 0:00:29
528500 -- [-966.443] (-967.186) (-968.679) (-967.871) * (-968.328) [-965.935] (-968.555) (-969.447) -- 0:00:29
529000 -- (-967.607) (-969.933) [-967.821] (-968.946) * [-966.079] (-965.768) (-973.044) (-969.030) -- 0:00:29
529500 -- (-967.728) [-972.362] (-967.609) (-972.455) * (-966.434) [-968.055] (-966.199) (-968.884) -- 0:00:29
530000 -- (-971.112) (-969.288) (-968.260) [-966.317] * (-966.589) (-967.501) [-966.992] (-969.433) -- 0:00:29
Average standard deviation of split frequencies: 0.009272
530500 -- (-967.373) [-967.259] (-967.937) (-967.248) * (-966.945) [-968.855] (-966.395) (-973.604) -- 0:00:29
531000 -- [-968.478] (-969.437) (-969.641) (-971.401) * (-968.887) (-967.027) [-966.668] (-966.722) -- 0:00:29
531500 -- (-969.490) (-968.913) [-969.064] (-968.648) * (-970.982) (-969.772) (-971.501) [-968.196] -- 0:00:29
532000 -- (-967.243) [-968.201] (-966.225) (-967.053) * (-966.111) [-968.008] (-967.594) (-968.135) -- 0:00:29
532500 -- (-969.040) (-971.081) (-967.067) [-968.070] * (-966.549) [-966.788] (-965.839) (-968.340) -- 0:00:28
533000 -- (-968.282) (-974.528) (-966.722) [-969.152] * [-965.997] (-968.372) (-971.822) (-968.196) -- 0:00:28
533500 -- (-967.974) (-969.182) (-966.845) [-966.375] * (-968.324) (-969.260) [-967.428] (-967.316) -- 0:00:28
534000 -- (-971.497) (-969.827) [-969.177] (-971.023) * [-968.747] (-970.373) (-967.767) (-967.304) -- 0:00:28
534500 -- [-968.385] (-968.789) (-969.985) (-968.298) * (-968.805) [-970.212] (-970.409) (-967.982) -- 0:00:28
535000 -- (-973.000) [-968.503] (-968.402) (-969.949) * (-967.082) (-971.094) [-971.121] (-967.053) -- 0:00:28
Average standard deviation of split frequencies: 0.009070
535500 -- (-966.639) [-966.772] (-968.245) (-970.019) * (-970.602) (-971.693) [-968.396] (-967.408) -- 0:00:28
536000 -- (-966.879) [-967.500] (-968.170) (-969.206) * (-970.568) (-971.447) (-966.354) [-970.707] -- 0:00:28
536500 -- (-967.016) (-966.899) [-967.514] (-967.663) * [-967.140] (-967.888) (-968.375) (-966.475) -- 0:00:28
537000 -- (-967.032) [-969.788] (-967.314) (-968.754) * (-968.715) (-968.053) (-968.234) [-966.601] -- 0:00:28
537500 -- (-969.452) [-969.440] (-967.867) (-968.159) * (-966.313) (-969.454) [-971.202] (-966.047) -- 0:00:28
538000 -- (-967.285) (-967.919) (-966.997) [-970.234] * [-966.049] (-968.078) (-971.337) (-967.622) -- 0:00:28
538500 -- (-967.617) (-967.394) [-966.896] (-968.044) * (-966.292) (-967.714) [-969.664] (-967.290) -- 0:00:28
539000 -- (-967.288) (-966.721) (-967.402) [-968.505] * (-966.861) (-967.123) [-967.343] (-966.468) -- 0:00:28
539500 -- [-966.176] (-965.996) (-968.123) (-967.698) * (-970.058) (-969.222) (-966.535) [-968.523] -- 0:00:28
540000 -- (-966.344) (-966.011) (-970.613) [-968.090] * (-968.954) (-966.663) (-971.499) [-971.703] -- 0:00:28
Average standard deviation of split frequencies: 0.008773
540500 -- (-972.893) (-966.389) (-966.825) [-967.006] * (-969.223) [-969.609] (-967.559) (-969.327) -- 0:00:28
541000 -- (-966.006) (-965.591) (-966.684) [-966.053] * (-966.332) (-966.667) (-967.572) [-968.764] -- 0:00:28
541500 -- (-970.812) (-966.992) (-967.523) [-965.558] * (-966.742) (-966.609) [-967.951] (-970.278) -- 0:00:28
542000 -- (-967.562) (-973.869) [-966.429] (-965.851) * (-966.602) [-968.431] (-968.843) (-968.275) -- 0:00:28
542500 -- (-967.939) (-969.287) (-970.110) [-965.715] * (-967.765) (-969.436) [-968.136] (-973.371) -- 0:00:28
543000 -- [-968.569] (-969.909) (-966.912) (-968.273) * (-967.176) (-967.667) [-967.271] (-967.167) -- 0:00:28
543500 -- (-969.677) (-972.394) [-968.567] (-970.522) * (-966.072) (-967.733) [-967.265] (-969.433) -- 0:00:28
544000 -- [-968.902] (-971.191) (-966.996) (-969.163) * [-967.679] (-966.781) (-967.220) (-970.432) -- 0:00:28
544500 -- (-968.625) (-972.197) (-966.177) [-968.516] * [-966.986] (-967.629) (-967.343) (-970.088) -- 0:00:28
545000 -- [-969.975] (-966.665) (-965.770) (-967.741) * (-967.378) [-966.457] (-968.948) (-967.798) -- 0:00:28
Average standard deviation of split frequencies: 0.008904
545500 -- (-971.680) (-972.732) (-968.098) [-969.202] * (-967.921) (-967.206) (-968.585) [-966.494] -- 0:00:28
546000 -- [-968.496] (-976.899) (-975.622) (-969.091) * (-969.935) (-970.617) [-967.714] (-967.716) -- 0:00:28
546500 -- (-970.860) (-966.908) [-969.744] (-969.660) * [-967.051] (-971.081) (-965.744) (-969.161) -- 0:00:28
547000 -- (-969.064) (-967.864) (-971.438) [-967.282] * (-968.398) (-973.035) [-965.985] (-969.549) -- 0:00:28
547500 -- (-966.780) [-966.983] (-966.512) (-967.338) * [-966.444] (-966.710) (-967.590) (-968.623) -- 0:00:28
548000 -- (-969.975) [-972.017] (-966.216) (-967.807) * (-968.931) (-969.423) (-971.413) [-968.829] -- 0:00:28
548500 -- (-968.308) (-968.509) [-968.928] (-966.236) * (-974.291) [-968.204] (-968.654) (-967.490) -- 0:00:27
549000 -- (-970.206) (-969.184) [-967.103] (-969.446) * (-973.914) (-966.236) [-969.383] (-967.473) -- 0:00:27
549500 -- (-970.271) (-968.933) [-967.632] (-969.500) * [-970.018] (-968.651) (-967.790) (-968.009) -- 0:00:27
550000 -- (-966.090) [-966.189] (-966.700) (-967.252) * (-967.491) (-967.761) [-966.627] (-969.782) -- 0:00:27
Average standard deviation of split frequencies: 0.008775
550500 -- (-973.842) [-967.035] (-968.311) (-967.316) * (-968.235) [-966.888] (-966.324) (-968.751) -- 0:00:27
551000 -- [-968.370] (-967.258) (-967.906) (-967.229) * [-967.080] (-966.583) (-968.146) (-967.205) -- 0:00:27
551500 -- (-971.716) (-969.374) [-971.156] (-967.239) * (-967.801) (-966.584) [-966.507] (-974.001) -- 0:00:27
552000 -- [-967.231] (-968.741) (-968.882) (-966.914) * [-966.814] (-974.824) (-972.057) (-966.195) -- 0:00:27
552500 -- (-966.740) (-968.252) (-967.191) [-967.029] * (-969.877) (-969.417) (-966.718) [-967.668] -- 0:00:27
553000 -- [-966.385] (-967.093) (-969.287) (-965.899) * [-966.614] (-968.446) (-968.320) (-967.643) -- 0:00:27
553500 -- (-968.944) [-967.980] (-971.710) (-967.420) * [-967.092] (-973.172) (-968.953) (-971.014) -- 0:00:27
554000 -- [-971.523] (-968.400) (-969.343) (-972.256) * [-965.854] (-969.737) (-971.535) (-966.295) -- 0:00:27
554500 -- (-967.766) [-969.186] (-968.026) (-966.909) * [-966.044] (-967.069) (-968.370) (-966.706) -- 0:00:27
555000 -- (-967.993) (-970.256) (-967.624) [-968.340] * (-971.052) [-976.185] (-966.719) (-969.579) -- 0:00:27
Average standard deviation of split frequencies: 0.009061
555500 -- (-970.792) (-972.220) [-967.141] (-968.006) * (-968.286) [-968.440] (-968.094) (-973.407) -- 0:00:27
556000 -- (-971.766) [-965.783] (-969.635) (-967.774) * (-968.983) (-967.102) (-967.518) [-968.798] -- 0:00:27
556500 -- (-968.113) [-966.314] (-966.443) (-967.964) * (-968.638) (-965.985) [-966.991] (-968.139) -- 0:00:27
557000 -- (-966.374) (-966.755) (-968.705) [-973.802] * (-967.975) [-966.133] (-967.023) (-967.602) -- 0:00:27
557500 -- (-970.330) (-967.553) [-966.685] (-970.276) * (-966.306) (-966.886) (-969.430) [-967.305] -- 0:00:27
558000 -- [-966.751] (-966.709) (-967.458) (-971.249) * (-965.678) (-971.664) [-970.247] (-968.611) -- 0:00:27
558500 -- (-967.398) [-967.529] (-967.913) (-970.766) * (-969.242) (-967.641) [-969.253] (-966.865) -- 0:00:27
559000 -- (-968.542) [-966.362] (-972.900) (-968.226) * (-968.073) (-967.110) (-967.506) [-967.275] -- 0:00:27
559500 -- (-969.953) (-966.496) [-966.498] (-971.484) * (-966.166) [-969.052] (-969.235) (-966.689) -- 0:00:27
560000 -- (-966.667) (-965.848) [-968.176] (-975.330) * (-966.575) (-966.095) (-967.395) [-965.710] -- 0:00:27
Average standard deviation of split frequencies: 0.009196
560500 -- (-969.146) (-967.605) (-967.839) [-966.886] * (-967.312) (-968.277) [-969.203] (-967.421) -- 0:00:27
561000 -- (-968.461) (-972.692) (-966.615) [-972.094] * (-966.454) (-967.883) [-967.581] (-968.673) -- 0:00:27
561500 -- (-972.148) (-972.677) (-966.414) [-968.144] * (-966.878) [-967.831] (-967.752) (-967.848) -- 0:00:27
562000 -- [-972.417] (-967.888) (-973.278) (-966.314) * (-966.790) (-968.232) (-967.555) [-967.812] -- 0:00:27
562500 -- (-967.143) (-969.900) [-969.891] (-965.908) * (-970.692) (-967.506) (-968.527) [-968.500] -- 0:00:27
563000 -- [-968.150] (-969.101) (-969.211) (-965.908) * (-969.701) (-967.689) [-969.005] (-966.749) -- 0:00:27
563500 -- (-967.000) [-969.683] (-969.043) (-966.333) * (-970.267) [-967.407] (-968.604) (-972.835) -- 0:00:27
564000 -- (-967.727) [-967.361] (-967.204) (-966.185) * (-967.878) (-966.064) (-968.758) [-967.430] -- 0:00:27
564500 -- (-972.029) [-966.127] (-969.194) (-967.877) * (-967.985) (-966.873) (-969.824) [-967.669] -- 0:00:27
565000 -- (-969.152) (-966.076) [-968.540] (-969.030) * (-966.144) (-968.006) [-972.485] (-968.669) -- 0:00:26
Average standard deviation of split frequencies: 0.009162
565500 -- [-966.709] (-965.657) (-966.034) (-968.801) * [-967.031] (-970.714) (-975.040) (-968.578) -- 0:00:26
566000 -- (-965.596) (-967.638) (-967.425) [-969.323] * (-966.585) [-966.435] (-973.408) (-967.792) -- 0:00:26
566500 -- (-966.902) (-970.481) (-967.679) [-968.696] * (-966.371) (-965.932) (-971.554) [-966.685] -- 0:00:26
567000 -- (-967.786) (-968.487) (-968.162) [-969.746] * (-971.841) [-967.516] (-969.381) (-968.921) -- 0:00:26
567500 -- [-967.708] (-972.692) (-971.534) (-969.264) * (-968.343) (-967.156) (-967.848) [-966.307] -- 0:00:26
568000 -- [-966.859] (-967.315) (-970.377) (-968.829) * [-970.037] (-967.895) (-967.918) (-971.730) -- 0:00:26
568500 -- (-968.111) (-968.416) [-969.123] (-969.094) * (-968.435) (-967.979) (-965.684) [-969.717] -- 0:00:26
569000 -- (-968.085) (-966.523) (-967.189) [-965.798] * (-967.182) (-968.567) [-966.989] (-965.944) -- 0:00:26
569500 -- (-966.013) (-966.390) (-967.328) [-968.491] * (-969.818) (-968.657) [-970.203] (-966.064) -- 0:00:26
570000 -- [-966.013] (-966.139) (-969.430) (-966.742) * [-966.241] (-971.419) (-967.436) (-966.939) -- 0:00:26
Average standard deviation of split frequencies: 0.009603
570500 -- [-967.217] (-968.912) (-969.996) (-966.727) * (-965.712) (-970.619) [-968.652] (-967.418) -- 0:00:26
571000 -- (-968.198) (-966.202) (-968.672) [-967.002] * (-966.468) [-967.971] (-969.467) (-971.064) -- 0:00:26
571500 -- (-966.980) [-968.188] (-967.813) (-968.603) * (-966.231) [-966.606] (-970.987) (-966.187) -- 0:00:26
572000 -- [-966.585] (-968.380) (-966.773) (-966.601) * (-966.724) [-966.815] (-969.486) (-967.772) -- 0:00:26
572500 -- (-966.333) (-966.988) (-966.950) [-966.542] * [-966.515] (-966.091) (-966.629) (-967.513) -- 0:00:26
573000 -- [-967.427] (-966.201) (-967.508) (-966.076) * (-970.718) [-968.362] (-965.955) (-967.968) -- 0:00:26
573500 -- (-969.712) (-966.353) (-969.991) [-966.978] * [-967.018] (-969.646) (-966.809) (-968.599) -- 0:00:26
574000 -- (-967.414) (-966.442) (-966.211) [-966.555] * (-970.062) (-967.758) [-966.683] (-968.157) -- 0:00:26
574500 -- (-967.386) [-967.267] (-966.065) (-966.702) * [-965.885] (-968.506) (-968.803) (-967.106) -- 0:00:26
575000 -- (-969.986) [-968.105] (-966.594) (-969.228) * [-965.651] (-970.047) (-969.516) (-967.285) -- 0:00:26
Average standard deviation of split frequencies: 0.010179
575500 -- [-966.361] (-969.528) (-966.894) (-968.432) * (-968.923) (-965.900) (-969.714) [-968.359] -- 0:00:26
576000 -- (-967.473) (-966.537) [-969.395] (-968.029) * (-965.740) [-968.394] (-971.600) (-972.219) -- 0:00:26
576500 -- (-969.125) [-967.016] (-966.551) (-967.618) * (-965.992) (-967.110) [-972.187] (-968.591) -- 0:00:26
577000 -- (-971.800) (-966.300) (-969.387) [-966.984] * (-973.801) (-967.123) [-968.948] (-971.471) -- 0:00:26
577500 -- (-969.493) (-969.232) (-967.734) [-966.813] * (-971.796) (-967.883) [-967.375] (-970.277) -- 0:00:26
578000 -- (-967.341) (-967.913) (-969.682) [-966.799] * (-969.092) (-967.421) (-966.835) [-967.666] -- 0:00:26
578500 -- (-968.196) (-968.431) [-969.026] (-966.494) * [-972.288] (-967.833) (-969.115) (-969.514) -- 0:00:26
579000 -- (-965.975) (-968.798) (-973.114) [-966.882] * (-966.082) [-967.452] (-971.304) (-966.260) -- 0:00:26
579500 -- (-970.377) (-968.837) [-966.866] (-968.325) * (-970.664) (-968.753) [-970.557] (-970.759) -- 0:00:26
580000 -- [-971.861] (-969.792) (-967.052) (-968.894) * [-967.450] (-967.338) (-971.702) (-965.741) -- 0:00:26
Average standard deviation of split frequencies: 0.009793
580500 -- (-968.415) [-971.950] (-966.506) (-971.768) * [-968.322] (-966.812) (-967.801) (-966.333) -- 0:00:26
581000 -- [-969.452] (-967.666) (-969.030) (-967.774) * (-967.034) (-967.786) (-966.461) [-967.412] -- 0:00:25
581500 -- [-967.581] (-969.307) (-966.599) (-968.982) * (-966.991) (-971.538) (-966.209) [-967.861] -- 0:00:25
582000 -- (-967.969) [-968.276] (-971.400) (-970.432) * (-967.205) [-966.181] (-966.403) (-968.271) -- 0:00:25
582500 -- (-967.817) (-966.039) [-967.602] (-968.649) * (-967.561) (-968.725) (-969.124) [-967.725] -- 0:00:25
583000 -- (-968.585) (-966.426) [-968.026] (-969.733) * (-969.472) (-966.359) [-966.165] (-969.313) -- 0:00:25
583500 -- (-969.896) (-967.065) (-968.319) [-966.744] * [-969.314] (-967.172) (-967.249) (-968.921) -- 0:00:25
584000 -- (-967.823) (-966.639) (-969.283) [-968.818] * (-972.674) (-969.109) (-968.417) [-970.347] -- 0:00:25
584500 -- (-966.339) (-966.639) (-970.123) [-968.854] * [-973.362] (-974.591) (-971.037) (-967.890) -- 0:00:25
585000 -- (-967.371) [-969.748] (-970.945) (-967.594) * (-966.811) (-970.662) (-969.919) [-967.812] -- 0:00:25
Average standard deviation of split frequencies: 0.009503
585500 -- (-967.547) (-968.235) [-968.775] (-968.343) * (-966.808) (-968.265) [-966.061] (-969.656) -- 0:00:25
586000 -- (-967.839) [-970.491] (-967.781) (-967.599) * (-969.043) [-967.864] (-969.034) (-970.512) -- 0:00:25
586500 -- (-969.343) (-967.809) (-969.791) [-966.837] * (-966.832) [-968.030] (-970.835) (-969.847) -- 0:00:25
587000 -- [-967.338] (-968.319) (-967.141) (-967.660) * (-966.607) [-966.875] (-969.950) (-967.763) -- 0:00:25
587500 -- (-968.848) (-967.439) (-968.431) [-966.555] * (-966.617) (-966.352) [-968.788] (-968.249) -- 0:00:25
588000 -- [-966.405] (-971.983) (-971.654) (-967.593) * [-970.984] (-974.957) (-969.662) (-968.033) -- 0:00:25
588500 -- [-969.528] (-968.415) (-967.335) (-971.489) * [-966.254] (-970.638) (-970.868) (-966.214) -- 0:00:25
589000 -- [-970.167] (-971.702) (-967.196) (-969.799) * (-967.780) (-966.228) [-969.474] (-966.678) -- 0:00:25
589500 -- (-969.727) [-969.956] (-967.344) (-966.279) * (-968.936) (-969.326) (-969.615) [-967.152] -- 0:00:25
590000 -- (-970.200) (-967.206) [-967.756] (-966.909) * [-967.060] (-969.171) (-968.700) (-969.431) -- 0:00:25
Average standard deviation of split frequencies: 0.009028
590500 -- (-968.921) [-966.935] (-965.967) (-969.036) * (-969.291) (-970.672) [-970.660] (-969.292) -- 0:00:25
591000 -- [-968.260] (-967.735) (-967.230) (-972.435) * (-967.624) (-969.190) [-968.309] (-969.780) -- 0:00:25
591500 -- (-967.058) [-970.032] (-971.710) (-967.343) * (-969.455) (-966.302) [-966.631] (-969.192) -- 0:00:25
592000 -- (-969.363) (-967.333) [-972.299] (-966.821) * (-967.620) (-967.975) [-966.195] (-968.127) -- 0:00:25
592500 -- (-967.896) (-967.871) [-966.897] (-968.318) * (-971.933) [-970.233] (-966.237) (-968.227) -- 0:00:25
593000 -- (-968.013) (-967.758) [-966.047] (-967.516) * (-971.379) (-969.886) (-968.047) [-967.114] -- 0:00:25
593500 -- (-966.811) (-967.633) (-966.911) [-966.952] * (-966.705) (-966.059) [-968.240] (-968.331) -- 0:00:25
594000 -- (-967.272) (-966.107) (-967.471) [-967.305] * (-965.741) (-967.349) (-966.883) [-966.818] -- 0:00:25
594500 -- (-967.828) (-969.315) [-969.053] (-967.826) * (-968.025) (-966.765) [-966.463] (-967.593) -- 0:00:25
595000 -- (-967.721) (-969.793) (-968.855) [-966.906] * (-966.915) (-968.581) [-966.057] (-966.272) -- 0:00:25
Average standard deviation of split frequencies: 0.008799
595500 -- [-968.990] (-966.834) (-969.516) (-969.398) * (-968.213) [-968.212] (-966.639) (-965.995) -- 0:00:25
596000 -- (-975.868) [-967.101] (-968.164) (-969.448) * (-968.228) (-966.844) [-966.377] (-970.582) -- 0:00:25
596500 -- (-974.336) (-966.620) [-972.459] (-968.825) * (-968.720) [-966.882] (-967.261) (-966.784) -- 0:00:25
597000 -- [-968.794] (-967.658) (-970.172) (-967.588) * (-968.657) (-968.759) [-965.972] (-966.193) -- 0:00:24
597500 -- (-967.627) [-967.416] (-968.155) (-968.188) * [-967.888] (-966.751) (-966.251) (-969.619) -- 0:00:24
598000 -- [-966.766] (-968.114) (-967.186) (-967.206) * (-969.153) (-966.534) [-967.226] (-966.401) -- 0:00:24
598500 -- (-967.641) [-967.599] (-966.962) (-968.181) * (-968.107) [-966.773] (-971.431) (-967.539) -- 0:00:24
599000 -- (-967.588) [-967.160] (-967.946) (-967.462) * (-967.659) [-967.149] (-969.887) (-971.246) -- 0:00:24
599500 -- (-970.910) [-969.496] (-967.756) (-966.511) * [-966.429] (-969.704) (-971.077) (-966.898) -- 0:00:24
600000 -- [-967.612] (-966.854) (-966.773) (-967.397) * [-967.073] (-966.554) (-968.729) (-966.532) -- 0:00:24
Average standard deviation of split frequencies: 0.009025
600500 -- (-967.404) (-968.562) [-966.672] (-967.688) * [-967.994] (-966.776) (-966.199) (-969.520) -- 0:00:24
601000 -- [-971.953] (-969.057) (-968.071) (-968.986) * (-970.209) (-966.186) (-968.325) [-966.236] -- 0:00:24
601500 -- (-967.890) [-972.006] (-969.097) (-968.387) * (-967.906) [-969.401] (-967.476) (-967.161) -- 0:00:24
602000 -- [-969.489] (-969.906) (-968.837) (-966.348) * (-971.620) (-966.006) [-968.526] (-966.744) -- 0:00:24
602500 -- (-968.594) [-968.111] (-967.126) (-966.573) * [-966.518] (-969.133) (-967.179) (-967.551) -- 0:00:24
