--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:35:39 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0068/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -967.19          -970.17
2       -967.21          -974.80
--------------------------------------
TOTAL     -967.20          -974.11
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.903391    0.089606    0.384863    1.506467    0.872232   1486.60   1493.80    1.000
r(A<->C){all}   0.169995    0.019407    0.000012    0.443251    0.132653    239.82    253.68    1.001
r(A<->G){all}   0.166639    0.020717    0.000194    0.447702    0.129383    220.40    287.66    1.001
r(A<->T){all}   0.158909    0.016903    0.000064    0.414085    0.126557    222.66    233.41    1.000
r(C<->G){all}   0.155790    0.019169    0.000005    0.433337    0.117153    194.57    275.03    1.007
r(C<->T){all}   0.175934    0.021372    0.000141    0.469963    0.138480    194.50    207.88    1.001
r(G<->T){all}   0.172732    0.019232    0.000052    0.440106    0.138036    231.22    243.69    1.003
pi(A){all}      0.234894    0.000251    0.202014    0.264733    0.234609   1344.91   1422.96    1.000
pi(C){all}      0.322224    0.000319    0.288836    0.358708    0.321720   1290.68   1363.35    1.000
pi(G){all}      0.288511    0.000290    0.255717    0.321201    0.288116   1095.92   1217.37    1.000
pi(T){all}      0.154371    0.000189    0.128584    0.180956    0.154099   1264.01   1365.61    1.000
alpha{1,2}      0.438822    0.247566    0.000185    1.465335    0.264255   1329.43   1389.19    1.001
alpha{3}        0.445926    0.221098    0.000116    1.438182    0.291907   1294.39   1300.20    1.000
pinvar{all}     0.997909    0.000006    0.993418    1.000000    0.998723   1374.24   1400.24    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-940.071984
Model 2: PositiveSelection	-940.071988
Model 0: one-ratio	-940.072007
Model 7: beta	-940.072007
Model 8: beta&w>1	-940.071978


Model 0 vs 1	4.5999999883861165E-5

Model 2 vs 