603000 -- (-968.133) [-965.817] (-967.100) (-969.417) * [-966.234] (-965.812) (-967.753) (-966.781) -- 0:00:24
603500 -- (-969.402) [-968.870] (-968.705) (-967.777) * (-966.885) (-966.393) [-967.384] (-966.629) -- 0:00:24
604000 -- [-966.757] (-969.190) (-966.705) (-967.160) * (-966.470) (-967.998) [-967.046] (-966.886) -- 0:00:24
604500 -- (-967.019) [-970.988] (-966.727) (-967.981) * (-967.145) [-966.848] (-969.181) (-967.853) -- 0:00:24
605000 -- (-967.017) [-966.743] (-967.360) (-968.983) * (-967.240) [-965.712] (-969.200) (-968.773) -- 0:00:24
Average standard deviation of split frequencies: 0.009043
605500 -- (-968.115) [-968.433] (-969.877) (-967.309) * [-968.730] (-970.537) (-971.064) (-966.187) -- 0:00:24
606000 -- (-968.752) (-966.687) [-967.448] (-966.803) * (-971.020) [-966.943] (-971.353) (-968.036) -- 0:00:24
606500 -- [-971.453] (-968.679) (-969.976) (-968.576) * (-968.728) (-969.567) (-966.703) [-965.729] -- 0:00:24
607000 -- (-966.961) (-968.578) [-969.684] (-968.695) * (-967.559) (-966.631) (-969.788) [-967.767] -- 0:00:24
607500 -- [-967.276] (-967.027) (-965.615) (-968.657) * (-970.742) [-970.154] (-968.955) (-966.189) -- 0:00:24
608000 -- [-966.184] (-972.140) (-967.166) (-968.707) * [-970.584] (-968.581) (-968.869) (-973.055) -- 0:00:24
608500 -- (-968.420) [-969.730] (-968.264) (-967.304) * (-969.729) (-968.948) [-967.177] (-968.414) -- 0:00:24
609000 -- [-969.173] (-977.142) (-965.908) (-966.935) * (-967.805) [-968.745] (-967.903) (-968.805) -- 0:00:24
609500 -- (-969.854) (-970.056) [-965.838] (-966.467) * (-967.805) (-967.214) [-966.264] (-967.400) -- 0:00:24
610000 -- (-967.724) (-970.332) (-966.316) [-966.576] * (-969.934) [-967.624] (-966.645) (-967.476) -- 0:00:24
Average standard deviation of split frequencies: 0.008974
610500 -- [-967.888] (-967.246) (-967.624) (-968.158) * (-971.320) (-970.057) (-969.459) [-966.869] -- 0:00:24
611000 -- [-968.291] (-968.292) (-970.717) (-967.725) * (-971.060) (-966.972) [-967.922] (-969.725) -- 0:00:24
611500 -- (-972.024) (-968.212) (-973.055) [-967.664] * (-969.030) (-966.602) [-970.137] (-971.991) -- 0:00:24
612000 -- (-969.593) [-968.503] (-970.286) (-968.929) * [-967.797] (-967.368) (-970.479) (-970.213) -- 0:00:24
612500 -- (-967.471) [-970.943] (-968.012) (-965.779) * (-967.137) [-966.287] (-970.722) (-968.064) -- 0:00:24
613000 -- (-969.039) (-970.042) (-968.010) [-968.340] * (-968.685) (-970.159) [-966.508] (-966.447) -- 0:00:23
613500 -- (-967.360) [-966.811] (-967.645) (-970.243) * (-966.456) (-967.966) (-968.991) [-968.735] -- 0:00:23
614000 -- (-965.709) [-968.131] (-969.250) (-971.092) * (-966.030) (-973.292) (-966.063) [-970.689] -- 0:00:23
614500 -- (-965.639) (-965.609) [-968.269] (-968.635) * (-969.894) [-971.060] (-969.339) (-969.728) -- 0:00:23
615000 -- (-966.195) (-967.430) (-968.081) [-967.725] * [-973.249] (-971.810) (-967.290) (-967.877) -- 0:00:23
Average standard deviation of split frequencies: 0.009088
615500 -- (-965.872) (-967.882) [-967.330] (-968.303) * (-967.161) (-969.164) (-966.234) [-968.697] -- 0:00:23
616000 -- (-966.247) (-970.999) (-966.303) [-968.762] * (-966.436) (-968.944) (-974.819) [-966.829] -- 0:00:23
616500 -- (-966.447) (-969.780) [-967.217] (-966.971) * (-967.764) (-965.842) [-966.581] (-967.284) -- 0:00:23
617000 -- (-967.154) [-966.890] (-965.957) (-968.140) * (-967.304) (-968.315) [-966.052] (-966.237) -- 0:00:23
617500 -- (-965.661) (-969.818) [-966.688] (-966.893) * (-966.411) [-966.679] (-966.380) (-972.249) -- 0:00:23
618000 -- [-969.572] (-966.811) (-967.823) (-966.170) * (-967.017) (-970.247) [-966.871] (-970.247) -- 0:00:23
618500 -- (-967.797) [-969.287] (-967.794) (-967.898) * (-968.280) [-968.246] (-967.084) (-972.327) -- 0:00:23
619000 -- [-970.681] (-970.471) (-970.961) (-968.919) * (-971.083) (-968.467) (-967.293) [-966.055] -- 0:00:23
619500 -- [-968.878] (-971.378) (-970.710) (-966.579) * [-968.581] (-965.864) (-969.865) (-968.280) -- 0:00:23
620000 -- (-966.353) (-968.019) (-969.712) [-967.244] * (-968.054) [-965.894] (-969.538) (-969.756) -- 0:00:23
Average standard deviation of split frequencies: 0.008497
620500 -- (-968.914) (-970.019) [-969.404] (-968.206) * (-966.285) [-966.920] (-968.732) (-971.145) -- 0:00:23
621000 -- [-967.691] (-969.397) (-966.439) (-967.043) * (-968.717) [-969.016] (-969.560) (-968.520) -- 0:00:23
621500 -- [-968.915] (-968.310) (-968.543) (-970.111) * [-971.553] (-966.828) (-967.617) (-969.342) -- 0:00:23
622000 -- (-967.429) (-967.723) [-966.417] (-969.144) * [-969.019] (-966.264) (-969.529) (-968.032) -- 0:00:23
622500 -- (-968.895) [-970.297] (-969.369) (-970.610) * (-967.372) (-967.877) (-966.826) [-967.421] -- 0:00:23
623000 -- (-967.272) (-969.311) [-967.911] (-969.288) * (-967.809) (-968.641) (-967.123) [-967.229] -- 0:00:22
623500 -- (-967.468) (-969.905) (-968.390) [-968.288] * (-966.250) [-969.578] (-969.481) (-967.746) -- 0:00:23
624000 -- (-966.734) [-972.954] (-968.773) (-967.172) * [-968.248] (-969.594) (-967.375) (-973.885) -- 0:00:23
624500 -- (-967.787) (-969.931) [-968.930] (-968.816) * [-967.195] (-970.776) (-967.561) (-967.670) -- 0:00:23
625000 -- (-973.097) (-966.252) (-969.294) [-970.894] * [-967.207] (-970.367) (-965.881) (-968.437) -- 0:00:23
Average standard deviation of split frequencies: 0.008283
625500 -- (-966.902) [-968.561] (-970.179) (-967.348) * (-968.094) [-968.225] (-967.493) (-967.599) -- 0:00:23
626000 -- (-967.368) [-966.094] (-968.385) (-967.997) * [-966.386] (-966.639) (-967.163) (-966.830) -- 0:00:23
626500 -- (-968.285) (-968.926) [-968.555] (-967.548) * [-967.000] (-967.106) (-968.877) (-967.883) -- 0:00:23
627000 -- (-972.192) [-969.371] (-966.655) (-971.182) * [-967.361] (-969.632) (-969.460) (-967.036) -- 0:00:23
627500 -- [-970.548] (-966.625) (-967.491) (-966.192) * (-967.665) [-969.833] (-968.285) (-967.702) -- 0:00:23
628000 -- (-968.317) (-971.422) [-966.918] (-966.305) * (-969.010) (-971.862) (-971.499) [-965.724] -- 0:00:23
628500 -- (-968.928) (-968.361) (-970.096) [-968.743] * [-971.998] (-969.291) (-965.892) (-968.329) -- 0:00:23
629000 -- (-972.485) (-970.176) [-967.959] (-967.184) * (-968.955) [-970.420] (-966.525) (-966.985) -- 0:00:23
629500 -- (-967.028) (-969.266) [-969.298] (-966.431) * [-970.541] (-969.291) (-965.825) (-966.938) -- 0:00:22
630000 -- (-965.842) (-972.209) [-970.363] (-966.479) * (-967.265) (-967.235) [-966.301] (-967.515) -- 0:00:22
Average standard deviation of split frequencies: 0.007662
630500 -- (-966.109) (-968.295) (-970.668) [-966.822] * (-966.763) [-969.396] (-967.809) (-970.819) -- 0:00:22
631000 -- [-970.733] (-966.408) (-969.629) (-966.650) * (-967.643) [-967.415] (-970.179) (-970.618) -- 0:00:22
631500 -- [-968.821] (-969.472) (-969.473) (-969.774) * (-966.346) (-968.702) (-976.492) [-969.506] -- 0:00:22
632000 -- (-967.168) (-970.998) [-967.930] (-967.638) * [-966.176] (-966.899) (-968.547) (-969.108) -- 0:00:22
632500 -- (-967.163) [-967.544] (-966.897) (-966.712) * (-966.802) (-967.612) (-967.618) [-969.246] -- 0:00:22
633000 -- (-969.982) [-968.360] (-967.210) (-967.237) * (-965.771) (-968.249) (-966.696) [-967.949] -- 0:00:22
633500 -- (-971.828) (-967.113) (-972.421) [-968.732] * [-967.552] (-968.384) (-969.957) (-965.705) -- 0:00:22
634000 -- (-969.844) [-966.993] (-967.310) (-971.715) * [-968.129] (-972.665) (-968.826) (-967.329) -- 0:00:22
634500 -- (-965.841) (-968.558) [-967.491] (-968.593) * (-967.220) [-972.555] (-967.459) (-967.112) -- 0:00:22
635000 -- [-967.039] (-966.624) (-968.847) (-968.124) * (-967.496) [-966.906] (-969.354) (-966.578) -- 0:00:22
Average standard deviation of split frequencies: 0.007412
635500 -- (-970.270) (-970.086) [-969.220] (-969.626) * [-968.569] (-966.839) (-969.453) (-967.867) -- 0:00:22
636000 -- (-967.792) [-966.415] (-967.766) (-966.723) * (-970.453) [-967.398] (-966.284) (-968.182) -- 0:00:22
636500 -- (-967.436) (-968.734) [-968.291] (-968.193) * (-967.166) (-967.433) [-967.032] (-972.874) -- 0:00:22
637000 -- (-966.475) (-967.672) [-968.047] (-968.584) * [-969.348] (-967.557) (-967.207) (-971.444) -- 0:00:22
637500 -- (-970.686) (-968.533) [-967.947] (-967.618) * (-967.245) [-967.242] (-968.650) (-967.383) -- 0:00:22
638000 -- [-967.089] (-972.519) (-970.115) (-966.415) * (-967.903) (-966.963) [-966.375] (-967.127) -- 0:00:22
638500 -- (-972.737) (-968.009) (-966.479) [-967.316] * (-968.446) [-982.097] (-969.362) (-969.929) -- 0:00:22
639000 -- (-969.286) [-966.284] (-968.781) (-970.762) * (-968.398) (-970.929) [-967.047] (-968.001) -- 0:00:22
639500 -- [-967.901] (-968.039) (-967.293) (-966.261) * (-967.649) (-967.857) (-970.863) [-967.884] -- 0:00:21
640000 -- [-967.054] (-967.757) (-967.746) (-965.990) * (-967.450) [-967.591] (-967.234) (-972.448) -- 0:00:22
Average standard deviation of split frequencies: 0.007505
640500 -- (-966.118) (-965.784) [-966.453] (-968.147) * (-971.346) (-967.257) (-969.939) [-967.039] -- 0:00:22
641000 -- (-967.269) (-969.616) (-967.573) [-967.354] * [-965.602] (-970.136) (-968.202) (-968.065) -- 0:00:22
641500 -- [-968.395] (-966.811) (-966.868) (-969.564) * [-967.091] (-969.966) (-966.034) (-967.406) -- 0:00:22
642000 -- (-970.435) (-971.134) (-968.015) [-966.590] * (-966.447) [-966.996] (-970.303) (-966.260) -- 0:00:22
642500 -- [-969.931] (-967.465) (-970.221) (-966.591) * (-968.364) [-967.210] (-968.666) (-966.476) -- 0:00:22
643000 -- (-969.207) (-968.051) (-968.456) [-966.032] * (-968.391) [-966.617] (-968.536) (-969.688) -- 0:00:22
643500 -- (-967.210) [-967.492] (-967.859) (-967.603) * (-968.158) [-966.964] (-968.612) (-972.565) -- 0:00:22
644000 -- (-967.061) (-966.780) (-967.964) [-967.870] * [-967.066] (-970.172) (-969.562) (-967.277) -- 0:00:22
644500 -- (-966.181) (-966.523) (-965.898) [-966.375] * [-966.553] (-973.217) (-969.329) (-966.915) -- 0:00:22
645000 -- [-966.896] (-966.524) (-968.953) (-969.017) * (-968.363) [-971.750] (-967.749) (-966.363) -- 0:00:22
Average standard deviation of split frequencies: 0.007571
645500 -- (-968.530) (-969.117) (-967.974) [-968.330] * (-967.087) (-977.000) [-968.169] (-967.740) -- 0:00:21
646000 -- (-970.954) [-968.375] (-968.111) (-969.254) * (-969.979) (-968.131) (-975.677) [-966.449] -- 0:00:21
646500 -- (-972.087) [-967.638] (-967.951) (-967.345) * (-967.239) (-967.035) (-972.058) [-971.572] -- 0:00:21
647000 -- (-966.848) [-968.228] (-967.244) (-967.603) * (-966.799) (-966.518) (-969.715) [-968.021] -- 0:00:21
647500 -- (-971.384) (-968.683) (-966.201) [-971.839] * (-969.621) (-967.034) (-969.307) [-968.290] -- 0:00:21
648000 -- (-970.364) [-968.733] (-966.627) (-969.224) * (-967.353) [-970.456] (-967.868) (-968.014) -- 0:00:21
648500 -- (-968.303) [-968.014] (-967.053) (-967.798) * (-967.236) (-966.914) [-968.978] (-967.237) -- 0:00:21
649000 -- (-968.850) (-967.863) [-969.050] (-968.520) * (-970.297) (-970.510) [-968.747] (-966.387) -- 0:00:21
649500 -- [-967.754] (-969.127) (-968.590) (-968.524) * (-969.167) (-970.493) [-968.452] (-968.245) -- 0:00:21
650000 -- [-967.570] (-966.968) (-968.801) (-966.336) * (-971.255) (-973.009) (-966.255) [-965.990] -- 0:00:21
Average standard deviation of split frequencies: 0.007698
650500 -- (-966.380) [-967.640] (-970.227) (-966.271) * (-965.785) (-968.830) (-967.290) [-969.875] -- 0:00:21
651000 -- [-966.269] (-969.717) (-967.922) (-967.709) * (-966.629) [-967.884] (-969.089) (-967.879) -- 0:00:21
651500 -- (-965.989) (-966.240) [-967.627] (-968.467) * (-966.336) (-967.253) (-966.762) [-966.516] -- 0:00:21
652000 -- (-966.243) (-968.472) (-967.616) [-967.878] * (-974.860) (-969.139) [-968.498] (-968.702) -- 0:00:21
652500 -- (-968.158) (-971.445) [-966.486] (-967.152) * [-969.896] (-966.877) (-967.166) (-968.866) -- 0:00:21
653000 -- [-969.605] (-967.846) (-966.265) (-966.488) * [-966.318] (-967.325) (-966.626) (-969.178) -- 0:00:21
653500 -- (-966.510) (-967.069) (-967.217) [-967.471] * [-967.671] (-973.282) (-966.609) (-966.473) -- 0:00:21
654000 -- (-968.060) [-966.968] (-966.899) (-968.407) * (-967.472) (-968.025) (-969.893) [-967.201] -- 0:00:21
654500 -- [-967.509] (-968.314) (-967.633) (-968.657) * [-968.189] (-970.421) (-966.490) (-968.915) -- 0:00:21
655000 -- (-967.896) (-968.085) [-966.805] (-969.206) * (-968.042) (-967.925) (-966.321) [-970.277] -- 0:00:21
Average standard deviation of split frequencies: 0.007276
655500 -- (-967.337) [-968.206] (-966.142) (-971.597) * [-966.948] (-969.972) (-965.743) (-968.069) -- 0:00:21
656000 -- [-966.886] (-970.066) (-966.481) (-972.143) * (-968.348) [-968.410] (-970.156) (-968.048) -- 0:00:21
656500 -- (-965.590) [-968.282] (-966.594) (-967.066) * (-967.741) [-965.943] (-968.180) (-969.494) -- 0:00:21
657000 -- (-968.840) (-968.321) [-966.484] (-967.615) * [-967.902] (-968.631) (-967.932) (-969.316) -- 0:00:21
657500 -- (-974.458) (-971.174) (-967.050) [-966.534] * (-968.948) [-970.163] (-969.163) (-970.091) -- 0:00:21
658000 -- (-969.944) (-968.640) [-966.919] (-967.073) * (-971.308) [-968.342] (-966.546) (-967.035) -- 0:00:21
658500 -- (-969.685) (-966.514) (-966.831) [-966.037] * [-967.281] (-972.093) (-967.282) (-966.546) -- 0:00:21
659000 -- (-969.502) [-968.697] (-966.982) (-967.443) * (-966.473) (-969.210) (-966.137) [-967.731] -- 0:00:21
659500 -- [-966.082] (-967.401) (-967.742) (-966.196) * (-968.043) (-966.619) [-970.823] (-967.831) -- 0:00:21
660000 -- (-967.402) (-968.472) (-966.551) [-967.899] * [-966.622] (-966.291) (-972.834) (-969.071) -- 0:00:21
Average standard deviation of split frequencies: 0.007314
660500 -- (-967.113) [-967.615] (-967.053) (-967.279) * (-967.001) (-966.398) (-966.378) [-969.836] -- 0:00:21
661000 -- (-966.109) (-967.183) [-966.401] (-967.498) * (-966.797) [-966.663] (-966.550) (-965.700) -- 0:00:21
661500 -- (-967.598) [-967.694] (-965.978) (-966.865) * (-967.221) (-967.389) [-966.881] (-967.840) -- 0:00:20
662000 -- (-966.561) [-967.467] (-968.838) (-968.326) * (-968.971) (-969.403) (-967.084) [-971.691] -- 0:00:20
662500 -- (-969.752) (-966.918) (-969.889) [-966.657] * [-969.661] (-967.495) (-969.192) (-968.943) -- 0:00:20
663000 -- (-968.683) (-966.982) [-966.862] (-967.810) * (-968.496) (-968.848) (-967.553) [-967.725] -- 0:00:20
663500 -- (-972.165) [-966.763] (-968.603) (-965.710) * (-967.957) (-969.459) [-966.287] (-969.372) -- 0:00:20
664000 -- (-966.567) (-970.589) (-969.139) [-965.667] * [-967.953] (-969.214) (-967.438) (-970.493) -- 0:00:20
664500 -- (-967.522) (-969.769) [-968.191] (-969.419) * [-966.818] (-966.697) (-968.277) (-967.378) -- 0:00:20
665000 -- (-966.472) (-970.414) [-969.681] (-967.110) * (-970.056) (-966.671) [-969.857] (-972.096) -- 0:00:20
Average standard deviation of split frequencies: 0.007034
665500 -- (-966.895) [-968.608] (-968.023) (-969.547) * (-968.105) (-968.472) [-968.828] (-968.144) -- 0:00:20
666000 -- (-968.877) [-969.543] (-966.113) (-968.826) * [-967.326] (-968.686) (-969.229) (-968.147) -- 0:00:20
666500 -- (-969.633) [-966.816] (-967.654) (-969.540) * (-965.722) (-966.770) (-970.588) [-966.959] -- 0:00:20
667000 -- (-971.154) (-965.825) [-967.148] (-968.558) * (-965.721) (-968.150) [-967.234] (-968.135) -- 0:00:20
667500 -- (-968.081) (-968.037) (-966.702) [-967.344] * (-966.741) (-968.810) (-966.521) [-968.402] -- 0:00:20
668000 -- (-967.064) (-967.365) (-972.184) [-966.910] * (-966.760) [-970.907] (-968.230) (-966.800) -- 0:00:20
668500 -- [-967.874] (-967.819) (-966.661) (-966.935) * [-968.354] (-967.324) (-966.080) (-966.162) -- 0:00:20
669000 -- (-969.164) [-965.898] (-967.441) (-967.705) * (-970.458) [-970.613] (-968.090) (-968.840) -- 0:00:20
669500 -- (-970.443) (-966.146) [-967.354] (-969.461) * (-969.201) (-969.257) [-968.654] (-967.401) -- 0:00:20
670000 -- (-971.884) [-967.204] (-971.315) (-971.001) * [-966.705] (-967.924) (-970.562) (-968.177) -- 0:00:20
Average standard deviation of split frequencies: 0.007161
670500 -- (-969.768) [-968.682] (-972.211) (-968.060) * (-967.792) (-968.247) [-970.003] (-968.376) -- 0:00:20
671000 -- (-969.728) (-967.719) [-968.612] (-967.820) * (-967.508) (-968.173) (-971.302) [-966.030] -- 0:00:20
671500 -- (-966.327) (-968.113) (-968.169) [-966.067] * (-970.006) [-967.416] (-969.214) (-967.946) -- 0:00:20
672000 -- [-966.199] (-972.053) (-969.713) (-970.225) * (-969.612) [-966.274] (-969.842) (-969.807) -- 0:00:20
672500 -- [-969.060] (-967.390) (-969.957) (-969.900) * (-972.124) [-969.060] (-968.271) (-968.947) -- 0:00:20
673000 -- (-967.955) (-969.870) (-967.333) [-966.447] * (-968.784) [-966.671] (-965.811) (-969.002) -- 0:00:20
673500 -- [-967.395] (-968.632) (-970.875) (-969.975) * (-966.044) [-968.277] (-965.700) (-966.871) -- 0:00:20
674000 -- (-966.227) (-967.770) [-967.258] (-967.706) * (-966.924) (-966.625) [-965.931] (-968.138) -- 0:00:20
674500 -- (-966.760) (-968.789) (-968.674) [-966.213] * [-966.492] (-966.537) (-970.310) (-968.743) -- 0:00:20
675000 -- [-968.370] (-968.628) (-970.510) (-968.748) * (-967.121) (-965.908) (-971.519) [-966.890] -- 0:00:20
Average standard deviation of split frequencies: 0.007366
675500 -- (-966.095) (-967.596) (-966.339) [-967.648] * (-972.333) (-966.131) [-968.505] (-969.234) -- 0:00:20
676000 -- [-969.599] (-968.208) (-968.092) (-967.261) * (-971.225) (-967.986) [-967.249] (-973.602) -- 0:00:20
676500 -- (-969.475) (-970.005) [-966.675] (-966.011) * (-972.158) (-967.267) [-967.379] (-966.472) -- 0:00:20
677000 -- (-968.603) (-969.388) (-968.583) [-967.213] * (-971.359) (-966.931) [-967.091] (-967.233) -- 0:00:20
677500 -- (-969.293) (-971.423) (-971.536) [-968.410] * (-968.513) [-966.313] (-969.873) (-967.112) -- 0:00:19
678000 -- (-969.325) (-969.269) (-966.467) [-969.615] * (-969.926) (-968.728) (-966.773) [-968.609] -- 0:00:19
678500 -- (-966.166) [-966.410] (-967.475) (-966.335) * [-969.027] (-966.500) (-969.745) (-971.176) -- 0:00:19
679000 -- (-966.471) (-969.047) [-969.957] (-967.058) * (-966.624) (-969.421) (-970.859) [-966.738] -- 0:00:19
679500 -- (-968.466) (-969.164) [-968.694] (-967.041) * (-965.915) (-967.498) [-967.068] (-967.123) -- 0:00:19
680000 -- (-968.568) (-967.418) [-969.032] (-966.554) * (-969.192) [-967.491] (-967.341) (-969.327) -- 0:00:19
Average standard deviation of split frequencies: 0.006796
680500 -- (-973.507) [-966.735] (-966.683) (-966.191) * (-967.794) [-968.212] (-969.313) (-969.038) -- 0:00:19
681000 -- [-969.703] (-967.839) (-966.635) (-966.679) * [-968.455] (-966.913) (-967.545) (-967.143) -- 0:00:19
681500 -- [-965.818] (-968.388) (-969.753) (-971.955) * (-972.953) (-967.192) (-968.268) [-968.001] -- 0:00:19
682000 -- [-966.434] (-970.285) (-967.868) (-970.287) * [-970.567] (-967.748) (-966.946) (-968.364) -- 0:00:19
682500 -- (-970.066) [-970.430] (-967.540) (-967.944) * (-967.026) [-969.308] (-970.845) (-969.773) -- 0:00:19
683000 -- (-967.845) (-971.226) (-966.923) [-967.331] * [-973.146] (-966.040) (-970.918) (-966.425) -- 0:00:19
683500 -- (-966.358) [-966.842] (-967.933) (-968.312) * (-969.334) (-967.688) (-969.300) [-970.640] -- 0:00:19
684000 -- [-967.370] (-968.768) (-967.439) (-969.837) * (-971.014) [-973.387] (-966.944) (-967.919) -- 0:00:19
684500 -- [-968.747] (-968.061) (-965.997) (-968.255) * (-965.834) (-971.773) (-966.125) [-968.821] -- 0:00:19
685000 -- (-969.814) (-968.721) (-972.385) [-970.508] * [-965.749] (-968.612) (-969.053) (-968.189) -- 0:00:19
Average standard deviation of split frequencies: 0.006442
685500 -- [-967.779] (-966.942) (-968.369) (-972.191) * (-967.558) [-967.098] (-969.643) (-972.151) -- 0:00:19
686000 -- (-967.377) [-966.935] (-966.712) (-972.496) * (-968.696) [-967.229] (-967.381) (-966.086) -- 0:00:19
686500 -- (-968.184) [-971.542] (-969.359) (-967.705) * [-969.790] (-972.617) (-969.276) (-967.266) -- 0:00:19
687000 -- (-967.134) (-967.104) [-966.459] (-967.713) * [-970.109] (-969.577) (-969.299) (-966.594) -- 0:00:19
687500 -- [-967.327] (-974.760) (-966.510) (-968.227) * (-968.204) [-967.114] (-970.621) (-968.616) -- 0:00:19
688000 -- (-969.109) (-972.124) [-967.475] (-968.011) * (-966.832) [-967.922] (-968.023) (-966.933) -- 0:00:19
688500 -- (-970.795) (-973.736) (-967.411) [-971.618] * (-969.769) [-966.510] (-966.247) (-966.309) -- 0:00:19
689000 -- (-967.133) [-971.113] (-967.295) (-972.237) * (-966.682) (-967.327) (-970.168) [-966.223] -- 0:00:19
689500 -- (-966.203) (-968.796) [-966.725] (-967.981) * (-966.142) [-970.171] (-970.937) (-968.815) -- 0:00:19
690000 -- [-967.518] (-965.604) (-967.768) (-970.122) * (-968.660) (-969.238) (-969.166) [-971.976] -- 0:00:19
Average standard deviation of split frequencies: 0.006825
690500 -- [-967.021] (-968.088) (-965.984) (-967.441) * (-967.623) (-967.900) [-966.559] (-969.657) -- 0:00:19
691000 -- (-970.145) (-969.093) [-968.264] (-967.229) * (-968.626) (-967.300) (-965.701) [-967.251] -- 0:00:19
691500 -- (-969.001) (-971.756) [-968.181] (-966.626) * (-966.978) (-971.401) [-968.767] (-966.545) -- 0:00:19
692000 -- [-966.065] (-967.341) (-969.012) (-969.529) * (-970.471) [-968.706] (-968.016) (-969.835) -- 0:00:19
692500 -- (-969.786) (-972.897) (-968.013) [-966.374] * (-966.951) [-969.004] (-969.796) (-972.472) -- 0:00:19
693000 -- (-966.209) [-966.033] (-967.350) (-968.716) * [-968.352] (-969.403) (-975.058) (-969.719) -- 0:00:19
693500 -- (-969.174) [-969.124] (-966.864) (-968.743) * (-966.464) (-970.506) [-965.961] (-971.200) -- 0:00:19
694000 -- (-967.667) [-968.830] (-966.848) (-966.493) * (-969.391) (-968.439) [-967.640] (-967.269) -- 0:00:18
694500 -- [-966.358] (-971.592) (-969.725) (-970.038) * [-969.511] (-969.547) (-971.511) (-967.775) -- 0:00:18
695000 -- (-968.545) [-971.697] (-967.101) (-967.213) * [-969.315] (-968.087) (-968.180) (-967.163) -- 0:00:18
Average standard deviation of split frequencies: 0.007251
695500 -- (-968.548) (-972.554) (-967.173) [-970.367] * (-967.199) [-966.874] (-968.834) (-968.191) -- 0:00:18
696000 -- (-968.683) (-970.390) (-966.974) [-968.049] * [-969.238] (-969.625) (-966.720) (-970.013) -- 0:00:18
696500 -- [-967.833] (-967.138) (-966.757) (-967.768) * (-969.518) (-968.352) (-966.190) [-966.576] -- 0:00:18
697000 -- (-968.188) [-968.723] (-968.188) (-966.322) * (-969.712) (-967.359) (-967.066) [-966.661] -- 0:00:18
697500 -- (-968.654) (-967.139) (-967.578) [-967.703] * (-971.850) (-971.496) [-970.489] (-967.811) -- 0:00:18
698000 -- (-968.752) (-970.211) (-967.230) [-967.703] * (-969.378) [-965.876] (-969.427) (-968.641) -- 0:00:18
698500 -- (-967.322) (-967.116) (-968.564) [-970.583] * (-969.079) (-965.751) (-966.247) [-968.373] -- 0:00:18
699000 -- (-966.540) [-966.934] (-966.603) (-971.471) * [-969.157] (-966.288) (-967.555) (-966.897) -- 0:00:18
699500 -- (-966.506) (-967.871) (-966.534) [-966.553] * [-968.569] (-966.415) (-966.854) (-969.889) -- 0:00:18
700000 -- (-970.746) [-966.741] (-966.660) (-968.176) * [-966.813] (-967.720) (-969.715) (-966.859) -- 0:00:18
Average standard deviation of split frequencies: 0.007569
700500 -- (-968.725) (-966.498) [-966.567] (-966.639) * (-966.706) (-966.811) (-966.672) [-966.879] -- 0:00:18
701000 -- (-969.534) (-966.640) [-967.270] (-966.367) * (-970.120) (-966.692) [-969.774] (-966.282) -- 0:00:18
701500 -- (-966.510) [-968.103] (-968.077) (-965.581) * (-972.537) (-966.326) (-967.402) [-967.184] -- 0:00:18
702000 -- (-969.937) (-968.679) (-974.117) [-965.807] * [-969.993] (-966.780) (-966.784) (-971.924) -- 0:00:18
702500 -- (-968.552) (-970.446) (-967.243) [-968.855] * [-967.493] (-966.119) (-968.987) (-967.446) -- 0:00:18
703000 -- (-966.090) [-967.227] (-966.157) (-966.258) * (-966.874) [-966.437] (-970.460) (-973.739) -- 0:00:18
703500 -- (-966.342) (-966.702) (-967.009) [-968.881] * (-966.918) (-966.992) [-968.133] (-967.903) -- 0:00:18
704000 -- (-971.017) (-969.516) [-970.049] (-970.787) * (-967.833) (-969.442) (-967.830) [-967.788] -- 0:00:18
704500 -- (-968.718) (-966.998) (-966.564) [-967.432] * (-967.771) (-970.371) (-966.741) [-969.126] -- 0:00:18
705000 -- [-968.413] (-974.586) (-966.523) (-971.290) * (-969.542) (-968.794) (-969.334) [-967.861] -- 0:00:18
Average standard deviation of split frequencies: 0.007679
705500 -- (-967.370) (-973.938) (-968.061) [-967.567] * [-968.739] (-975.748) (-967.344) (-967.969) -- 0:00:18
706000 -- [-965.896] (-967.927) (-968.384) (-966.603) * [-969.674] (-969.317) (-968.576) (-969.469) -- 0:00:18
706500 -- (-969.918) (-970.468) [-967.226] (-968.004) * (-973.281) (-968.717) [-968.215] (-966.396) -- 0:00:18
707000 -- [-966.851] (-972.615) (-969.236) (-967.959) * [-972.522] (-969.080) (-966.320) (-966.238) -- 0:00:18
707500 -- [-966.868] (-969.392) (-969.851) (-966.006) * (-967.848) [-969.762] (-967.212) (-967.521) -- 0:00:18
708000 -- (-968.228) (-968.697) [-969.166] (-968.507) * [-967.653] (-967.185) (-968.008) (-970.124) -- 0:00:18
708500 -- (-967.278) (-968.276) (-968.194) [-967.622] * (-966.950) (-967.955) [-966.719] (-967.602) -- 0:00:18
709000 -- (-971.673) [-968.028] (-970.982) (-967.733) * [-967.165] (-968.754) (-968.509) (-967.602) -- 0:00:18
709500 -- (-969.941) (-968.776) (-968.318) [-966.941] * (-967.738) (-969.443) [-965.797] (-968.464) -- 0:00:18
710000 -- (-966.894) (-968.453) [-967.476] (-965.761) * [-969.691] (-970.592) (-966.644) (-969.240) -- 0:00:17
Average standard deviation of split frequencies: 0.007338
710500 -- (-966.496) [-968.578] (-968.027) (-966.047) * (-968.593) (-966.778) (-968.696) [-966.776] -- 0:00:17
711000 -- (-967.797) [-966.691] (-970.555) (-966.870) * [-968.367] (-966.421) (-967.927) (-967.637) -- 0:00:17
711500 -- [-967.641] (-966.682) (-969.121) (-967.261) * (-968.647) (-970.366) (-970.045) [-966.030] -- 0:00:17
712000 -- (-967.995) (-967.455) [-966.198] (-966.391) * (-965.725) (-966.849) [-967.881] (-970.018) -- 0:00:17
712500 -- (-966.732) (-972.905) [-967.384] (-966.089) * (-965.763) [-966.531] (-968.015) (-969.771) -- 0:00:17
713000 -- (-967.662) [-966.701] (-970.252) (-966.953) * (-966.139) [-968.648] (-968.916) (-970.110) -- 0:00:17
713500 -- (-966.177) (-971.467) (-967.786) [-966.374] * [-966.152] (-968.430) (-968.713) (-969.160) -- 0:00:17
714000 -- [-966.607] (-972.864) (-966.931) (-965.732) * [-969.546] (-968.827) (-967.745) (-968.037) -- 0:00:17
714500 -- (-965.829) [-973.859] (-968.822) (-966.132) * (-969.578) (-966.115) [-966.790] (-967.299) -- 0:00:17
715000 -- (-966.034) (-968.710) (-970.814) [-965.818] * (-966.615) (-966.686) (-967.163) [-970.231] -- 0:00:17
Average standard deviation of split frequencies: 0.007366
715500 -- (-970.378) [-965.644] (-967.126) (-967.134) * (-968.072) (-966.575) (-967.730) [-970.438] -- 0:00:17
716000 -- (-965.816) (-966.969) [-967.761] (-968.583) * (-968.991) (-966.584) (-966.987) [-967.992] -- 0:00:17
716500 -- (-966.935) (-968.721) [-968.394] (-966.846) * [-975.447] (-967.243) (-966.759) (-967.862) -- 0:00:17
717000 -- (-970.273) [-968.983] (-969.884) (-967.758) * (-970.458) (-968.315) (-969.262) [-967.723] -- 0:00:17
717500 -- (-974.614) [-966.965] (-968.385) (-971.751) * [-970.965] (-971.888) (-968.488) (-966.549) -- 0:00:17
718000 -- (-969.975) (-966.617) (-970.771) [-972.142] * (-967.427) (-967.353) [-968.261] (-967.853) -- 0:00:17
718500 -- (-967.635) [-967.353] (-969.810) (-970.642) * (-967.225) [-967.970] (-967.892) (-967.599) -- 0:00:17
719000 -- (-970.096) (-965.972) (-970.997) [-967.063] * (-967.879) (-968.424) [-966.754] (-966.781) -- 0:00:17
719500 -- (-966.685) (-969.402) [-969.086] (-967.750) * (-970.680) (-968.355) [-968.977] (-966.975) -- 0:00:17
720000 -- [-967.564] (-969.552) (-966.457) (-969.527) * (-966.108) (-966.561) (-967.212) [-966.858] -- 0:00:17
Average standard deviation of split frequencies: 0.007400
720500 -- (-969.703) (-969.854) [-965.810] (-968.743) * [-966.633] (-970.239) (-967.196) (-969.146) -- 0:00:17
721000 -- [-974.129] (-969.087) (-968.500) (-966.322) * [-967.066] (-966.523) (-970.473) (-966.742) -- 0:00:17
721500 -- (-967.074) (-967.863) (-968.588) [-966.931] * (-967.067) (-967.629) [-970.747] (-967.010) -- 0:00:17
722000 -- (-969.162) (-966.049) [-967.600] (-971.306) * (-967.491) (-969.069) (-971.880) [-966.393] -- 0:00:17
722500 -- (-966.804) [-968.910] (-969.087) (-969.379) * [-971.377] (-968.273) (-970.238) (-966.870) -- 0:00:17
723000 -- (-967.998) (-967.322) [-966.621] (-967.878) * (-969.209) (-967.982) (-971.843) [-966.484] -- 0:00:17
723500 -- (-967.793) [-965.952] (-968.204) (-970.628) * (-967.186) [-966.893] (-967.802) (-966.883) -- 0:00:17
724000 -- (-968.472) (-966.514) [-969.484] (-966.815) * (-967.807) (-968.452) (-966.656) [-966.471] -- 0:00:17
724500 -- (-968.082) (-967.303) [-969.131] (-967.659) * (-967.821) [-967.486] (-971.798) (-971.768) -- 0:00:17
725000 -- (-966.987) [-966.682] (-967.343) (-966.161) * (-968.751) [-966.725] (-967.343) (-967.999) -- 0:00:17
Average standard deviation of split frequencies: 0.007021
725500 -- [-966.964] (-968.487) (-965.751) (-966.582) * [-967.513] (-966.787) (-968.120) (-967.270) -- 0:00:17
726000 -- (-967.263) [-969.424] (-965.973) (-967.961) * [-967.492] (-968.115) (-968.542) (-966.557) -- 0:00:16
726500 -- (-972.568) (-965.797) (-966.927) [-966.630] * (-968.983) [-965.911] (-966.484) (-968.374) -- 0:00:16
727000 -- (-966.159) (-966.178) (-967.746) [-969.897] * (-970.648) [-967.438] (-966.173) (-967.091) -- 0:00:16
727500 -- (-967.125) [-966.251] (-967.860) (-970.898) * [-969.892] (-968.771) (-966.288) (-969.462) -- 0:00:16
728000 -- (-967.868) (-968.465) [-965.586] (-968.098) * [-968.696] (-970.069) (-970.247) (-970.584) -- 0:00:16
728500 -- (-968.042) [-967.615] (-967.472) (-971.259) * [-968.005] (-967.284) (-966.891) (-967.053) -- 0:00:16
729000 -- [-969.472] (-968.165) (-967.723) (-973.281) * (-967.392) (-968.866) [-967.699] (-967.227) -- 0:00:16
729500 -- (-967.132) [-968.595] (-968.088) (-968.685) * (-968.419) (-969.380) (-967.843) [-970.000] -- 0:00:16
730000 -- (-969.054) [-967.024] (-970.199) (-967.159) * (-971.492) (-969.808) [-966.753] (-971.160) -- 0:00:16
Average standard deviation of split frequencies: 0.006976
730500 -- (-967.640) [-968.206] (-972.662) (-969.450) * [-967.507] (-966.725) (-969.658) (-966.561) -- 0:00:16
731000 -- (-968.418) (-966.331) [-970.115] (-969.781) * [-968.831] (-966.623) (-969.157) (-967.063) -- 0:00:16
731500 -- (-966.360) (-967.124) (-968.369) [-966.546] * (-968.319) (-965.989) (-968.337) [-972.966] -- 0:00:16
732000 -- (-967.546) [-967.962] (-966.312) (-968.556) * [-966.210] (-965.909) (-968.808) (-969.551) -- 0:00:16
732500 -- (-967.041) [-969.867] (-967.007) (-967.243) * (-966.499) [-967.920] (-967.993) (-970.278) -- 0:00:16
733000 -- (-966.333) [-966.354] (-967.083) (-969.378) * (-970.778) (-967.915) (-969.200) [-966.902] -- 0:00:16
733500 -- [-966.686] (-966.221) (-970.454) (-970.307) * (-968.173) [-966.060] (-968.374) (-970.952) -- 0:00:16
734000 -- (-966.689) (-966.819) [-967.718] (-967.045) * (-970.523) (-968.492) (-967.369) [-969.710] -- 0:00:16
734500 -- [-967.578] (-967.487) (-968.533) (-969.185) * (-970.175) [-971.166] (-966.808) (-970.523) -- 0:00:16
735000 -- (-966.986) [-966.441] (-967.463) (-968.922) * [-967.411] (-970.773) (-968.383) (-969.243) -- 0:00:16
Average standard deviation of split frequencies: 0.006805
735500 -- (-968.378) (-966.252) (-968.337) [-966.142] * [-966.812] (-967.392) (-968.668) (-969.690) -- 0:00:16
736000 -- (-966.868) (-968.403) (-968.462) [-966.555] * (-966.347) (-966.985) [-967.167] (-972.129) -- 0:00:16
736500 -- (-966.245) [-967.352] (-970.686) (-968.827) * (-969.599) [-969.730] (-966.634) (-967.986) -- 0:00:16
737000 -- (-966.288) [-972.250] (-968.343) (-969.295) * (-968.717) (-968.151) (-967.010) [-970.096] -- 0:00:16
737500 -- (-968.133) [-968.845] (-973.195) (-969.268) * (-966.313) (-966.420) [-969.283] (-969.330) -- 0:00:16
738000 -- [-966.467] (-966.804) (-970.955) (-970.166) * (-968.131) (-970.866) [-968.501] (-969.936) -- 0:00:16
738500 -- (-969.142) [-969.159] (-970.416) (-968.191) * (-970.879) (-972.135) (-967.212) [-968.042] -- 0:00:16
739000 -- [-967.299] (-967.154) (-973.109) (-966.236) * [-966.882] (-968.950) (-968.302) (-966.209) -- 0:00:16
739500 -- (-967.027) (-966.913) (-970.089) [-965.763] * (-969.143) (-969.425) (-965.958) [-966.313] -- 0:00:16
740000 -- (-966.294) [-968.314] (-971.376) (-968.350) * (-966.991) (-966.926) (-967.401) [-970.269] -- 0:00:16
Average standard deviation of split frequencies: 0.006484
740500 -- (-967.440) (-971.160) [-967.658] (-967.160) * (-967.298) [-967.329] (-972.508) (-967.064) -- 0:00:16
741000 -- (-966.232) [-972.696] (-968.445) (-966.677) * [-968.109] (-967.434) (-968.563) (-967.552) -- 0:00:16
741500 -- [-966.381] (-972.591) (-969.523) (-966.846) * [-967.256] (-969.291) (-975.038) (-968.573) -- 0:00:16
742000 -- (-967.971) (-972.162) [-966.618] (-966.349) * (-968.078) (-969.706) [-967.799] (-967.391) -- 0:00:15
742500 -- (-965.855) (-972.396) [-966.685] (-966.146) * (-966.606) (-971.484) (-967.570) [-968.297] -- 0:00:15
743000 -- (-969.520) [-969.642] (-968.654) (-966.369) * (-968.310) (-966.521) [-969.545] (-966.600) -- 0:00:15
743500 -- [-967.436] (-969.576) (-966.742) (-966.149) * (-966.444) (-966.656) (-969.207) [-966.159] -- 0:00:15
744000 -- (-970.334) (-968.051) (-967.854) [-969.624] * (-966.245) (-965.969) (-969.952) [-967.970] -- 0:00:15
744500 -- [-966.225] (-966.723) (-969.276) (-968.071) * (-966.245) (-971.333) (-969.684) [-970.972] -- 0:00:15
745000 -- (-967.322) [-966.600] (-968.566) (-970.851) * (-966.170) (-970.190) [-972.472] (-967.623) -- 0:00:15
Average standard deviation of split frequencies: 0.006793
745500 -- [-966.237] (-969.449) (-969.088) (-967.262) * [-968.778] (-967.335) (-969.750) (-967.314) -- 0:00:15
746000 -- [-965.482] (-968.601) (-967.657) (-967.168) * (-969.363) (-968.874) [-966.775] (-967.269) -- 0:00:15
746500 -- (-972.401) [-966.050] (-966.905) (-967.650) * (-968.777) [-969.168] (-965.861) (-967.921) -- 0:00:15
747000 -- [-968.264] (-966.020) (-968.532) (-972.418) * [-967.804] (-967.306) (-966.498) (-966.666) -- 0:00:15
747500 -- (-966.958) (-966.528) (-966.334) [-968.502] * (-968.150) [-970.619] (-967.835) (-966.204) -- 0:00:15
748000 -- (-966.867) [-968.971] (-966.444) (-967.154) * (-968.017) (-966.744) (-970.869) [-967.984] -- 0:00:15
748500 -- (-967.063) [-971.687] (-967.244) (-967.511) * (-968.736) (-966.238) [-966.878] (-967.271) -- 0:00:15
749000 -- (-966.902) [-968.110] (-967.361) (-969.548) * [-966.236] (-969.859) (-968.689) (-967.090) -- 0:00:15
749500 -- (-967.469) (-966.531) (-967.968) [-966.733] * (-966.603) (-969.075) (-972.167) [-966.919] -- 0:00:15
750000 -- (-968.765) [-966.383] (-968.062) (-968.904) * (-974.123) [-967.133] (-972.362) (-966.427) -- 0:00:15
Average standard deviation of split frequencies: 0.006712
750500 -- [-966.847] (-970.155) (-967.770) (-969.029) * (-971.861) (-968.132) [-970.008] (-966.717) -- 0:00:15
751000 -- [-966.371] (-967.548) (-969.144) (-967.033) * (-969.660) [-967.714] (-968.311) (-966.475) -- 0:00:15
751500 -- (-968.785) (-967.405) (-967.094) [-971.267] * (-967.721) (-967.283) [-967.169] (-970.859) -- 0:00:15
752000 -- (-966.700) [-967.658] (-970.217) (-974.574) * [-967.843] (-968.842) (-968.148) (-968.700) -- 0:00:15
752500 -- (-966.331) (-966.905) (-969.385) [-967.778] * (-971.206) (-971.218) [-969.689] (-966.201) -- 0:00:15
753000 -- (-966.935) (-966.352) (-969.802) [-968.758] * (-966.869) (-972.342) [-968.225] (-967.349) -- 0:00:15
753500 -- (-968.259) (-966.265) [-965.974] (-966.057) * [-966.924] (-967.000) (-969.555) (-969.379) -- 0:00:15
754000 -- (-965.968) (-967.031) [-966.088] (-967.975) * (-967.659) (-967.505) [-966.560] (-970.257) -- 0:00:15
754500 -- (-966.105) (-968.093) [-968.651] (-971.223) * (-965.989) (-970.449) (-967.198) [-967.230] -- 0:00:15
755000 -- (-966.990) [-969.473] (-966.526) (-966.712) * (-972.563) [-966.800] (-972.749) (-972.342) -- 0:00:15
Average standard deviation of split frequencies: 0.006508
755500 -- (-967.339) (-969.314) [-966.373] (-966.475) * [-969.969] (-966.658) (-971.804) (-969.894) -- 0:00:15
756000 -- [-967.221] (-967.451) (-967.157) (-967.732) * [-970.407] (-969.291) (-968.377) (-967.060) -- 0:00:15
756500 -- (-970.248) (-969.082) [-967.557] (-968.366) * (-968.383) (-972.768) (-966.612) [-966.896] -- 0:00:15
757000 -- (-965.857) (-972.887) (-968.219) [-970.971] * (-970.390) (-968.424) [-969.480] (-965.952) -- 0:00:15
757500 -- [-966.631] (-968.548) (-967.124) (-966.385) * [-968.454] (-968.607) (-969.447) (-966.524) -- 0:00:15
758000 -- (-967.710) [-968.124] (-969.789) (-968.150) * [-967.517] (-969.211) (-968.895) (-967.964) -- 0:00:15
758500 -- [-966.966] (-966.464) (-968.770) (-966.956) * (-971.335) [-967.381] (-967.542) (-967.882) -- 0:00:14
759000 -- (-968.733) (-967.574) (-968.007) [-967.756] * (-972.169) (-966.000) (-968.562) [-966.059] -- 0:00:14
759500 -- (-968.504) (-967.107) (-968.935) [-973.437] * (-969.692) (-966.151) [-967.474] (-967.531) -- 0:00:14
760000 -- [-966.667] (-968.548) (-967.683) (-970.710) * (-971.130) (-965.888) (-967.946) [-967.161] -- 0:00:14
Average standard deviation of split frequencies: 0.005810
760500 -- (-967.403) (-966.552) (-968.131) [-965.962] * (-973.865) (-967.894) (-965.966) [-966.716] -- 0:00:14
761000 -- (-969.412) (-971.013) (-966.084) [-966.106] * (-970.648) (-968.749) [-967.265] (-966.096) -- 0:00:14
761500 -- (-965.668) (-969.768) [-967.407] (-970.661) * (-970.380) [-968.125] (-967.546) (-967.066) -- 0:00:14
762000 -- (-969.138) (-967.953) (-966.124) [-967.283] * (-969.950) (-966.567) (-965.912) [-971.334] -- 0:00:14
762500 -- (-969.579) [-967.596] (-967.229) (-966.649) * (-967.744) [-966.336] (-967.470) (-967.090) -- 0:00:14
763000 -- (-965.620) (-968.688) [-968.578] (-970.843) * [-966.141] (-966.793) (-966.492) (-967.419) -- 0:00:14
763500 -- (-966.271) [-966.748] (-968.469) (-967.029) * (-966.193) (-969.283) (-966.232) [-970.713] -- 0:00:14
764000 -- (-966.690) [-966.441] (-966.798) (-970.098) * (-973.002) (-969.273) [-968.121] (-970.577) -- 0:00:14
764500 -- (-968.265) (-966.522) (-967.579) [-967.570] * (-966.880) (-967.997) (-967.931) [-969.387] -- 0:00:14
765000 -- (-969.970) [-967.650] (-966.746) (-968.344) * (-969.086) (-968.756) [-968.283] (-969.276) -- 0:00:14
Average standard deviation of split frequencies: 0.006000
765500 -- (-967.189) (-974.606) [-968.233] (-967.143) * (-971.801) (-968.352) (-968.570) [-966.640] -- 0:00:14
766000 -- (-966.979) (-972.482) [-969.112] (-970.784) * (-968.875) (-965.786) (-969.693) [-968.222] -- 0:00:14
766500 -- (-967.791) (-967.068) [-969.146] (-966.880) * (-966.776) (-967.382) [-968.088] (-970.065) -- 0:00:14
767000 -- [-968.458] (-972.777) (-968.670) (-966.836) * (-966.732) [-966.079] (-965.830) (-970.798) -- 0:00:14
767500 -- (-970.018) (-966.452) [-969.583] (-969.616) * (-969.387) (-969.177) [-966.101] (-966.300) -- 0:00:14
768000 -- [-967.087] (-966.494) (-969.257) (-966.776) * (-968.474) [-967.707] (-971.282) (-967.031) -- 0:00:14
768500 -- [-967.016] (-973.678) (-967.667) (-966.049) * [-968.077] (-968.700) (-976.634) (-966.725) -- 0:00:14
769000 -- (-966.515) (-968.359) [-968.333] (-971.842) * (-968.869) (-966.645) (-969.079) [-968.042] -- 0:00:14
769500 -- (-967.423) (-969.824) (-967.991) [-971.707] * (-971.506) (-966.740) (-970.923) [-966.535] -- 0:00:14
770000 -- (-967.324) (-969.576) [-968.504] (-967.456) * [-968.268] (-967.678) (-968.689) (-966.351) -- 0:00:14
Average standard deviation of split frequencies: 0.006384
770500 -- (-968.513) [-967.777] (-969.906) (-966.685) * (-966.232) (-971.116) [-969.394] (-967.139) -- 0:00:14
771000 -- (-966.439) (-966.490) (-967.149) [-966.366] * (-965.875) (-968.920) [-966.785] (-967.994) -- 0:00:14
771500 -- (-967.770) [-968.854] (-966.539) (-968.033) * [-966.013] (-969.120) (-965.760) (-969.466) -- 0:00:14
772000 -- [-968.783] (-970.968) (-967.314) (-967.752) * (-968.346) (-969.898) [-968.089] (-969.600) -- 0:00:14
772500 -- (-969.575) (-966.631) (-968.046) [-967.918] * (-973.278) (-969.557) [-965.915] (-966.541) -- 0:00:14
773000 -- [-967.001] (-966.940) (-966.210) (-968.311) * (-966.981) [-968.523] (-967.556) (-966.752) -- 0:00:14
773500 -- (-967.000) (-967.499) [-966.663] (-968.184) * (-970.582) (-965.962) (-967.051) [-968.839] -- 0:00:14
774000 -- [-968.490] (-968.251) (-968.625) (-967.434) * [-966.331] (-968.285) (-972.623) (-968.803) -- 0:00:14
774500 -- (-969.559) [-969.370] (-965.670) (-966.483) * [-967.284] (-967.813) (-968.831) (-971.406) -- 0:00:13
775000 -- (-971.677) (-971.353) [-966.970] (-967.019) * (-966.948) (-975.876) (-966.284) [-965.978] -- 0:00:13
Average standard deviation of split frequencies: 0.006189
775500 -- [-972.610] (-970.045) (-965.941) (-968.158) * [-966.852] (-968.708) (-966.259) (-968.792) -- 0:00:13
776000 -- [-967.052] (-967.644) (-967.201) (-969.017) * (-968.851) (-972.756) [-966.608] (-967.404) -- 0:00:13
776500 -- [-967.698] (-965.848) (-967.740) (-968.699) * [-967.428] (-969.652) (-966.405) (-968.234) -- 0:00:13
777000 -- (-967.757) (-966.214) [-969.674] (-969.722) * (-971.822) (-970.463) (-973.863) [-967.592] -- 0:00:13
777500 -- (-968.116) (-967.460) (-971.617) [-967.582] * (-967.652) (-972.813) [-971.586] (-966.847) -- 0:00:13
778000 -- (-968.330) (-968.989) [-967.334] (-966.913) * (-966.702) (-967.622) (-972.203) [-966.995] -- 0:00:13
778500 -- [-968.908] (-969.865) (-968.288) (-966.708) * [-968.282] (-968.644) (-969.447) (-966.875) -- 0:00:13
779000 -- [-966.508] (-977.106) (-966.791) (-970.551) * (-966.621) [-967.762] (-970.423) (-967.350) -- 0:00:13
779500 -- (-968.783) (-974.796) [-969.471] (-972.229) * (-967.907) [-970.439] (-967.459) (-970.421) -- 0:00:13
780000 -- (-966.871) (-972.308) (-969.228) [-973.085] * (-968.502) (-966.913) (-966.183) [-968.428] -- 0:00:13
Average standard deviation of split frequencies: 0.006114
780500 -- (-967.624) [-968.920] (-966.342) (-970.544) * [-968.478] (-966.493) (-966.813) (-967.361) -- 0:00:13
781000 -- (-967.186) (-972.432) [-966.738] (-966.447) * [-968.589] (-969.395) (-965.923) (-967.666) -- 0:00:13
781500 -- (-967.589) (-966.632) [-966.711] (-969.897) * [-966.279] (-969.281) (-966.571) (-972.623) -- 0:00:13
782000 -- (-966.725) [-969.688] (-966.056) (-969.250) * (-966.866) (-967.715) [-967.192] (-969.060) -- 0:00:13
782500 -- (-966.771) (-968.564) (-971.995) [-968.421] * [-970.051] (-969.446) (-969.161) (-968.494) -- 0:00:13
783000 -- (-971.049) [-967.232] (-970.577) (-969.771) * (-968.466) (-969.762) (-968.522) [-969.103] -- 0:00:13
783500 -- (-968.362) (-969.034) [-967.314] (-972.448) * (-971.033) [-969.735] (-966.488) (-970.425) -- 0:00:13
784000 -- (-967.220) (-966.636) [-966.339] (-968.777) * (-968.970) (-967.761) [-966.732] (-966.918) -- 0:00:13
784500 -- (-967.929) (-969.071) [-966.499] (-967.347) * (-969.239) (-970.577) (-975.477) [-969.653] -- 0:00:13
785000 -- (-966.500) [-968.387] (-971.498) (-965.957) * (-967.393) (-972.100) [-968.859] (-968.306) -- 0:00:13
Average standard deviation of split frequencies: 0.005960
785500 -- [-967.497] (-967.155) (-969.959) (-965.834) * [-965.745] (-970.587) (-968.433) (-965.976) -- 0:00:13
786000 -- [-966.313] (-968.751) (-968.577) (-967.923) * (-965.912) (-967.025) (-969.598) [-966.970] -- 0:00:13
786500 -- (-966.458) [-971.067] (-967.708) (-966.084) * (-970.212) [-966.908] (-967.861) (-967.366) -- 0:00:13
787000 -- (-967.063) (-970.698) [-967.056] (-966.801) * (-967.873) (-971.758) [-966.053] (-966.888) -- 0:00:13
787500 -- (-967.321) (-966.821) (-966.644) [-967.456] * [-969.781] (-969.959) (-966.275) (-967.109) -- 0:00:13
788000 -- [-967.043] (-967.404) (-966.821) (-968.103) * [-970.153] (-966.560) (-967.262) (-966.811) -- 0:00:13
788500 -- (-967.121) [-970.048] (-967.748) (-970.912) * [-967.437] (-968.932) (-971.582) (-965.623) -- 0:00:13
789000 -- (-967.777) [-968.458] (-969.007) (-972.428) * [-967.017] (-966.802) (-966.358) (-967.804) -- 0:00:13
789500 -- (-970.312) (-968.411) [-968.352] (-972.364) * (-969.894) (-973.893) [-967.207] (-966.553) -- 0:00:13
790000 -- (-968.156) (-967.641) (-966.970) [-972.366] * (-967.390) (-972.879) (-966.222) [-969.709] -- 0:00:13
Average standard deviation of split frequencies: 0.006223
790500 -- (-965.895) (-966.780) [-966.335] (-974.465) * (-966.562) [-967.119] (-966.154) (-968.855) -- 0:00:12
791000 -- (-965.906) [-965.930] (-968.626) (-969.972) * (-967.670) (-965.608) (-968.630) [-968.562] -- 0:00:12
791500 -- (-970.239) (-967.466) (-965.765) [-965.717] * (-968.181) (-968.995) (-969.518) [-966.765] -- 0:00:12
792000 -- [-968.581] (-966.754) (-968.604) (-973.497) * [-968.489] (-966.841) (-966.257) (-970.542) -- 0:00:12
792500 -- (-972.435) [-967.524] (-972.667) (-966.772) * (-966.730) (-966.902) (-966.316) [-968.905] -- 0:00:12
793000 -- (-966.992) [-969.465] (-970.331) (-966.366) * [-966.437] (-965.748) (-969.572) (-968.240) -- 0:00:12
793500 -- (-967.355) [-967.631] (-968.443) (-969.393) * [-968.121] (-966.111) (-967.081) (-967.227) -- 0:00:12
794000 -- (-966.688) (-967.936) (-969.010) [-966.502] * [-970.694] (-967.331) (-966.787) (-968.904) -- 0:00:12
794500 -- [-967.602] (-966.162) (-968.609) (-968.014) * (-966.010) [-969.105] (-967.600) (-974.933) -- 0:00:12
795000 -- (-967.922) (-967.618) [-965.839] (-969.854) * [-966.079] (-968.305) (-969.116) (-972.845) -- 0:00:12
Average standard deviation of split frequencies: 0.006366
795500 -- (-972.093) [-967.146] (-966.741) (-969.810) * (-969.305) (-968.466) (-968.796) [-968.514] -- 0:00:12
796000 -- [-967.531] (-970.778) (-967.583) (-970.792) * [-966.545] (-969.331) (-967.731) (-966.830) -- 0:00:12
796500 -- [-969.167] (-967.472) (-969.941) (-971.444) * (-968.462) (-965.563) [-968.713] (-968.671) -- 0:00:12
797000 -- (-970.354) [-969.212] (-966.172) (-971.662) * (-968.839) (-970.710) [-969.066] (-967.454) -- 0:00:12
797500 -- (-966.641) [-967.067] (-966.165) (-968.847) * (-967.555) [-968.979] (-969.076) (-970.466) -- 0:00:12
798000 -- [-969.642] (-966.233) (-965.880) (-968.279) * (-968.772) [-968.106] (-968.042) (-967.477) -- 0:00:12
798500 -- (-968.264) [-967.507] (-969.876) (-966.817) * [-966.549] (-968.422) (-967.016) (-971.382) -- 0:00:12
799000 -- (-966.288) [-970.524] (-967.048) (-967.986) * (-969.858) [-966.561] (-969.071) (-970.422) -- 0:00:12
799500 -- (-967.860) (-967.196) [-966.662] (-969.159) * (-970.486) [-968.473] (-968.469) (-971.315) -- 0:00:12
800000 -- [-970.030] (-966.358) (-965.977) (-967.031) * (-968.514) (-968.852) (-971.059) [-966.331] -- 0:00:12
Average standard deviation of split frequencies: 0.006660
800500 -- [-967.656] (-965.877) (-966.801) (-968.642) * [-967.870] (-966.368) (-968.139) (-967.230) -- 0:00:12
801000 -- [-966.237] (-966.907) (-967.006) (-969.217) * (-966.084) (-966.769) [-969.432] (-968.623) -- 0:00:12
801500 -- (-967.899) (-965.901) [-969.908] (-972.044) * (-967.459) (-966.224) (-968.105) [-968.521] -- 0:00:12
802000 -- [-966.011] (-971.818) (-969.497) (-969.439) * (-971.539) (-973.665) (-968.035) [-967.759] -- 0:00:12
802500 -- (-970.916) (-967.109) (-968.427) [-967.217] * (-967.044) (-968.231) [-965.909] (-973.786) -- 0:00:12
803000 -- (-967.209) (-967.150) [-968.091] (-966.913) * (-968.293) (-968.481) [-966.884] (-968.952) -- 0:00:12
803500 -- (-966.810) [-972.762] (-970.333) (-971.935) * [-970.183] (-966.788) (-968.416) (-967.556) -- 0:00:12
804000 -- (-968.130) (-968.496) [-969.266] (-967.378) * (-968.864) (-966.883) (-968.345) [-967.052] -- 0:00:12
804500 -- (-968.228) (-967.701) [-970.217] (-971.062) * (-966.804) (-966.838) [-965.687] (-969.616) -- 0:00:12
805000 -- (-965.538) (-967.136) [-969.581] (-970.534) * (-967.180) (-968.200) [-968.065] (-969.275) -- 0:00:12
Average standard deviation of split frequencies: 0.006726
805500 -- (-967.704) (-966.541) (-970.989) [-967.508] * (-966.896) [-967.101] (-967.581) (-966.617) -- 0:00:12
806000 -- (-966.744) [-966.482] (-968.371) (-966.280) * (-966.167) [-968.345] (-967.694) (-969.336) -- 0:00:12
806500 -- (-967.021) [-970.974] (-968.686) (-967.315) * (-967.644) (-970.896) (-967.084) [-970.618] -- 0:00:11
807000 -- (-972.131) (-972.100) [-967.658] (-967.048) * (-968.221) [-971.349] (-966.809) (-971.868) -- 0:00:11
807500 -- [-969.023] (-969.253) (-966.743) (-967.165) * [-969.183] (-969.858) (-967.611) (-971.846) -- 0:00:11
808000 -- (-970.564) [-968.455] (-967.522) (-970.499) * (-967.058) (-966.019) (-968.435) [-966.878] -- 0:00:11
808500 -- (-968.301) (-968.487) (-969.564) [-966.542] * (-971.350) (-967.570) (-968.365) [-969.138] -- 0:00:11
809000 -- (-968.389) (-970.575) (-968.273) [-967.265] * (-969.490) (-967.360) (-976.711) [-970.097] -- 0:00:11
809500 -- (-970.222) (-967.200) (-966.946) [-966.750] * (-969.641) (-966.986) (-969.219) [-967.184] -- 0:00:11
810000 -- (-969.536) (-968.175) [-968.194] (-970.468) * (-970.737) [-967.304] (-968.513) (-967.922) -- 0:00:11
Average standard deviation of split frequencies: 0.006687
810500 -- (-969.474) (-967.440) (-967.199) [-968.286] * [-972.301] (-967.984) (-966.478) (-970.253) -- 0:00:11
811000 -- [-967.476] (-967.657) (-968.597) (-967.860) * [-970.929] (-968.607) (-967.834) (-966.469) -- 0:00:11
811500 -- [-965.980] (-968.247) (-971.599) (-968.178) * [-967.103] (-967.647) (-967.541) (-969.622) -- 0:00:11
812000 -- (-969.908) (-967.344) [-974.130] (-969.210) * (-966.310) (-969.592) [-968.392] (-969.313) -- 0:00:11
812500 -- (-966.911) (-965.873) [-967.180] (-970.693) * (-966.159) (-972.436) (-968.967) [-969.206] -- 0:00:11
813000 -- (-972.789) [-968.003] (-967.299) (-968.522) * (-966.642) (-968.485) [-967.562] (-968.576) -- 0:00:11
813500 -- [-969.901] (-967.865) (-966.221) (-968.966) * (-970.132) (-968.562) (-967.934) [-968.967] -- 0:00:11
814000 -- (-965.714) (-971.183) (-966.133) [-966.989] * (-974.367) [-969.477] (-966.966) (-968.104) -- 0:00:11
814500 -- [-965.714] (-970.953) (-966.218) (-966.065) * (-971.502) [-967.975] (-967.207) (-966.638) -- 0:00:11
815000 -- [-967.856] (-967.850) (-966.281) (-966.164) * (-969.228) (-968.313) [-966.687] (-969.514) -- 0:00:11
Average standard deviation of split frequencies: 0.007041
815500 -- (-968.508) [-967.834] (-967.080) (-966.996) * (-969.368) (-967.360) (-967.777) [-966.389] -- 0:00:11
816000 -- (-968.652) [-971.800] (-967.461) (-967.320) * [-973.370] (-975.123) (-967.929) (-967.303) -- 0:00:11
816500 -- (-967.361) [-968.493] (-967.577) (-967.075) * (-969.409) (-969.854) [-968.194] (-967.203) -- 0:00:11
817000 -- (-972.729) [-967.025] (-970.151) (-967.218) * (-968.599) (-966.620) (-968.877) [-966.937] -- 0:00:11
817500 -- (-968.907) (-969.200) [-967.550] (-968.235) * (-967.614) (-970.423) [-966.967] (-967.240) -- 0:00:11
818000 -- (-969.434) (-968.529) [-969.192] (-969.351) * (-967.640) (-968.223) [-966.944] (-966.600) -- 0:00:11
818500 -- [-966.500] (-968.299) (-967.418) (-967.582) * [-966.467] (-968.201) (-966.410) (-967.945) -- 0:00:11
819000 -- [-969.244] (-966.143) (-966.787) (-968.112) * (-968.572) (-969.021) (-968.735) [-969.077] -- 0:00:11
819500 -- (-967.425) (-968.449) [-966.529] (-968.938) * (-968.750) (-966.454) (-968.218) [-966.908] -- 0:00:11
820000 -- [-967.333] (-970.730) (-968.211) (-971.642) * (-967.511) (-971.159) [-966.677] (-968.964) -- 0:00:11
Average standard deviation of split frequencies: 0.006965
820500 -- (-969.515) (-966.138) [-966.562] (-967.780) * (-967.324) (-970.195) [-970.000] (-967.560) -- 0:00:11
821000 -- (-966.882) (-968.644) [-968.597] (-969.434) * [-968.711] (-971.655) (-968.162) (-966.806) -- 0:00:11
821500 -- [-967.123] (-966.590) (-967.037) (-967.918) * (-968.786) (-968.787) (-970.346) [-969.043] -- 0:00:11
822000 -- (-967.230) (-967.232) (-968.849) [-968.049] * (-968.938) (-966.520) [-971.585] (-968.270) -- 0:00:11
822500 -- [-968.603] (-968.628) (-970.281) (-968.543) * (-968.142) (-966.509) (-971.372) [-968.250] -- 0:00:11
823000 -- [-965.950] (-966.883) (-967.010) (-969.009) * [-967.158] (-968.715) (-973.746) (-966.571) -- 0:00:10
823500 -- [-966.108] (-969.689) (-966.547) (-966.492) * [-969.237] (-967.557) (-970.637) (-969.614) -- 0:00:10
824000 -- (-966.934) [-968.474] (-966.907) (-967.475) * (-969.845) (-966.320) (-969.482) [-968.009] -- 0:00:10
824500 -- (-967.466) [-967.806] (-967.398) (-968.828) * [-971.726] (-966.219) (-968.457) (-968.818) -- 0:00:10
825000 -- [-967.432] (-967.991) (-972.521) (-967.796) * (-968.009) (-965.848) (-967.823) [-967.766] -- 0:00:10
Average standard deviation of split frequencies: 0.006848
825500 -- (-967.024) (-966.180) [-969.970] (-969.132) * (-966.770) (-966.313) (-971.301) [-968.465] -- 0:00:10
826000 -- (-970.475) (-966.171) [-969.056] (-968.628) * (-967.017) (-967.542) (-967.094) [-969.339] -- 0:00:10
826500 -- (-966.701) (-967.524) [-969.008] (-965.859) * (-967.352) (-966.463) (-967.442) [-968.775] -- 0:00:10
827000 -- (-966.182) (-968.558) [-966.996] (-969.634) * (-966.124) (-970.965) (-968.013) [-966.497] -- 0:00:10
827500 -- (-967.382) (-968.331) [-966.241] (-967.005) * (-966.425) [-968.575] (-969.144) (-969.808) -- 0:00:10
828000 -- (-966.620) (-966.054) (-967.725) [-966.641] * [-971.307] (-969.477) (-967.074) (-966.375) -- 0:00:10
828500 -- [-966.844] (-966.847) (-971.341) (-969.128) * (-969.386) [-967.072] (-968.037) (-966.365) -- 0:00:10
829000 -- (-968.439) [-968.453] (-969.004) (-967.774) * (-967.497) (-966.138) [-966.520] (-972.206) -- 0:00:10
829500 -- (-968.041) (-966.954) (-968.322) [-968.957] * (-968.427) [-970.480] (-967.590) (-972.157) -- 0:00:10
830000 -- (-971.549) (-972.489) [-968.929] (-973.261) * (-972.702) [-970.361] (-968.730) (-966.351) -- 0:00:10
Average standard deviation of split frequencies: 0.006916
830500 -- (-968.369) (-971.372) (-971.517) [-965.744] * (-967.424) (-970.778) [-967.257] (-967.511) -- 0:00:10
831000 -- (-967.576) [-971.047] (-969.239) (-965.788) * (-966.902) (-969.161) [-966.349] (-970.722) -- 0:00:10
831500 -- (-967.989) [-966.740] (-970.131) (-969.863) * [-966.827] (-967.545) (-971.078) (-973.987) -- 0:00:10
832000 -- (-968.188) [-966.164] (-971.864) (-968.894) * (-966.652) [-966.775] (-968.025) (-966.064) -- 0:00:10
832500 -- [-968.632] (-966.387) (-967.717) (-966.344) * (-968.898) [-966.387] (-970.528) (-967.759) -- 0:00:10
833000 -- (-968.468) [-966.286] (-967.373) (-966.202) * (-966.696) (-967.515) (-971.381) [-967.750] -- 0:00:10
833500 -- (-970.405) (-966.720) (-968.558) [-967.639] * [-966.079] (-967.343) (-969.249) (-967.419) -- 0:00:10
834000 -- (-967.279) (-967.015) (-967.641) [-967.538] * [-966.621] (-968.630) (-969.629) (-967.092) -- 0:00:10
834500 -- [-967.517] (-967.910) (-968.224) (-967.645) * (-966.263) [-970.060] (-968.613) (-973.113) -- 0:00:10
835000 -- (-966.579) (-966.903) [-966.476] (-967.896) * (-966.601) (-971.825) [-966.680] (-966.267) -- 0:00:10
Average standard deviation of split frequencies: 0.006414
835500 -- [-968.703] (-965.813) (-966.261) (-971.186) * (-969.413) (-968.865) (-966.862) [-968.287] -- 0:00:10
836000 -- (-969.220) [-967.706] (-966.591) (-971.677) * (-968.686) (-968.453) [-967.308] (-966.509) -- 0:00:10
836500 -- (-968.923) (-968.431) [-967.204] (-969.104) * (-970.420) (-966.012) [-968.821] (-967.649) -- 0:00:10
837000 -- (-968.515) [-970.134] (-971.297) (-971.372) * (-968.430) [-966.071] (-968.766) (-972.466) -- 0:00:10
837500 -- (-967.651) (-968.759) [-968.725] (-970.611) * [-968.387] (-967.316) (-967.160) (-969.725) -- 0:00:10
838000 -- (-966.518) [-968.183] (-971.706) (-966.816) * (-970.404) (-967.391) (-968.692) [-968.287] -- 0:00:10
838500 -- (-971.471) (-968.465) (-971.300) [-966.837] * (-966.165) (-969.560) (-967.103) [-968.520] -- 0:00:10
839000 -- (-967.002) (-970.098) (-970.710) [-966.664] * (-966.327) (-967.572) [-967.481] (-966.815) -- 0:00:09
839500 -- (-968.890) (-966.933) [-969.418] (-969.639) * (-977.180) (-968.557) [-969.267] (-968.234) -- 0:00:09
840000 -- (-968.115) (-968.293) [-969.333] (-968.084) * [-967.792] (-966.654) (-970.048) (-969.162) -- 0:00:09
Average standard deviation of split frequencies: 0.006343
840500 -- (-968.672) [-966.689] (-968.778) (-967.146) * [-967.631] (-967.568) (-967.429) (-966.786) -- 0:00:09
841000 -- [-968.286] (-969.036) (-968.921) (-966.591) * (-968.875) [-966.552] (-966.349) (-969.267) -- 0:00:09
841500 -- (-967.436) (-966.166) [-967.476] (-966.876) * (-970.240) (-965.828) [-966.730] (-967.012) -- 0:00:09
842000 -- (-967.202) (-969.169) (-966.202) [-969.001] * (-966.355) (-965.901) (-968.340) [-968.418] -- 0:00:09
842500 -- [-966.412] (-966.750) (-968.245) (-970.241) * [-970.241] (-966.960) (-970.882) (-967.645) -- 0:00:09
843000 -- [-967.866] (-968.528) (-966.491) (-967.972) * (-966.873) (-972.538) (-969.462) [-966.972] -- 0:00:09
843500 -- (-969.521) (-967.320) [-967.064] (-968.318) * (-967.251) (-970.389) (-970.118) [-967.103] -- 0:00:09
844000 -- (-969.685) (-967.339) [-968.227] (-968.146) * [-970.918] (-970.782) (-969.996) (-966.548) -- 0:00:09
844500 -- [-966.188] (-968.424) (-967.582) (-968.537) * [-967.498] (-970.255) (-967.839) (-971.666) -- 0:00:09
845000 -- (-970.165) (-968.750) (-975.937) [-967.669] * (-965.821) (-966.368) [-968.657] (-967.849) -- 0:00:09
Average standard deviation of split frequencies: 0.006304
845500 -- (-967.587) (-970.706) (-971.681) [-972.920] * (-968.531) (-969.053) [-967.848] (-970.958) -- 0:00:09
846000 -- [-967.536] (-968.307) (-969.821) (-969.686) * (-969.350) (-970.162) (-965.957) [-966.447] -- 0:00:09
846500 -- (-967.488) (-969.519) [-968.944] (-972.033) * (-971.976) [-970.257] (-967.357) (-967.861) -- 0:00:09
847000 -- (-971.638) (-968.198) (-968.629) [-968.567] * (-967.529) (-971.165) [-966.794] (-972.018) -- 0:00:09
847500 -- (-966.632) (-968.273) (-968.211) [-968.020] * (-969.063) [-967.875] (-966.250) (-965.903) -- 0:00:09
848000 -- (-966.378) [-969.775] (-966.069) (-966.401) * (-966.357) (-968.993) (-966.459) [-965.761] -- 0:00:09
848500 -- [-966.644] (-966.762) (-968.543) (-966.572) * (-969.753) (-973.188) [-966.460] (-969.192) -- 0:00:09
849000 -- (-967.476) (-971.081) (-969.840) [-967.573] * (-967.370) (-969.907) (-966.780) [-967.863] -- 0:00:09
849500 -- (-966.567) [-968.192] (-969.692) (-967.361) * (-968.371) (-968.561) [-968.091] (-968.020) -- 0:00:09
850000 -- (-970.817) [-973.943] (-967.781) (-969.539) * [-965.682] (-966.506) (-966.163) (-966.189) -- 0:00:09
Average standard deviation of split frequencies: 0.006234
850500 -- (-973.427) [-968.726] (-969.520) (-967.366) * [-966.343] (-969.590) (-972.828) (-970.411) -- 0:00:09
851000 -- (-973.370) [-966.610] (-970.600) (-970.076) * (-966.485) [-967.633] (-967.169) (-967.621) -- 0:00:09
851500 -- [-969.649] (-971.474) (-977.523) (-966.549) * (-969.611) [-966.824] (-967.635) (-967.793) -- 0:00:09
852000 -- (-969.150) (-972.247) [-966.295] (-966.898) * (-968.666) (-967.507) [-968.083] (-967.447) -- 0:00:09
852500 -- (-968.851) (-966.450) [-970.510] (-968.095) * (-971.405) (-968.865) [-966.500] (-967.785) -- 0:00:09
853000 -- (-967.923) [-971.116] (-970.166) (-967.805) * (-972.893) (-967.102) (-967.722) [-966.490] -- 0:00:09
853500 -- [-967.874] (-969.817) (-968.701) (-968.150) * (-968.565) (-966.826) [-966.604] (-965.964) -- 0:00:09
854000 -- [-967.639] (-967.961) (-968.107) (-967.973) * [-968.485] (-966.877) (-969.663) (-966.740) -- 0:00:09
854500 -- [-968.085] (-969.628) (-969.159) (-973.740) * (-968.152) (-968.805) [-967.937] (-966.152) -- 0:00:09
855000 -- (-969.441) (-966.408) [-970.070] (-968.758) * (-966.899) (-968.113) [-968.750] (-966.038) -- 0:00:08
Average standard deviation of split frequencies: 0.006127
855500 -- (-969.577) (-966.206) [-967.714] (-968.656) * (-966.829) (-967.581) (-968.856) [-967.518] -- 0:00:08
856000 -- (-968.045) [-966.375] (-967.200) (-970.874) * [-968.285] (-968.365) (-965.989) (-967.921) -- 0:00:08
856500 -- [-966.683] (-968.804) (-969.285) (-970.888) * (-968.379) (-965.933) [-967.040] (-970.704) -- 0:00:08
857000 -- (-966.742) (-967.022) [-967.185] (-965.944) * [-968.460] (-965.884) (-968.184) (-968.608) -- 0:00:08
857500 -- (-969.037) (-967.831) [-966.445] (-966.981) * (-967.743) (-965.739) (-968.452) [-967.579] -- 0:00:08
858000 -- (-967.288) (-967.100) (-966.841) [-965.830] * (-971.633) (-972.380) [-967.544] (-969.704) -- 0:00:08
858500 -- [-966.448] (-967.980) (-968.168) (-965.946) * [-968.631] (-967.028) (-971.126) (-970.546) -- 0:00:08
859000 -- [-966.311] (-966.742) (-966.475) (-968.543) * (-968.171) [-967.028] (-967.176) (-969.286) -- 0:00:08
859500 -- [-967.458] (-968.471) (-976.006) (-970.584) * (-972.554) (-968.234) [-968.151] (-965.524) -- 0:00:08
860000 -- (-967.245) [-967.221] (-969.065) (-967.931) * (-969.388) (-970.458) (-966.652) [-967.993] -- 0:00:08
Average standard deviation of split frequencies: 0.006265
860500 -- (-968.413) [-968.129] (-975.235) (-970.065) * (-968.034) (-969.047) (-966.958) [-968.059] -- 0:00:08
861000 -- (-966.506) (-967.262) (-968.097) [-970.247] * [-968.015] (-969.718) (-966.331) (-974.845) -- 0:00:08
861500 -- (-966.574) (-968.684) (-968.382) [-970.228] * (-970.014) (-969.977) [-969.202] (-969.693) -- 0:00:08
862000 -- (-968.771) (-970.338) [-969.130] (-968.535) * [-966.830] (-971.519) (-967.216) (-968.056) -- 0:00:08
862500 -- (-968.320) (-966.230) (-968.993) [-965.842] * (-966.807) (-969.740) (-966.531) [-969.092] -- 0:00:08
863000 -- (-966.764) (-967.401) (-969.056) [-965.911] * (-967.382) (-967.455) [-972.863] (-967.711) -- 0:00:08
863500 -- (-967.686) (-968.710) (-969.234) [-966.458] * (-967.268) [-967.844] (-974.157) (-968.992) -- 0:00:08
864000 -- (-966.047) (-969.071) (-967.997) [-968.275] * (-966.235) [-970.184] (-967.635) (-970.536) -- 0:00:08
864500 -- [-968.613] (-970.502) (-971.848) (-967.312) * [-966.093] (-966.760) (-966.372) (-967.038) -- 0:00:08
865000 -- [-969.435] (-969.244) (-967.271) (-967.044) * (-970.242) (-967.688) (-967.103) [-968.648] -- 0:00:08
Average standard deviation of split frequencies: 0.006124
865500 -- (-966.522) [-968.986] (-966.743) (-970.412) * (-967.188) (-974.215) [-970.367] (-968.489) -- 0:00:08
866000 -- (-967.435) [-967.580] (-967.258) (-968.251) * (-967.872) (-968.148) [-968.178] (-968.049) -- 0:00:08
866500 -- (-968.751) [-966.523] (-967.332) (-967.017) * (-968.296) (-969.975) [-970.334] (-966.914) -- 0:00:08
867000 -- (-967.206) [-966.945] (-968.301) (-965.809) * (-969.714) (-969.160) (-967.237) [-966.332] -- 0:00:08
867500 -- (-968.524) (-967.405) [-967.490] (-968.285) * (-967.027) [-970.092] (-967.915) (-966.090) -- 0:00:08
868000 -- (-967.926) (-968.714) [-971.610] (-968.120) * (-967.389) (-968.803) [-969.673] (-966.056) -- 0:00:08
868500 -- (-965.961) [-965.836] (-970.820) (-967.289) * (-967.478) (-969.161) [-966.413] (-966.102) -- 0:00:08
869000 -- [-966.770] (-968.724) (-968.230) (-969.591) * (-966.926) (-967.891) (-965.951) [-967.520] -- 0:00:08
869500 -- (-967.265) (-967.330) [-971.037] (-970.888) * (-967.240) (-971.086) (-970.076) [-967.627] -- 0:00:08
870000 -- (-967.136) (-968.966) (-972.301) [-970.143] * (-967.138) (-969.632) (-968.529) [-965.845] -- 0:00:08
Average standard deviation of split frequencies: 0.006091
870500 -- (-967.319) [-967.370] (-967.823) (-966.770) * (-968.658) [-967.639] (-966.829) (-967.037) -- 0:00:08
871000 -- (-967.658) (-966.557) (-967.226) [-967.723] * (-968.521) (-968.356) (-966.427) [-969.309] -- 0:00:07
871500 -- [-966.444] (-968.823) (-966.924) (-967.923) * [-965.934] (-969.242) (-975.637) (-966.671) -- 0:00:07
872000 -- (-966.676) (-967.117) [-969.187] (-970.157) * (-968.386) (-967.492) (-972.446) [-966.556] -- 0:00:07
872500 -- (-968.660) (-968.088) (-968.213) [-965.839] * [-970.694] (-967.747) (-967.129) (-967.049) -- 0:00:07
873000 -- [-966.063] (-967.001) (-968.906) (-969.296) * (-966.980) (-967.747) (-968.349) [-969.594] -- 0:00:07
873500 -- (-967.476) [-966.214] (-966.935) (-966.642) * (-968.480) [-966.657] (-970.279) (-967.706) -- 0:00:07
874000 -- (-967.757) (-968.252) (-967.752) [-971.096] * (-967.016) [-966.687] (-966.905) (-970.140) -- 0:00:07
874500 -- [-970.055] (-968.470) (-970.375) (-966.547) * (-966.816) (-966.883) [-966.938] (-971.061) -- 0:00:07
875000 -- (-966.757) (-970.305) (-968.368) [-966.192] * (-969.025) (-970.038) (-967.211) [-968.482] -- 0:00:07
Average standard deviation of split frequencies: 0.006491
875500 -- (-971.427) (-966.881) [-967.169] (-966.627) * [-968.325] (-970.624) (-968.922) (-969.678) -- 0:00:07
876000 -- (-968.245) [-966.131] (-965.996) (-966.696) * (-966.647) (-968.920) (-965.874) [-967.059] -- 0:00:07
876500 -- (-968.735) (-966.127) [-966.027] (-968.958) * [-967.166] (-968.074) (-968.201) (-966.569) -- 0:00:07
877000 -- [-969.080] (-969.250) (-971.648) (-966.128) * [-967.506] (-970.132) (-967.872) (-967.823) -- 0:00:07
877500 -- (-971.464) (-969.273) [-966.746] (-967.555) * (-966.751) (-967.137) [-965.773] (-967.613) -- 0:00:07
878000 -- (-970.251) (-970.084) (-967.359) [-966.735] * (-966.752) (-968.027) (-967.562) [-966.464] -- 0:00:07
878500 -- [-966.046] (-968.239) (-967.754) (-969.837) * (-966.757) [-968.222] (-967.343) (-967.563) -- 0:00:07
879000 -- (-966.800) [-968.092] (-971.048) (-971.544) * [-966.244] (-969.947) (-970.734) (-966.858) -- 0:00:07
879500 -- (-965.666) (-966.590) [-968.629] (-974.656) * [-967.926] (-967.297) (-967.610) (-969.502) -- 0:00:07
880000 -- [-966.611] (-966.867) (-966.116) (-969.754) * [-968.903] (-968.265) (-966.937) (-966.693) -- 0:00:07
Average standard deviation of split frequencies: 0.006624
880500 -- (-967.554) (-967.693) [-966.658] (-968.179) * (-970.304) [-966.923] (-966.957) (-967.018) -- 0:00:07
881000 -- (-967.636) [-967.935] (-967.480) (-967.408) * (-970.713) [-966.587] (-967.035) (-967.095) -- 0:00:07
881500 -- [-967.074] (-967.970) (-969.325) (-967.416) * (-972.563) [-967.775] (-968.197) (-967.088) -- 0:00:07
882000 -- (-969.569) [-966.544] (-967.698) (-966.725) * (-968.991) (-969.279) [-966.738] (-965.875) -- 0:00:07
882500 -- [-972.424] (-967.303) (-967.869) (-967.132) * (-968.185) [-968.191] (-971.256) (-965.874) -- 0:00:07
883000 -- (-971.539) [-966.751] (-968.910) (-969.219) * [-967.787] (-967.113) (-968.194) (-966.534) -- 0:00:07
883500 -- (-966.177) (-966.849) [-967.236] (-972.012) * [-966.635] (-967.205) (-967.722) (-971.136) -- 0:00:07
884000 -- [-968.071] (-967.062) (-967.141) (-967.942) * [-968.297] (-967.692) (-966.600) (-970.790) -- 0:00:07
884500 -- (-969.158) (-969.277) (-967.100) [-967.715] * (-968.587) (-969.986) (-967.509) [-967.434] -- 0:00:07
885000 -- (-968.274) (-966.981) [-967.987] (-966.499) * (-966.608) [-966.702] (-966.719) (-968.829) -- 0:00:07
Average standard deviation of split frequencies: 0.006850
885500 -- (-967.248) (-969.829) (-967.194) [-966.473] * (-969.937) (-966.196) [-971.271] (-966.268) -- 0:00:07
886000 -- (-968.895) [-969.739] (-972.693) (-972.767) * (-967.031) (-968.578) [-967.022] (-967.350) -- 0:00:07
886500 -- [-968.092] (-970.260) (-972.400) (-969.299) * (-968.872) (-970.900) (-966.689) [-966.315] -- 0:00:07
887000 -- (-968.175) (-969.726) [-967.209] (-967.754) * (-965.718) (-969.282) (-968.069) [-966.100] -- 0:00:07
887500 -- (-966.063) (-970.593) (-967.001) [-969.241] * (-970.167) [-965.761] (-968.034) (-966.534) -- 0:00:06
888000 -- [-970.335] (-967.859) (-966.525) (-966.560) * (-982.554) [-965.792] (-968.675) (-967.369) -- 0:00:06
888500 -- (-973.237) (-969.853) (-967.503) [-966.551] * (-970.850) (-965.988) [-967.937] (-966.042) -- 0:00:06
889000 -- (-969.751) [-968.832] (-968.693) (-966.418) * (-967.632) (-966.535) (-969.862) [-966.989] -- 0:00:06
889500 -- [-967.922] (-972.640) (-972.460) (-967.482) * [-968.859] (-968.652) (-968.273) (-968.253) -- 0:00:06
890000 -- [-968.295] (-971.398) (-968.901) (-972.452) * (-968.939) (-966.876) (-969.319) [-969.828] -- 0:00:06
Average standard deviation of split frequencies: 0.006715
890500 -- (-967.811) (-968.272) [-966.572] (-969.475) * (-966.226) (-968.068) [-968.316] (-969.819) -- 0:00:06
891000 -- (-967.932) (-971.147) [-967.746] (-966.525) * [-967.507] (-970.107) (-972.343) (-966.039) -- 0:00:06
891500 -- (-970.056) (-967.533) [-967.971] (-966.843) * (-967.912) [-969.440] (-970.803) (-966.519) -- 0:00:06
892000 -- (-967.929) [-966.634] (-970.317) (-970.570) * [-966.822] (-974.075) (-968.410) (-973.289) -- 0:00:06
892500 -- [-968.683] (-966.156) (-970.936) (-967.541) * [-967.387] (-970.367) (-970.519) (-966.647) -- 0:00:06
893000 -- [-966.924] (-967.391) (-971.200) (-966.035) * (-968.794) [-967.520] (-970.720) (-968.737) -- 0:00:06
893500 -- [-966.986] (-967.552) (-968.787) (-967.917) * [-967.105] (-969.543) (-968.700) (-967.887) -- 0:00:06
894000 -- (-967.497) (-968.996) [-967.593] (-967.090) * (-966.636) (-969.504) [-968.879] (-968.001) -- 0:00:06
894500 -- [-967.318] (-967.816) (-967.322) (-966.665) * (-967.323) (-968.839) [-968.034] (-968.200) -- 0:00:06
895000 -- (-966.899) [-967.455] (-970.874) (-968.235) * (-969.564) [-967.630] (-967.820) (-967.592) -- 0:00:06
Average standard deviation of split frequencies: 0.006675
895500 -- (-967.961) (-971.060) [-966.314] (-970.675) * [-968.271] (-967.223) (-966.583) (-972.003) -- 0:00:06
896000 -- (-974.179) (-972.552) (-970.445) [-968.408] * (-966.772) (-967.681) [-965.988] (-968.450) -- 0:00:06
896500 -- (-970.304) (-966.413) (-969.751) [-969.086] * (-967.091) (-966.999) (-968.438) [-971.386] -- 0:00:06
897000 -- (-968.443) (-967.983) [-966.442] (-970.046) * (-968.106) (-966.668) [-968.792] (-967.882) -- 0:00:06
897500 -- (-966.567) (-967.087) (-966.994) [-967.144] * [-967.115] (-967.110) (-967.901) (-966.627) -- 0:00:06
898000 -- (-966.127) (-970.130) (-969.274) [-966.874] * (-968.017) (-966.083) (-967.456) [-968.385] -- 0:00:06
898500 -- [-967.345] (-979.226) (-969.741) (-967.447) * (-967.127) (-969.755) [-967.107] (-968.631) -- 0:00:06
899000 -- (-967.581) (-972.570) [-966.160] (-969.986) * (-969.058) (-967.412) (-967.401) [-969.200] -- 0:00:06
899500 -- (-969.413) [-967.430] (-970.488) (-967.587) * (-971.532) (-966.719) [-967.481] (-966.076) -- 0:00:06
900000 -- (-970.692) (-966.132) (-967.967) [-969.237] * (-971.073) (-972.482) (-969.120) [-968.593] -- 0:00:06
Average standard deviation of split frequencies: 0.006510
900500 -- (-968.343) (-969.011) [-967.917] (-968.061) * (-970.472) [-967.994] (-966.691) (-969.351) -- 0:00:06
901000 -- (-966.502) (-969.257) [-968.641] (-966.736) * (-971.319) [-967.460] (-969.477) (-966.245) -- 0:00:06
901500 -- (-966.770) [-968.848] (-967.259) (-965.962) * (-967.969) (-971.223) (-968.655) [-966.932] -- 0:00:06
902000 -- (-965.847) (-967.050) (-967.298) [-967.445] * (-968.103) [-969.561] (-968.016) (-969.252) -- 0:00:06
902500 -- [-965.839] (-967.062) (-967.579) (-965.779) * [-966.243] (-968.527) (-968.694) (-967.581) -- 0:00:06
903000 -- (-969.485) [-967.066] (-966.921) (-966.041) * (-970.945) [-966.629] (-973.796) (-969.381) -- 0:00:06
903500 -- (-967.651) (-966.818) (-967.587) [-967.442] * (-967.807) [-969.548] (-967.648) (-969.488) -- 0:00:05
904000 -- (-968.204) (-966.771) (-967.215) [-967.646] * [-967.133] (-966.723) (-968.798) (-966.553) -- 0:00:05
904500 -- (-967.922) (-968.189) (-971.062) [-967.410] * (-968.302) [-966.859] (-968.709) (-968.954) -- 0:00:05
905000 -- (-968.408) [-970.242] (-967.289) (-969.715) * (-968.878) (-967.513) [-971.753] (-969.231) -- 0:00:05
Average standard deviation of split frequencies: 0.006341
905500 -- (-965.894) (-971.856) (-967.985) [-968.120] * (-967.336) (-970.474) [-972.606] (-968.875) -- 0:00:05
906000 -- [-965.891] (-968.273) (-968.127) (-968.403) * (-966.258) (-971.533) (-969.029) [-968.002] -- 0:00:05
906500 -- (-968.589) (-966.781) [-967.728] (-968.686) * (-968.604) (-968.250) (-970.624) [-967.302] -- 0:00:05
907000 -- (-966.303) (-968.935) (-969.875) [-971.051] * (-970.210) (-969.371) (-967.206) [-969.269] -- 0:00:05
907500 -- [-966.011] (-969.201) (-970.259) (-966.770) * [-966.914] (-967.811) (-969.897) (-970.189) -- 0:00:05
908000 -- (-966.578) (-968.561) (-975.296) [-966.880] * [-966.530] (-970.802) (-966.616) (-970.224) -- 0:00:05
908500 -- (-966.722) [-966.622] (-973.945) (-968.373) * [-967.901] (-968.499) (-967.907) (-966.737) -- 0:00:05
909000 -- [-968.017] (-970.013) (-970.418) (-968.377) * [-967.032] (-970.033) (-967.505) (-968.679) -- 0:00:05
909500 -- (-966.866) (-967.582) (-972.014) [-969.764] * (-968.088) (-966.673) [-967.909] (-967.121) -- 0:00:05
910000 -- [-968.537] (-967.765) (-973.258) (-970.215) * (-966.811) [-967.887] (-967.033) (-967.277) -- 0:00:05
Average standard deviation of split frequencies: 0.006568
910500 -- (-967.667) (-968.035) (-970.604) [-970.527] * (-969.847) [-967.541] (-967.348) (-967.807) -- 0:00:05
911000 -- (-972.486) (-967.335) (-966.347) [-967.996] * (-968.697) [-969.704] (-966.563) (-972.372) -- 0:00:05
911500 -- (-972.465) (-966.342) (-966.826) [-966.748] * (-968.013) (-967.745) (-966.232) [-970.345] -- 0:00:05
912000 -- (-965.908) (-967.275) (-970.093) [-966.046] * (-971.128) (-970.162) (-966.106) [-966.282] -- 0:00:05
912500 -- (-966.563) (-966.705) (-972.354) [-966.018] * (-967.021) [-965.977] (-966.542) (-969.510) -- 0:00:05
913000 -- (-966.619) (-968.286) [-967.111] (-967.267) * [-967.718] (-967.163) (-967.490) (-967.578) -- 0:00:05
913500 -- (-968.575) [-966.444] (-968.314) (-967.024) * (-966.847) (-966.722) [-966.574] (-967.463) -- 0:00:05
914000 -- (-969.956) (-970.602) (-969.367) [-965.979] * [-967.582] (-967.460) (-966.340) (-965.742) -- 0:00:05
914500 -- [-967.273] (-967.120) (-970.231) (-967.481) * (-970.624) (-968.455) [-968.837] (-968.580) -- 0:00:05
915000 -- (-968.351) [-966.889] (-969.703) (-967.312) * (-966.461) [-967.406] (-966.998) (-969.511) -- 0:00:05
Average standard deviation of split frequencies: 0.006851
915500 -- [-971.580] (-968.421) (-968.946) (-968.733) * (-968.453) [-968.036] (-968.265) (-969.392) -- 0:00:05
916000 -- (-969.322) [-966.476] (-969.581) (-969.639) * (-967.705) [-966.231] (-968.701) (-967.196) -- 0:00:05
916500 -- [-970.062] (-965.630) (-972.223) (-968.483) * (-971.756) (-968.941) [-968.601] (-967.610) -- 0:00:05
917000 -- (-970.314) (-966.555) (-971.080) [-967.251] * (-971.144) [-967.216] (-976.624) (-966.140) -- 0:00:05
917500 -- (-972.359) (-967.981) (-969.412) [-966.444] * [-968.268] (-967.013) (-972.361) (-968.191) -- 0:00:05
918000 -- [-968.210] (-968.735) (-971.449) (-968.127) * (-966.002) [-967.986] (-970.647) (-968.309) -- 0:00:05
918500 -- (-966.672) (-969.417) [-968.711] (-967.841) * (-966.257) [-970.524] (-967.489) (-969.895) -- 0:00:05
919000 -- (-971.521) (-969.368) (-967.797) [-966.654] * (-967.858) (-967.638) (-967.489) [-968.406] -- 0:00:05
919500 -- (-966.700) [-971.452] (-967.252) (-972.332) * (-966.787) (-968.470) [-967.981] (-967.821) -- 0:00:04
920000 -- (-967.537) (-969.211) [-967.551] (-967.176) * (-968.141) [-967.561] (-968.404) (-966.849) -- 0:00:04
Average standard deviation of split frequencies: 0.007168
920500 -- [-967.213] (-966.423) (-968.140) (-971.395) * [-967.392] (-966.680) (-968.837) (-967.168) -- 0:00:04
921000 -- [-969.922] (-966.982) (-966.465) (-967.307) * (-967.754) [-965.995] (-970.174) (-970.289) -- 0:00:04
921500 -- (-966.883) (-966.926) [-968.578] (-969.779) * (-966.703) (-967.221) [-966.450] (-973.655) -- 0:00:04
922000 -- [-968.729] (-970.754) (-968.101) (-968.582) * [-967.155] (-967.355) (-967.085) (-974.042) -- 0:00:04
922500 -- [-968.086] (-966.871) (-969.787) (-967.153) * (-968.847) (-967.902) [-966.527] (-969.975) -- 0:00:04
923000 -- (-967.791) [-969.020] (-968.472) (-966.129) * (-967.125) [-968.876] (-966.094) (-966.888) -- 0:00:04
923500 -- (-965.849) (-967.781) (-970.943) [-966.437] * (-971.083) (-966.934) [-967.429] (-967.235) -- 0:00:04
924000 -- (-969.596) (-967.394) (-975.726) [-965.758] * (-973.131) (-965.776) (-970.499) [-965.954] -- 0:00:04
924500 -- (-971.007) (-972.630) (-970.201) [-968.321] * (-972.562) (-969.681) [-968.269] (-966.149) -- 0:00:04
925000 -- (-968.728) (-969.475) [-971.353] (-968.339) * (-967.849) (-967.306) (-967.122) [-966.497] -- 0:00:04
Average standard deviation of split frequencies: 0.007191
925500 -- [-967.141] (-969.908) (-971.834) (-966.933) * (-968.059) [-969.022] (-969.711) (-971.841) -- 0:00:04
926000 -- (-968.429) [-968.027] (-968.456) (-966.801) * [-968.847] (-971.016) (-968.790) (-972.364) -- 0:00:04
926500 -- (-971.932) (-966.677) [-968.517] (-965.750) * (-969.488) (-970.133) (-967.846) [-968.681] -- 0:00:04
927000 -- (-967.960) [-967.041] (-970.144) (-966.508) * [-969.475] (-972.434) (-971.567) (-969.886) -- 0:00:04
927500 -- (-969.465) [-966.448] (-967.062) (-967.726) * [-969.955] (-971.135) (-968.105) (-969.380) -- 0:00:04
928000 -- [-966.938] (-967.351) (-970.169) (-966.718) * (-969.642) (-971.935) (-969.765) [-971.406] -- 0:00:04
928500 -- [-967.993] (-970.117) (-967.124) (-966.716) * (-969.228) (-966.708) [-969.393] (-968.242) -- 0:00:04
929000 -- (-968.837) (-969.868) (-970.898) [-965.653] * (-969.468) (-968.937) (-966.033) [-967.266] -- 0:00:04
929500 -- (-966.630) (-967.022) (-970.121) [-965.657] * (-969.877) [-967.393] (-966.593) (-969.354) -- 0:00:04
930000 -- (-968.057) [-966.892] (-970.080) (-967.943) * (-968.094) (-968.128) [-970.144] (-969.450) -- 0:00:04
Average standard deviation of split frequencies: 0.006933
930500 -- (-968.123) [-969.553] (-968.440) (-966.801) * [-967.402] (-965.874) (-970.752) (-970.716) -- 0:00:04
931000 -- (-970.614) (-965.705) [-970.080] (-967.054) * (-970.288) (-968.015) [-974.117] (-966.499) -- 0:00:04
931500 -- [-966.712] (-965.795) (-967.798) (-967.997) * (-967.954) (-969.977) (-973.057) [-967.959] -- 0:00:04
932000 -- [-967.397] (-966.388) (-968.036) (-967.246) * (-968.222) [-967.759] (-966.674) (-969.021) -- 0:00:04
932500 -- [-966.456] (-970.239) (-968.268) (-966.974) * (-968.545) [-966.447] (-969.698) (-966.129) -- 0:00:04
933000 -- (-966.146) (-968.975) (-968.092) [-966.175] * (-971.480) (-969.538) [-967.828] (-965.852) -- 0:00:04
933500 -- (-967.035) (-967.136) (-967.753) [-967.610] * [-968.182] (-968.178) (-969.688) (-965.933) -- 0:00:04
934000 -- (-968.170) [-966.729] (-968.025) (-967.608) * (-968.108) (-966.635) [-967.430] (-967.429) -- 0:00:04
934500 -- [-966.515] (-967.406) (-967.691) (-967.077) * (-969.700) (-966.819) [-967.273] (-969.160) -- 0:00:04
935000 -- (-968.054) [-969.054] (-968.588) (-965.986) * (-968.038) (-967.990) (-970.663) [-970.247] -- 0:00:04
Average standard deviation of split frequencies: 0.007649
935500 -- (-970.956) (-969.668) [-967.036] (-971.689) * (-970.124) (-967.616) (-968.074) [-967.141] -- 0:00:03
936000 -- (-975.427) (-968.428) [-967.640] (-970.355) * (-969.490) (-969.997) (-966.674) [-971.776] -- 0:00:03
936500 -- (-967.181) (-967.314) (-967.371) [-966.268] * (-971.256) (-969.606) [-966.258] (-966.375) -- 0:00:03
937000 -- (-966.839) (-967.685) [-967.885] (-971.866) * [-967.700] (-969.949) (-970.263) (-969.123) -- 0:00:03
937500 -- (-969.550) (-970.149) (-967.817) [-968.292] * (-967.740) (-968.588) (-970.809) [-968.342] -- 0:00:03
938000 -- (-970.621) (-968.892) [-966.131] (-970.323) * [-968.341] (-967.054) (-967.399) (-966.773) -- 0:00:03
938500 -- (-967.455) [-969.574] (-968.982) (-966.684) * (-969.710) (-965.984) (-966.966) [-968.150] -- 0:00:03
939000 -- [-968.923] (-969.417) (-968.594) (-966.758) * (-968.276) [-968.247] (-969.218) (-966.356) -- 0:00:03
939500 -- (-968.354) [-968.271] (-967.747) (-969.335) * (-966.289) [-968.025] (-965.998) (-968.091) -- 0:00:03
940000 -- (-966.525) (-968.267) [-968.039] (-972.078) * (-967.546) (-967.274) (-967.760) [-966.344] -- 0:00:03
Average standard deviation of split frequencies: 0.007705
940500 -- (-969.650) [-967.449] (-967.527) (-965.803) * (-967.565) [-967.806] (-968.961) (-965.868) -- 0:00:03
941000 -- (-969.236) (-966.956) (-965.997) [-965.949] * [-965.947] (-972.790) (-966.357) (-970.340) -- 0:00:03
941500 -- (-967.641) (-970.293) (-965.997) [-966.767] * (-972.554) (-969.001) [-968.410] (-969.932) -- 0:00:03
942000 -- (-971.026) (-974.607) (-966.390) [-966.222] * (-968.908) (-965.794) [-968.150] (-969.236) -- 0:00:03
942500 -- (-969.460) [-966.831] (-972.291) (-965.892) * [-969.227] (-966.099) (-968.553) (-969.220) -- 0:00:03
943000 -- (-968.067) (-966.647) [-967.347] (-965.914) * (-968.165) (-966.686) (-967.608) [-968.068] -- 0:00:03
943500 -- (-967.517) [-966.893] (-971.111) (-966.776) * (-968.552) (-966.686) [-967.209] (-967.584) -- 0:00:03
944000 -- [-968.525] (-970.699) (-970.516) (-967.096) * (-969.375) (-966.650) [-966.580] (-966.644) -- 0:00:03
944500 -- (-966.798) (-972.550) [-968.326] (-969.901) * [-967.086] (-966.573) (-966.917) (-968.384) -- 0:00:03
945000 -- [-967.624] (-970.375) (-965.620) (-967.780) * (-968.043) (-969.910) (-966.806) [-966.049] -- 0:00:03
Average standard deviation of split frequencies: 0.007475
945500 -- (-967.649) (-968.516) [-965.667] (-968.868) * (-965.868) (-967.746) (-967.271) [-968.610] -- 0:00:03
946000 -- (-967.906) [-967.993] (-967.532) (-968.338) * (-966.239) (-969.301) [-966.956] (-968.054) -- 0:00:03
946500 -- (-968.605) (-968.702) [-968.405] (-966.808) * (-966.642) (-967.843) [-966.039] (-971.628) -- 0:00:03
947000 -- (-966.823) (-968.430) [-967.294] (-966.263) * (-971.303) (-971.370) [-968.562] (-967.533) -- 0:00:03
947500 -- (-967.385) (-968.281) (-966.194) [-966.824] * [-967.005] (-968.514) (-967.500) (-974.541) -- 0:00:03
948000 -- (-970.314) (-971.909) [-967.433] (-969.902) * (-965.873) (-969.907) (-969.765) [-966.331] -- 0:00:03
948500 -- [-967.783] (-966.770) (-975.181) (-968.213) * (-970.775) (-976.509) [-967.531] (-968.789) -- 0:00:03
949000 -- (-968.969) (-967.708) [-966.324] (-967.754) * (-972.840) (-972.782) [-966.004] (-969.883) -- 0:00:03
949500 -- (-968.228) (-966.467) (-973.650) [-969.054] * [-968.595] (-968.040) (-966.885) (-967.387) -- 0:00:03
950000 -- [-968.064] (-965.983) (-966.452) (-967.565) * (-968.830) (-966.389) [-967.517] (-966.697) -- 0:00:03
Average standard deviation of split frequencies: 0.007221
950500 -- (-969.748) (-966.497) (-967.068) [-967.943] * (-967.801) (-966.369) (-967.757) [-969.548] -- 0:00:03
951000 -- (-971.119) [-966.964] (-966.178) (-969.030) * [-970.298] (-966.388) (-966.638) (-968.667) -- 0:00:03
951500 -- (-970.354) (-972.347) [-968.254] (-973.678) * (-967.598) (-966.829) [-967.531] (-968.472) -- 0:00:03
952000 -- (-968.755) (-974.556) (-968.982) [-970.713] * (-967.585) (-967.167) (-972.101) [-967.276] -- 0:00:02
952500 -- (-969.032) [-970.371] (-970.767) (-967.951) * (-965.833) (-967.599) (-968.352) [-967.317] -- 0:00:02
953000 -- [-966.551] (-968.167) (-967.032) (-966.005) * [-969.493] (-966.452) (-968.125) (-967.121) -- 0:00:02
953500 -- (-966.597) [-970.678] (-969.335) (-968.444) * (-968.280) [-968.246] (-966.849) (-967.270) -- 0:00:02
954000 -- (-966.230) (-969.595) [-966.457] (-971.136) * [-967.729] (-967.342) (-969.414) (-968.165) -- 0:00:02
954500 -- [-966.585] (-966.653) (-965.890) (-970.124) * (-966.660) [-968.554] (-969.521) (-967.203) -- 0:00:02
955000 -- (-966.365) (-968.648) [-968.076] (-969.645) * (-970.368) [-969.495] (-966.472) (-966.035) -- 0:00:02
Average standard deviation of split frequencies: 0.006965
955500 -- (-966.293) [-967.545] (-966.225) (-967.815) * [-970.850] (-973.705) (-970.594) (-967.775) -- 0:00:02
956000 -- (-967.975) [-966.540] (-966.361) (-969.717) * (-968.813) (-967.100) (-970.741) [-967.121] -- 0:00:02
956500 -- (-971.175) (-969.562) [-968.332] (-966.885) * [-968.879] (-972.904) (-974.382) (-967.806) -- 0:00:02
957000 -- [-968.738] (-971.088) (-968.595) (-968.942) * (-966.757) (-968.841) (-969.517) [-968.024] -- 0:00:02
957500 -- (-967.732) (-968.926) [-965.715] (-969.005) * (-968.120) (-973.395) [-968.570] (-969.985) -- 0:00:02
958000 -- [-966.405] (-968.868) (-967.413) (-969.597) * (-969.962) (-968.838) [-969.867] (-967.643) -- 0:00:02
958500 -- (-966.351) (-968.020) [-965.859] (-969.751) * (-966.481) (-967.262) [-968.100] (-966.778) -- 0:00:02
959000 -- (-966.602) (-971.263) [-968.205] (-966.415) * (-967.212) [-966.901] (-968.658) (-967.237) -- 0:00:02
959500 -- (-967.416) [-967.410] (-969.340) (-966.190) * (-968.795) (-967.625) [-969.328] (-970.375) -- 0:00:02
960000 -- (-967.124) [-971.790] (-967.650) (-967.018) * (-967.049) [-966.437] (-967.065) (-968.222) -- 0:00:02
Average standard deviation of split frequencies: 0.007453
960500 -- (-966.359) (-970.701) (-975.134) [-966.211] * (-968.253) (-967.665) (-966.829) [-966.974] -- 0:00:02
961000 -- (-968.758) (-967.164) [-970.039] (-966.375) * (-968.132) [-967.058] (-966.955) (-971.305) -- 0:00:02
961500 -- (-968.174) (-967.209) (-968.978) [-966.405] * (-967.544) (-972.276) [-966.849] (-968.078) -- 0:00:02
962000 -- (-969.967) (-968.706) [-968.367] (-967.135) * [-966.011] (-974.216) (-966.874) (-967.751) -- 0:00:02
962500 -- (-966.473) (-967.758) [-966.432] (-967.987) * (-966.659) (-970.473) [-966.819] (-967.347) -- 0:00:02
963000 -- [-966.427] (-967.594) (-967.940) (-969.854) * (-967.991) [-968.363] (-970.828) (-968.400) -- 0:00:02
963500 -- (-967.220) [-969.166] (-969.614) (-967.731) * (-967.616) (-969.485) (-967.723) [-973.541] -- 0:00:02
964000 -- [-968.329] (-966.936) (-966.357) (-967.795) * (-967.084) (-968.960) [-966.883] (-966.926) -- 0:00:02
964500 -- (-967.803) [-967.628] (-967.906) (-970.526) * (-969.174) (-969.235) [-970.897] (-968.427) -- 0:00:02
965000 -- (-966.100) [-967.791] (-969.594) (-969.974) * (-966.939) [-968.656] (-970.052) (-971.337) -- 0:00:02
Average standard deviation of split frequencies: 0.007228
965500 -- (-966.977) (-967.941) [-974.725] (-966.667) * (-970.089) [-967.108] (-968.166) (-977.154) -- 0:00:02
966000 -- [-970.029] (-966.861) (-967.479) (-967.213) * (-968.262) [-969.308] (-967.799) (-974.711) -- 0:00:02
966500 -- [-971.719] (-966.785) (-968.468) (-965.953) * (-970.038) [-967.584] (-971.175) (-966.212) -- 0:00:02
967000 -- [-967.188] (-972.562) (-966.352) (-967.089) * (-967.283) [-966.919] (-969.188) (-968.219) -- 0:00:02
967500 -- (-970.172) (-966.976) [-965.923] (-966.997) * (-970.070) (-967.023) (-968.028) [-970.963] -- 0:00:02
968000 -- [-965.646] (-967.745) (-967.187) (-967.276) * (-967.483) [-968.451] (-967.862) (-966.573) -- 0:00:01
968500 -- (-965.754) (-968.871) (-965.672) [-972.883] * (-967.333) [-967.988] (-966.200) (-969.209) -- 0:00:01
969000 -- (-970.456) (-967.358) (-967.042) [-969.431] * (-968.182) (-969.704) (-967.076) [-966.789] -- 0:00:01
969500 -- (-967.715) (-972.311) (-966.139) [-969.648] * [-971.602] (-967.159) (-969.009) (-966.467) -- 0:00:01
970000 -- [-967.583] (-970.292) (-968.338) (-968.677) * (-968.809) (-968.238) (-972.179) [-970.402] -- 0:00:01
Average standard deviation of split frequencies: 0.007163
970500 -- [-966.770] (-967.193) (-967.471) (-969.124) * (-968.857) (-967.923) (-968.078) [-967.740] -- 0:00:01
971000 -- [-967.961] (-966.988) (-967.749) (-968.967) * (-970.121) [-972.131] (-970.945) (-969.493) -- 0:00:01
971500 -- (-967.794) [-967.559] (-966.803) (-966.778) * (-969.800) (-968.646) [-971.535] (-969.644) -- 0:00:01
972000 -- (-967.724) (-968.840) [-972.503] (-969.630) * [-967.448] (-970.482) (-971.768) (-968.778) -- 0:00:01
972500 -- (-967.158) (-968.631) (-973.527) [-970.052] * (-966.549) [-967.069] (-969.589) (-967.917) -- 0:00:01
973000 -- (-967.695) (-968.428) (-968.032) [-967.556] * (-966.243) (-966.915) (-969.080) [-965.832] -- 0:00:01
973500 -- (-965.948) (-973.433) (-967.812) [-968.128] * (-967.288) (-966.350) (-967.413) [-967.733] -- 0:00:01
974000 -- [-966.383] (-969.004) (-969.247) (-966.919) * (-968.096) [-967.631] (-970.239) (-966.952) -- 0:00:01
974500 -- (-973.415) (-967.626) (-967.730) [-969.459] * (-969.843) [-966.046] (-968.031) (-967.144) -- 0:00:01
975000 -- (-973.938) (-967.996) [-966.242] (-966.644) * (-969.966) (-967.383) [-967.780] (-968.093) -- 0:00:01
Average standard deviation of split frequencies: 0.007003
975500 -- (-972.123) (-971.217) (-967.750) [-968.457] * (-966.847) (-965.994) [-966.841] (-970.646) -- 0:00:01
976000 -- (-967.933) [-968.510] (-967.568) (-966.152) * (-969.577) [-966.659] (-966.307) (-968.192) -- 0:00:01
976500 -- (-970.781) [-968.467] (-968.564) (-966.188) * (-967.273) [-971.351] (-969.005) (-967.769) -- 0:00:01
977000 -- [-970.061] (-969.534) (-967.724) (-966.906) * (-971.405) [-967.473] (-970.301) (-967.049) -- 0:00:01
977500 -- (-967.538) (-971.111) (-968.020) [-967.496] * (-967.710) (-966.556) [-968.158] (-968.195) -- 0:00:01
978000 -- (-971.405) [-966.812] (-966.786) (-968.434) * (-970.743) (-968.511) (-967.791) [-968.146] -- 0:00:01
978500 -- (-970.527) [-967.430] (-966.086) (-967.169) * (-969.557) [-968.289] (-965.816) (-969.714) -- 0:00:01
979000 -- [-968.617] (-969.100) (-968.146) (-966.197) * [-968.563] (-968.487) (-970.179) (-969.840) -- 0:00:01
979500 -- (-971.620) [-968.037] (-967.307) (-968.072) * (-973.441) (-967.506) (-968.678) [-967.993] -- 0:00:01
980000 -- (-970.310) (-967.271) (-967.745) [-968.092] * [-966.856] (-969.130) (-969.410) (-968.299) -- 0:00:01
Average standard deviation of split frequencies: 0.007150
980500 -- [-967.030] (-968.756) (-967.333) (-969.020) * (-968.974) (-968.992) [-973.946] (-968.485) -- 0:00:01
981000 -- (-968.602) (-968.081) (-966.895) [-968.136] * (-969.697) (-969.975) (-972.696) [-965.913] -- 0:00:01
981500 -- (-966.362) (-968.634) [-967.453] (-968.441) * (-967.009) (-972.414) [-969.011] (-966.366) -- 0:00:01
982000 -- [-966.229] (-968.665) (-972.124) (-968.401) * (-966.907) (-972.771) [-965.959] (-967.674) -- 0:00:01
982500 -- [-966.878] (-968.760) (-977.152) (-968.463) * [-967.466] (-967.540) (-967.784) (-967.899) -- 0:00:01
983000 -- [-965.917] (-971.495) (-968.977) (-969.808) * [-966.735] (-967.628) (-971.132) (-967.102) -- 0:00:01
983500 -- [-968.311] (-967.729) (-968.384) (-967.088) * [-967.049] (-967.000) (-972.428) (-966.968) -- 0:00:01
984000 -- (-968.511) [-967.482] (-967.074) (-968.003) * [-966.939] (-971.182) (-970.597) (-968.108) -- 0:00:00
984500 -- [-967.629] (-972.166) (-967.364) (-965.836) * (-971.116) (-969.846) (-966.666) [-967.944] -- 0:00:00
985000 -- (-968.385) (-968.744) (-967.057) [-966.308] * (-967.905) (-968.130) (-969.141) [-970.405] -- 0:00:00
Average standard deviation of split frequencies: 0.006903
985500 -- (-969.824) (-969.105) (-967.540) [-966.071] * (-970.400) (-966.573) [-966.444] (-968.610) -- 0:00:00
986000 -- [-973.010] (-966.342) (-970.397) (-968.393) * (-971.800) (-968.985) (-969.448) [-968.982] -- 0:00:00
986500 -- (-970.822) (-969.293) [-972.581] (-966.520) * [-968.327] (-967.536) (-967.489) (-967.573) -- 0:00:00
987000 -- [-966.781] (-970.383) (-968.618) (-973.009) * (-970.298) [-967.819] (-966.983) (-966.303) -- 0:00:00
987500 -- (-967.101) (-968.892) [-969.746] (-970.275) * (-965.934) (-968.538) (-967.538) [-966.302] -- 0:00:00
988000 -- (-969.751) (-968.273) [-969.768] (-972.038) * [-968.950] (-966.996) (-966.675) (-969.538) -- 0:00:00
988500 -- (-971.338) [-968.927] (-970.073) (-970.194) * (-968.697) (-968.067) [-966.941] (-967.686) -- 0:00:00
989000 -- (-975.097) (-967.174) (-969.094) [-966.540] * (-968.745) (-971.128) (-966.609) [-971.883] -- 0:00:00
989500 -- (-969.944) [-967.147] (-969.003) (-967.970) * (-970.128) (-972.002) [-965.999] (-967.883) -- 0:00:00
990000 -- (-967.080) [-966.666] (-969.332) (-966.903) * (-968.761) (-970.715) (-966.935) [-971.355] -- 0:00:00
Average standard deviation of split frequencies: 0.006989
990500 -- (-966.097) (-968.870) (-966.770) [-970.484] * (-972.655) [-972.969] (-968.434) (-971.934) -- 0:00:00
991000 -- (-969.518) (-965.643) (-967.343) [-966.815] * [-971.430] (-970.016) (-967.415) (-966.725) -- 0:00:00
991500 -- (-966.195) (-973.005) [-970.057] (-968.377) * (-970.237) (-966.831) (-967.863) [-967.079] -- 0:00:00
992000 -- (-968.273) [-973.175] (-969.218) (-968.171) * (-971.217) (-967.090) (-974.952) [-971.490] -- 0:00:00
992500 -- (-966.663) (-968.658) [-966.654] (-967.365) * (-968.618) (-966.713) (-970.094) [-969.590] -- 0:00:00
993000 -- (-969.102) (-972.114) [-968.827] (-970.037) * (-966.340) (-966.480) [-973.774] (-967.807) -- 0:00:00
993500 -- (-970.405) (-970.512) (-967.300) [-967.616] * (-966.416) (-971.540) [-969.937] (-966.186) -- 0:00:00
994000 -- [-968.169] (-967.274) (-969.075) (-967.549) * (-968.828) [-967.805] (-969.089) (-969.883) -- 0:00:00
994500 -- (-972.712) (-969.695) (-966.694) [-966.975] * (-970.047) [-968.051] (-966.556) (-967.152) -- 0:00:00
995000 -- (-967.811) (-968.324) (-967.154) [-966.929] * (-974.945) (-967.621) [-966.257] (-967.730) -- 0:00:00
Average standard deviation of split frequencies: 0.007040
995500 -- [-966.271] (-967.640) (-969.628) (-967.600) * [-967.291] (-973.281) (-966.436) (-968.120) -- 0:00:00
996000 -- (-971.145) [-966.912] (-968.073) (-968.011) * [-967.043] (-967.910) (-966.886) (-968.054) -- 0:00:00
996500 -- (-968.394) [-967.548] (-967.660) (-968.845) * [-966.279] (-967.382) (-969.658) (-967.023) -- 0:00:00
997000 -- (-968.034) (-967.309) [-966.881] (-971.787) * (-967.921) (-969.081) [-966.647] (-970.640) -- 0:00:00
997500 -- [-967.787] (-967.363) (-968.600) (-972.268) * (-970.475) [-970.030] (-968.969) (-966.968) -- 0:00:00
998000 -- (-971.444) (-970.523) [-970.627] (-967.500) * (-968.548) (-968.816) (-966.552) [-968.413] -- 0:00:00
998500 -- [-968.180] (-967.793) (-968.350) (-966.194) * (-972.634) (-967.807) (-968.857) [-968.706] -- 0:00:00
999000 -- (-968.665) (-968.726) (-967.904) [-967.331] * (-970.551) [-968.933] (-972.364) (-966.112) -- 0:00:00
999500 -- [-966.905] (-968.991) (-968.658) (-968.877) * (-968.385) [-968.303] (-967.751) (-969.873) -- 0:00:00
1000000 -- (-967.364) (-969.545) [-966.275] (-975.936) * (-966.101) (-970.287) [-967.390] (-968.867) -- 0:00:00
Average standard deviation of split frequencies: 0.007096
Analysis completed in 1 mins 1 seconds
Analysis used 59.91 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -965.47
Likelihood of best state for "cold" chain of run 2 was -965.47
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 64 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.1 % ( 25 %) Dirichlet(Pi{all})
29.6 % ( 24 %) Slider(Pi{all})
78.9 % ( 57 %) Multiplier(Alpha{1,2})
78.1 % ( 62 %) Multiplier(Alpha{3})
20.9 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.4 % ( 17 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.6 % ( 21 %) Dirichlet(Pi{all})
29.2 % ( 25 %) Slider(Pi{all})
78.5 % ( 51 %) Multiplier(Alpha{1,2})
77.9 % ( 50 %) Multiplier(Alpha{3})
20.2 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.6 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166467 0.83 0.67
3 | 166288 166781 0.84
4 | 166795 166176 167493
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166856 0.82 0.66
3 | 166743 166204 0.83
4 | 166274 166656 167267
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -967.17
| 2 |
| * 2 11 |
| 1 2 1 * 1* |
| 2 1 1 1 1 2 2 2 1 2 |
| 2 1 1 21 2 1 2 1 1 |
| 21 1 22 1 1 1* 1 |
| 11 2 22 1 2 2 2 2 21 2 1 21 1 1 |
| 2 1 2 1 221 1 1 21|
| 22 1 1 21 2 2 11 2 12 1 2 2 |
| 2 2 11 11 2 2 2 2 |
|11 1 2 2 1 12 *2 |
| 1 2 |
|2 1 2 * |
| 2|
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -968.95
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -967.19 -970.17
2 -967.21 -974.80
--------------------------------------
TOTAL -967.20 -974.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903391 0.089606 0.384863 1.506467 0.872232 1486.60 1493.80 1.000
r(A<->C){all} 0.169995 0.019407 0.000012 0.443251 0.132653 239.82 253.68 1.001
r(A<->G){all} 0.166639 0.020717 0.000194 0.447702 0.129383 220.40 287.66 1.001
r(A<->T){all} 0.158909 0.016903 0.000064 0.414085 0.126557 222.66 233.41 1.000
r(C<->G){all} 0.155790 0.019169 0.000005 0.433337 0.117153 194.57 275.03 1.007
r(C<->T){all} 0.175934 0.021372 0.000141 0.469963 0.138480 194.50 207.88 1.001
r(G<->T){all} 0.172732 0.019232 0.000052 0.440106 0.138036 231.22 243.69 1.003
pi(A){all} 0.234894 0.000251 0.202014 0.264733 0.234609 1344.91 1422.96 1.000
pi(C){all} 0.322224 0.000319 0.288836 0.358708 0.321720 1290.68 1363.35 1.000
pi(G){all} 0.288511 0.000290 0.255717 0.321201 0.288116 1095.92 1217.37 1.000
pi(T){all} 0.154371 0.000189 0.128584 0.180956 0.154099 1264.01 1365.61 1.000
alpha{1,2} 0.438822 0.247566 0.000185 1.465335 0.264255 1329.43 1389.19 1.001
alpha{3} 0.445926 0.221098 0.000116 1.438182 0.291907 1294.39 1300.20 1.000
pinvar{all} 0.997909 0.000006 0.993418 1.000000 0.998723 1374.24 1400.24 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- .**.**
9 -- ..*..*
10 -- ..****
11 -- .*..*.
12 -- ....**
13 -- .***.*
14 -- ..*.*.
15 -- .*.***
16 -- ..**..
17 -- ...**.
18 -- .*...*
19 -- .**...
20 -- ...*.*
21 -- .****.
22 -- ..*.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.005182 0.151233 0.158561 2
8 450 0.149900 0.007537 0.144570 0.155230 2
9 450 0.149900 0.000942 0.149234 0.150566 2
10 450 0.149900 0.017901 0.137242 0.162558 2
11 446 0.148568 0.003769 0.145903 0.151233 2
12 438 0.145903 0.008480 0.139907 0.151899 2
13 433 0.144237 0.004240 0.141239 0.147235 2
14 423 0.140906 0.012719 0.131912 0.149900 2
15 422 0.140573 0.001884 0.139241 0.141905 2
16 421 0.140240 0.008951 0.133911 0.146569 2
17 413 0.137575 0.019315 0.123917 0.151233 2
18 411 0.136909 0.004240 0.133911 0.139907 2
19 404 0.134577 0.000000 0.134577 0.134577 2
20 403 0.134244 0.004240 0.131246 0.137242 2
21 388 0.129247 0.003769 0.126582 0.131912 2
22 298 0.099267 0.010364 0.091939 0.106596 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100903 0.010692 0.000012 0.306781 0.069380 1.000 2
length{all}[2] 0.100462 0.010846 0.000100 0.310908 0.066848 1.000 2
length{all}[3] 0.098407 0.009474 0.000016 0.294060 0.068795 1.000 2
length{all}[4] 0.104563 0.010872 0.000049 0.319182 0.073521 1.000 2
length{all}[5] 0.097286 0.009199 0.000045 0.297343 0.067600 1.000 2
length{all}[6] 0.099406 0.009880 0.000035 0.307329 0.069292 1.000 2
length{all}[7] 0.103369 0.011467 0.000273 0.332994 0.071692 0.998 2
length{all}[8] 0.094544 0.010238 0.000221 0.302385 0.062923 0.998 2
length{all}[9] 0.103307 0.012347 0.000033 0.342436 0.063832 0.999 2
length{all}[10] 0.107602 0.012154 0.000081 0.334574 0.071665 1.001 2
length{all}[11] 0.100914 0.008967 0.000084 0.290656 0.069704 0.998 2
length{all}[12] 0.100262 0.009722 0.000040 0.297389 0.074567 0.998 2
length{all}[13] 0.095769 0.009611 0.000107 0.295676 0.064858 1.000 2
length{all}[14] 0.108682 0.013113 0.000023 0.329104 0.073815 1.005 2
length{all}[15] 0.104001 0.010085 0.000098 0.302622 0.073317 0.998 2
length{all}[16] 0.097039 0.009425 0.000077 0.305426 0.061387 0.998 2
length{all}[17] 0.095664 0.007814 0.000019 0.267478 0.068631 0.999 2
length{all}[18] 0.103921 0.013188 0.000058 0.337249 0.069800 0.998 2
length{all}[19] 0.092707 0.008291 0.000030 0.263272 0.068520 0.999 2
length{all}[20] 0.095346 0.008545 0.000023 0.266542 0.072100 1.006 2
length{all}[21] 0.101505 0.010350 0.000020 0.294476 0.073741 0.998 2
length{all}[22] 0.117639 0.013116 0.000091 0.375916 0.080730 1.006 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007096
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 714
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 238 / 238 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 238 / 238 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039128 0.026697 0.043868 0.106611 0.103737 0.034149 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1022.831718
Iterating by ming2
Initial: fx= 1022.831718
x= 0.03913 0.02670 0.04387 0.10661 0.10374 0.03415 0.30000 1.30000
1 h-m-p 0.0000 0.0001 570.4205 ++ 985.655928 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0035 86.8030 ++ 983.301822 m 0.0035 24 | 2/8
3 h-m-p 0.0000 0.0000 6362.1225 ++ 982.564033 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0057 235.4079 ++++ 959.177653 m 0.0057 48 | 4/8
5 h-m-p 0.0001 0.0006 24.0218 ++ 958.436878 m 0.0006 59 | 5/8
6 h-m-p 0.0001 0.0004 80.0769 ++ 951.660616 m 0.0004 70 | 6/8
7 h-m-p 0.0000 0.0001 50.1548 ++ 949.770335 m 0.0001 81 | 7/8
8 h-m-p 0.0160 8.0000 1.0553 -------------.. | 7/8
9 h-m-p 0.0000 0.0002 226.6812 +++ 940.072007 m 0.0002 115 | 8/8
10 h-m-p 0.0160 8.0000 0.0000 Y 940.072007 0 0.0160 126 | 8/8
11 h-m-p 0.0160 8.0000 0.0000 Y 940.072007 0 0.0160 137
Out..
lnL = -940.072007
138 lfun, 138 eigenQcodon, 828 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076509 0.020506 0.015154 0.103381 0.027627 0.055847 0.000100 0.546065 0.216768
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.883338
np = 9
lnL0 = -1007.493867
Iterating by ming2
Initial: fx= 1007.493867
x= 0.07651 0.02051 0.01515 0.10338 0.02763 0.05585 0.00011 0.54607 0.21677
1 h-m-p 0.0000 0.0000 533.2087 ++ 1006.542417 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0004 256.6091 +++ 986.846654 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0001 203.5778 ++ 982.471884 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0002 149.9600 ++ 977.710681 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0002 281.4731 ++ 963.193231 m 0.0002 63 | 5/9
6 h-m-p 0.0000 0.0001 901.9279 ++ 953.897515 m 0.0001 75 | 6/9
7 h-m-p 0.0000 0.0001 374.7169 ++ 951.540700 m 0.0001 87 | 7/9
8 h-m-p 0.0009 0.0184 16.9772 -----------.. | 7/9
9 h-m-p 0.0000 0.0002 223.2136 +++ 940.071992 m 0.0002 121 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 940.071992 m 8.0000 133 | 7/9
11 h-m-p -0.0000 -0.0000 0.0000
h-m-p: -6.00014882e-14 -3.00007441e-13 2.75026190e-06 940.071992
.. | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 940.071992 m 8.0000 160 | 7/9
13 h-m-p 0.0089 4.4393 0.1878 +++++ 940.071984 m 4.4393 177 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 Y 940.071984 0 1.6000 191 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 Y 940.071984 0 1.6000 204
Out..
lnL = -940.071984
205 lfun, 615 eigenQcodon, 2460 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.016567 0.082353 0.059124 0.079237 0.016633 0.072075 0.000100 1.560543 0.569080 0.405219 2.302816
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.290451
np = 11
lnL0 = -1012.002712
Iterating by ming2
Initial: fx= 1012.002712
x= 0.01657 0.08235 0.05912 0.07924 0.01663 0.07208 0.00011 1.56054 0.56908 0.40522 2.30282
1 h-m-p 0.0000 0.0000 512.4573 ++ 1011.197219 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 199.1691 ++++ 988.088820 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0000 238.2609 ++ 988.030143 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0018 155.1282 ++++ 953.808430 m 0.0018 62 | 4/11
5 h-m-p 0.0000 0.0000 496646.7426 ++ 950.835855 m 0.0000 76 | 5/11
6 h-m-p 0.0011 0.0070 9.8280 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 385.1608 ++ 944.482419 m 0.0000 113 | 6/11
8 h-m-p 0.0160 8.0000 4.9289 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 324.3866 ++ 940.871813 m 0.0000 152 | 7/11
10 h-m-p 0.0160 8.0000 1.6648 -------------.. | 7/11
11 h-m-p 0.0000 0.0000 233.7246 ++ 940.071988 m 0.0000 191 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 940.071988 m 8.0000 208 | 8/11
13 h-m-p 0.0227 8.0000 0.0017 ----Y 940.071988 0 0.0000 229 | 8/11
14 h-m-p 0.0160 8.0000 0.0002 ----N 940.071988 0 0.0000 250 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 -----------N 940.071988 0 0.0000 278
Out..
lnL = -940.071988
279 lfun, 1116 eigenQcodon, 5022 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -940.085218 S = -940.068838 -0.006276
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:03
did 20 / 53 patterns 0:03
did 30 / 53 patterns 0:03
did 40 / 53 patterns 0:03
did 50 / 53 patterns 0:03
did 53 / 53 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.028806 0.055435 0.077632 0.102004 0.022004 0.033623 0.000100 0.485425 1.048505
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.099246
np = 9
lnL0 = -1011.689473
Iterating by ming2
Initial: fx= 1011.689473
x= 0.02881 0.05544 0.07763 0.10200 0.02200 0.03362 0.00011 0.48543 1.04851
1 h-m-p 0.0000 0.0000 526.6721 ++ 1010.974370 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0080 60.9717 +++++ 989.441130 m 0.0080 29 | 2/9
3 h-m-p 0.0001 0.0007 182.7796 ++ 971.973354 m 0.0007 41 | 3/9
4 h-m-p 0.0001 0.0005 93.4052 ++ 959.922935 m 0.0005 53 | 4/9
5 h-m-p 0.0017 0.0084 8.2563 ------------.. | 4/9
6 h-m-p 0.0000 0.0000 462.2534 ++ 949.866330 m 0.0000 87 | 5/9
7 h-m-p 0.0160 8.0000 1.8728 -------------.. | 5/9
8 h-m-p 0.0000 0.0000 403.0525 ++ 942.083117 m 0.0000 122 | 6/9
9 h-m-p 0.0160 8.0000 1.5426 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 332.0331 ++ 940.905855 m 0.0000 157 | 7/9
11 h-m-p 0.0160 8.0000 1.0916 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 234.9402 ++ 940.072007 m 0.0000 192 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 Y 940.072007 0 1.6000 204 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 Y 940.072007 0 0.0160 217
QuantileBeta(0.15, 0.00494, 0.97737) = 4.207753e-162 2000 rounds
| 7/9
15 h-m-p 0.0883 8.0000 0.0000 N 940.072007 0 0.0883 231
QuantileBeta(0.15, 0.00494, 0.97737) = 4.211612e-162 2000 rounds
| 7/9
16 h-m-p 0.0160 8.0000 0.0000 -Y 940.072007 0 0.0010 246
QuantileBeta(0.15, 0.00494, 0.97737) = 4.215482e-162 2000 rounds
| 7/9
17 h-m-p 0.0001 0.0006 0.0001 ----------..
QuantileBeta(0.15, 0.00494, 0.97737) = 4.215482e-162 2000 rounds
| 7/9
18 h-m-p 0.0160 8.0000 0.0000 -------------
QuantileBeta(0.15, 0.00494, 0.97737) = 4.215482e-162 2000 rounds
| 7/9
19 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -940.072007
319 lfun, 3509 eigenQcodon, 19140 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.031216 0.082933 0.048414 0.095667 0.050903 0.072164 0.000100 0.900000 0.489236 1.275604 2.724796
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.678062
np = 11
lnL0 = -1016.773123
Iterating by ming2
Initial: fx= 1016.773123
x= 0.03122 0.08293 0.04841 0.09567 0.05090 0.07216 0.00011 0.90000 0.48924 1.27560 2.72480
1 h-m-p 0.0000 0.0000 435.7278 ++ 1016.442977 m 0.0000 27 | 1/11
2 h-m-p 0.0000 0.0001 750.5991 ++ 981.290420 m 0.0001 52 | 2/11
3 h-m-p 0.0000 0.0000 18064.8972 ++ 963.984044 m 0.0000 76 | 3/11
4 h-m-p 0.0014 0.0093 37.2151 ++ 952.999703 m 0.0093 99 | 4/11
5 h-m-p 0.0000 0.0000 31178.7333 ++ 948.598370 m 0.0000 121 | 5/11
6 h-m-p 0.0002 0.0009 14.5081 ++ 948.576439 m 0.0009 142 | 6/11
7 h-m-p 0.0000 0.0001 130.9462 ++ 946.193929 m 0.0001 162 | 7/11
8 h-m-p 0.0002 0.0167 12.8112 ++++ 941.874503 m 0.0167 183 | 7/11
9 h-m-p 0.0000 0.0000 276.0261
h-m-p: 0.00000000e+00 0.00000000e+00 2.76026119e+02 941.874503
.. | 7/11
10 h-m-p 0.0000 0.0000 234.0506 ++ 940.072007 m 0.0000 216 | 8/11
11 h-m-p 1.6000 8.0000 0.0000 ++ 940.072007 m 8.0000 234 | 7/11
12 h-m-p 0.0000 0.0000 68.9707
h-m-p: 6.22521897e-18 3.11260948e-17 6.89706926e+01 940.072007
.. | 7/11
13 h-m-p 0.0160 8.0000 0.0003 +++++ 940.072006 m 8.0000 269
QuantileBeta(0.15, 0.00495, 1.43701) = 7.534861e-163 2000 rounds
| 7/11
14 h-m-p 0.0436 8.0000 0.0517 ++++ 940.071983 m 8.0000 289 | 7/11
15 h-m-p 1.6000 8.0000 0.0182 ++ 940.071982 m 8.0000 307 | 7/11
16 h-m-p 0.3845 1.9223 0.2283 ++ 940.071980 m 1.9223 325 | 8/11
17 h-m-p 0.6589 8.0000 0.0009 ++ 940.071980 m 8.0000 343 | 8/11
18 h-m-p 0.0018 0.0091 0.9552 ----Y 940.071980 0 0.0000 364 | 8/11
19 h-m-p 0.0342 8.0000 0.0000 Y 940.071980 0 0.0688 381 | 8/11
20 h-m-p 0.0467 8.0000 0.0001 ++++ 940.071980 m 8.0000 400 | 8/11
21 h-m-p 0.0160 8.0000 0.1814 +++++ 940.071980 m 8.0000 420 | 8/11
22 h-m-p 0.1346 8.0000 10.7820 +++ 940.071978 m 8.0000 438 | 8/11
23 h-m-p 0.5552 2.7759 4.4166 ++ 940.071978 m 2.7759 455 | 8/11
24 h-m-p 0.0000 0.0000 53.5524
h-m-p: 0.00000000e+00 0.00000000e+00 5.35523975e+01 940.071978
.. | 8/11
25 h-m-p 0.0160 8.0000 0.0000 -C 940.071978 0 0.0010 487
Out..
lnL = -940.071978
488 lfun, 5856 eigenQcodon, 32208 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -940.067514 S = -940.066471 -0.000456
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:15
did 20 / 53 patterns 0:16
did 30 / 53 patterns 0:16
did 40 / 53 patterns 0:16
did 50 / 53 patterns 0:16
did 53 / 53 patterns 0:16
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=238
NC_011896_1_WP_010907501_1_67_MLBR_RS00335 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
NC_002677_1_NP_301176_1_48_ML0068 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
**************************************************
NC_011896_1_WP_010907501_1_67_MLBR_RS00335 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
NC_002677_1_NP_301176_1_48_ML0068 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355 KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
**************************************************
NC_011896_1_WP_010907501_1_67_MLBR_RS00335 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
NC_002677_1_NP_301176_1_48_ML0068 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355 VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
**************************************************
NC_011896_1_WP_010907501_1_67_MLBR_RS00335 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
NC_002677_1_NP_301176_1_48_ML0068 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355 VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
**************************************************
NC_011896_1_WP_010907501_1_67_MLBR_RS00335 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
NC_002677_1_NP_301176_1_48_ML0068 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355 SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
**************************************
>NC_011896_1_WP_010907501_1_67_MLBR_RS00335 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC GGAAGGCAGCGACC >NC_002677_1_NP_301176_1_48_ML0068 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC GGAAGGCAGCGACC >NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC GGAAGGCAGCGACC >NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC GGAAGGCAGCGACC >NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC GGAAGGCAGCGACC >NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355 ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC GGAAGGCAGCGACC
>NC_011896_1_WP_010907501_1_67_MLBR_RS00335 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT >NC_002677_1_NP_301176_1_48_ML0068 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT >NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT >NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT >NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT >NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355 MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
#NEXUS
[ID: 0224910771]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907501_1_67_MLBR_RS00335
NC_002677_1_NP_301176_1_48_ML0068
NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060
NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245
NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345
NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907501_1_67_MLBR_RS00335,
2 NC_002677_1_NP_301176_1_48_ML0068,
3 NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060,
4 NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245,
5 NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345,
6 NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06937971,2:0.06684789,3:0.06879487,4:0.07352074,5:0.06760012,6:0.06929151);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06937971,2:0.06684789,3:0.06879487,4:0.07352074,5:0.06760012,6:0.06929151);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -967.19 -970.17
2 -967.21 -974.80
--------------------------------------
TOTAL -967.20 -974.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.903391 0.089606 0.384863 1.506467 0.872232 1486.60 1493.80 1.000
r(A<->C){all} 0.169995 0.019407 0.000012 0.443251 0.132653 239.82 253.68 1.001
r(A<->G){all} 0.166639 0.020717 0.000194 0.447702 0.129383 220.40 287.66 1.001
r(A<->T){all} 0.158909 0.016903 0.000064 0.414085 0.126557 222.66 233.41 1.000
r(C<->G){all} 0.155790 0.019169 0.000005 0.433337 0.117153 194.57 275.03 1.007
r(C<->T){all} 0.175934 0.021372 0.000141 0.469963 0.138480 194.50 207.88 1.001
r(G<->T){all} 0.172732 0.019232 0.000052 0.440106 0.138036 231.22 243.69 1.003
pi(A){all} 0.234894 0.000251 0.202014 0.264733 0.234609 1344.91 1422.96 1.000
pi(C){all} 0.322224 0.000319 0.288836 0.358708 0.321720 1290.68 1363.35 1.000
pi(G){all} 0.288511 0.000290 0.255717 0.321201 0.288116 1095.92 1217.37 1.000
pi(T){all} 0.154371 0.000189 0.128584 0.180956 0.154099 1264.01 1365.61 1.000
alpha{1,2} 0.438822 0.247566 0.000185 1.465335 0.264255 1329.43 1389.19 1.001
alpha{3} 0.445926 0.221098 0.000116 1.438182 0.291907 1294.39 1300.20 1.000
pinvar{all} 0.997909 0.000006 0.993418 1.000000 0.998723 1374.24 1400.24 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0068/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 238
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 6 6 6 6 6 6 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 6 6 6 6 6 6
CTC 5 5 5 5 5 5 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 10 10 10 10 10 10
CTA 5 5 5 5 5 5 | CCA 3 3 3 3 3 3 | Gln CAA 4 4 4 4 4 4 | CGA 3 3 3 3 3 3
CTG 9 9 9 9 9 9 | CCG 3 3 3 3 3 3 | CAG 6 6 6 6 6 6 | CGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 8 8 8 8 8 8 | ACC 6 6 6 6 6 6 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 3 3 3 3 3 3 | ACA 2 2 2 2 2 2 | Lys AAA 8 8 8 8 8 8 | Arg AGA 1 1 1 1 1 1
Met ATG 5 5 5 5 5 5 | ACG 5 5 5 5 5 5 | AAG 9 9 9 9 9 9 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 8 8 8 8 8 8 | Asp GAT 2 2 2 2 2 2 | Gly GGT 0 0 0 0 0 0
GTC 3 3 3 3 3 3 | GCC 19 19 19 19 19 19 | GAC 8 8 8 8 8 8 | GGC 4 4 4 4 4 4
GTA 2 2 2 2 2 2 | GCA 7 7 7 7 7 7 | Glu GAA 5 5 5 5 5 5 | GGA 2 2 2 2 2 2
GTG 8 8 8 8 8 8 | GCG 8 8 8 8 8 8 | GAG 7 7 7 7 7 7 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907501_1_67_MLBR_RS00335
position 1: T:0.08824 C:0.29412 A:0.26050 G:0.35714
position 2: T:0.25630 C:0.32353 A:0.24370 G:0.17647
position 3: T:0.11765 C:0.34874 A:0.20168 G:0.33193
Average T:0.15406 C:0.32213 A:0.23529 G:0.28852
#2: NC_002677_1_NP_301176_1_48_ML0068
position 1: T:0.08824 C:0.29412 A:0.26050 G:0.35714
position 2: T:0.25630 C:0.32353 A:0.24370 G:0.17647
position 3: T:0.11765 C:0.34874 A:0.20168 G:0.33193
Average T:0.15406 C:0.32213 A:0.23529 G:0.28852
#3: NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060
position 1: T:0.08824 C:0.29412 A:0.26050 G:0.35714
position 2: T:0.25630 C:0.32353 A:0.24370 G:0.17647
position 3: T:0.11765 C:0.34874 A:0.20168 G:0.33193
Average T:0.15406 C:0.32213 A:0.23529 G:0.28852
#4: NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245
position 1: T:0.08824 C:0.29412 A:0.26050 G:0.35714
position 2: T:0.25630 C:0.32353 A:0.24370 G:0.17647
position 3: T:0.11765 C:0.34874 A:0.20168 G:0.33193
Average T:0.15406 C:0.32213 A:0.23529 G:0.28852
#5: NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345
position 1: T:0.08824 C:0.29412 A:0.26050 G:0.35714
position 2: T:0.25630 C:0.32353 A:0.24370 G:0.17647
position 3: T:0.11765 C:0.34874 A:0.20168 G:0.33193
Average T:0.15406 C:0.32213 A:0.23529 G:0.28852
#6: NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355
position 1: T:0.08824 C:0.29412 A:0.26050 G:0.35714
position 2: T:0.25630 C:0.32353 A:0.24370 G:0.17647
position 3: T:0.11765 C:0.34874 A:0.20168 G:0.33193
Average T:0.15406 C:0.32213 A:0.23529 G:0.28852
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 36 | TAC 0 | TGC 0
Leu L TTA 6 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 30 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 36
CTC 30 | CCC 6 | CAC 6 | CGC 60
CTA 30 | CCA 18 | Gln Q CAA 24 | CGA 18
CTG 54 | CCG 18 | CAG 36 | CGG 54
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 0
ATC 48 | ACC 36 | AAC 30 | AGC 24
ATA 18 | ACA 12 | Lys K AAA 48 | Arg R AGA 6
Met M ATG 30 | ACG 30 | AAG 54 | AGG 12
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 48 | Asp D GAT 12 | Gly G GGT 0
GTC 18 | GCC 114 | GAC 48 | GGC 24
GTA 12 | GCA 42 | Glu E GAA 30 | GGA 12
GTG 48 | GCG 48 | GAG 42 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.08824 C:0.29412 A:0.26050 G:0.35714
position 2: T:0.25630 C:0.32353 A:0.24370 G:0.17647
position 3: T:0.11765 C:0.34874 A:0.20168 G:0.33193
Average T:0.15406 C:0.32213 A:0.23529 G:0.28852
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -940.072007 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907501_1_67_MLBR_RS00335: 0.000004, NC_002677_1_NP_301176_1_48_ML0068: 0.000004, NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060: 0.000004, NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245: 0.000004, NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345: 0.000004, NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 541.3 172.7 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 541.3 172.7 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 541.3 172.7 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 541.3 172.7 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 541.3 172.7 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 541.3 172.7 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -940.071984 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.470342
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907501_1_67_MLBR_RS00335: 0.000004, NC_002677_1_NP_301176_1_48_ML0068: 0.000004, NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060: 0.000004, NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245: 0.000004, NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345: 0.000004, NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.47034 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 541.3 172.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 541.3 172.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 541.3 172.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 541.3 172.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 541.3 172.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 541.3 172.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -940.071988 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.654256 0.216196 0.000001 2.340332
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907501_1_67_MLBR_RS00335: 0.000004, NC_002677_1_NP_301176_1_48_ML0068: 0.000004, NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060: 0.000004, NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245: 0.000004, NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345: 0.000004, NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.65426 0.21620 0.12955
w: 0.00000 1.00000 2.34033
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 541.3 172.7 0.5194 0.0000 0.0000 0.0 0.0
7..2 0.000 541.3 172.7 0.5194 0.0000 0.0000 0.0 0.0
7..3 0.000 541.3 172.7 0.5194 0.0000 0.0000 0.0 0.0
7..4 0.000 541.3 172.7 0.5194 0.0000 0.0000 0.0 0.0
7..5 0.000 541.3 172.7 0.5194 0.0000 0.0000 0.0 0.0
7..6 0.000 541.3 172.7 0.5194 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907501_1_67_MLBR_RS00335)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907501_1_67_MLBR_RS00335)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 9): -940.072007 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.977367
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907501_1_67_MLBR_RS00335: 0.000004, NC_002677_1_NP_301176_1_48_ML0068: 0.000004, NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060: 0.000004, NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245: 0.000004, NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345: 0.000004, NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.97737
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 541.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 541.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 541.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 541.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 541.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 541.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -940.071978 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 99.000000 1.851297 16.940797
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907501_1_67_MLBR_RS00335: 0.000004, NC_002677_1_NP_301176_1_48_ML0068: 0.000004, NZ_LVXE01000014_1_WP_010907501_1_511_A3216_RS06060: 0.000004, NZ_LYPH01000018_1_WP_010907501_1_688_A8144_RS03245: 0.000004, NZ_CP029543_1_WP_010907501_1_66_DIJ64_RS00345: 0.000004, NZ_AP014567_1_WP_010907501_1_68_JK2ML_RS00355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 99.00000 q = 1.85130
(p1 = 0.99999) w = 16.94080
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.95574 0.96868 0.97512 0.97961 0.98316 0.98618 0.98890 0.99146 0.99403 0.99701 16.94080
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 541.3 172.7 16.9406 0.0000 0.0000 0.0 0.0
7..2 0.000 541.3 172.7 16.9406 0.0000 0.0000 0.0 0.0
7..3 0.000 541.3 172.7 16.9406 0.0000 0.0000 0.0 0.0
7..4 0.000 541.3 172.7 16.9406 0.0000 0.0000 0.0 0.0
7..5 0.000 541.3 172.7 16.9406 0.0000 0.0000 0.0 0.0
7..6 0.000 541.3 172.7 16.9406 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907501_1_67_MLBR_RS00335)
Pr(w>1) post mean +- SE for w
1 M 1.000** 16.941
2 G 1.000** 16.941
3 L 1.000** 16.941
4 F 1.000** 16.941
5 H 1.000** 16.941
6 K 1.000** 16.941
7 R 1.000** 16.941
8 R 1.000** 16.941
9 S 1.000** 16.941
10 R 1.000** 16.941
11 A 1.000** 16.941
12 M 1.000** 16.941
13 R 1.000** 16.941
14 R 1.000** 16.941
15 A 1.000** 16.941
16 E 1.000** 16.941
17 A 1.000** 16.941
18 R 1.000** 16.941
19 A 1.000** 16.941
20 I 1.000** 16.941
21 K 1.000** 16.941
22 A 1.000** 16.941
23 R 1.000** 16.941
24 A 1.000** 16.941
25 K 1.000** 16.941
26 L 1.000** 16.941
27 E 1.000** 16.941
28 A 1.000** 16.941
29 R 1.000** 16.941
30 L 1.000** 16.941
31 A 1.000** 16.941
32 A 1.000** 16.941
33 K 1.000** 16.941
34 N 1.000** 16.941
35 E 1.000** 16.941
36 A 1.000** 16.941
37 R 1.000** 16.941
38 R 1.000** 16.941
39 L 1.000** 16.941
40 N 1.000** 16.941
41 S 1.000** 16.941
42 A 1.000** 16.941
43 Q 1.000** 16.941
44 R 1.000** 16.941
45 A 1.000** 16.941
46 T 1.000** 16.941
47 N 1.000** 16.941
48 K 1.000** 16.941
49 A 1.000** 16.941
50 L 1.000** 16.941
51 K 1.000** 16.941
52 A 1.000** 16.941
53 Q 1.000** 16.941
54 L 1.000** 16.941
55 K 1.000** 16.941
56 A 1.000** 16.941
57 K 1.000** 16.941
58 R 1.000** 16.941
59 N 1.000** 16.941
60 S 1.000** 16.941
61 D 1.000** 16.941
62 R 1.000** 16.941
63 V 1.000** 16.941
64 A 1.000** 16.941
65 L 1.000** 16.941
66 K 1.000** 16.941
67 V 1.000** 16.941
68 A 1.000** 16.941
69 E 1.000** 16.941
70 T 1.000** 16.941
71 E 1.000** 16.941
72 L 1.000** 16.941
73 K 1.000** 16.941
74 A 1.000** 16.941
75 A 1.000** 16.941
76 K 1.000** 16.941
77 E 1.000** 16.941
78 G 1.000** 16.941
79 K 1.000** 16.941
80 L 1.000** 16.941
81 L 1.000** 16.941
82 S 1.000** 16.941
83 P 1.000** 16.941
84 T 1.000** 16.941
85 R 1.000** 16.941
86 I 1.000** 16.941
87 R 1.000** 16.941
88 R 1.000** 16.941
89 V 1.000** 16.941
90 L 1.000** 16.941
91 T 1.000** 16.941
92 V 1.000** 16.941
93 S 1.000** 16.941
94 R 1.000** 16.941
95 L 1.000** 16.941
96 L 1.000** 16.941
97 A 1.000** 16.941
98 P 1.000** 16.941
99 I 1.000** 16.941
100 V 1.000** 16.941
101 V 1.000** 16.941
102 P 1.000** 16.941
103 L 1.000** 16.941
104 I 1.000** 16.941
105 Y 1.000** 16.941
106 R 1.000** 16.941
107 A 1.000** 16.941
108 A 1.000** 16.941
109 I 1.000** 16.941
110 A 1.000** 16.941
111 T 1.000** 16.941
112 R 1.000** 16.941
113 A 1.000** 16.941
114 L 1.000** 16.941
115 I 1.000** 16.941
116 D 1.000** 16.941
117 Q 1.000** 16.941
118 R 1.000** 16.941
119 R 1.000** 16.941
120 A 1.000** 16.941
121 D 1.000** 16.941
122 Q 1.000** 16.941
123 L 1.000** 16.941
124 G 1.000** 16.941
125 I 1.000** 16.941
126 P 1.000** 16.941
127 L 1.000** 16.941
128 A 1.000** 16.941
129 Q 1.000** 16.941
130 I 1.000** 16.941
131 G 1.000** 16.941
132 Q 1.000** 16.941
133 F 1.000** 16.941
134 S 1.000** 16.941
135 G 1.000** 16.941
136 P 1.000** 16.941
137 S 1.000** 16.941
138 A 1.000** 16.941
139 R 1.000** 16.941
140 L 1.000** 16.941
141 S 1.000** 16.941
142 A 1.000** 16.941
143 R 1.000** 16.941
144 I 1.000** 16.941
145 A 1.000** 16.941
146 R 1.000** 16.941
147 S 1.000** 16.941
148 E 1.000** 16.941
149 Q 1.000** 16.941
150 S 1.000** 16.941
151 V 1.000** 16.941
152 L 1.000** 16.941
153 L 1.000** 16.941
154 V 1.000** 16.941
155 Q 1.000** 16.941
156 E 1.000** 16.941
157 K 1.000** 16.941
158 K 1.000** 16.941
159 P 1.000** 16.941
160 K 1.000** 16.941
161 D 1.000** 16.941
162 A 1.000** 16.941
163 E 1.000** 16.941
164 T 1.000** 16.941
165 K 1.000** 16.941
166 Q 1.000** 16.941
167 F 1.000** 16.941
168 V 1.000** 16.941
169 S 1.000** 16.941
170 T 1.000** 16.941
171 I 1.000** 16.941
172 T 1.000** 16.941
173 E 1.000** 16.941
174 R 1.000** 16.941
175 L 1.000** 16.941
176 I 1.000** 16.941
177 D 1.000** 16.941
178 L 1.000** 16.941
179 S 1.000** 16.941
180 A 1.000** 16.941
181 A 1.000** 16.941
182 V 1.000** 16.941
183 A 1.000** 16.941
184 A 1.000** 16.941
185 V 1.000** 16.941
186 E 1.000** 16.941
187 N 1.000** 16.941
188 M 1.000** 16.941
189 P 1.000** 16.941
190 A 1.000** 16.941
191 T 1.000** 16.941
192 R 1.000** 16.941
193 R 1.000** 16.941
194 R 1.000** 16.941
195 A 1.000** 16.941
196 V 1.000** 16.941
197 H 1.000** 16.941
198 S 1.000** 16.941
199 T 1.000** 16.941
200 I 1.000** 16.941
201 S 1.000** 16.941
202 S 1.000** 16.941
203 Q 1.000** 16.941
204 L 1.000** 16.941
205 D 1.000** 16.941
206 G 1.000** 16.941
207 I 1.000** 16.941
208 E 1.000** 16.941
209 A 1.000** 16.941
210 D 1.000** 16.941
211 L 1.000** 16.941
212 M 1.000** 16.941
213 A 1.000** 16.941
214 R 1.000** 16.941
215 L 1.000** 16.941
216 G 1.000** 16.941
217 V 1.000** 16.941
218 D 1.000** 16.941
219 L 1.000** 16.941
220 T 1.000** 16.941
221 T 1.000** 16.941
222 S 1.000** 16.941
223 M 1.000** 16.941
224 A 1.000** 16.941
225 D 1.000** 16.941
226 N 1.000** 16.941
227 R 1.000** 16.941
228 S 1.000** 16.941
229 V 1.000** 16.941
230 A 1.000** 16.941
231 D 1.000** 16.941
232 S 1.000** 16.941
233 T 1.000** 16.941
234 R 1.000** 16.941
235 K 1.000** 16.941
236 A 1.000** 16.941
237 A 1.000** 16.941
238 T 1.000** 16.941
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907501_1_67_MLBR_RS00335)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:16
Model 1: NearlyNeutral -940.071984 Model 2: PositiveSelection -940.071988 Model 0: one-ratio -940.072007 Model 7: beta -940.072007 Model 8: beta&w>1 -940.071978 Model 0 vs 1 4.5999999883861165E-5 Model 2 vs 1 7.999999979801942E-6 Model 8 vs 7 5.800000008093775E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
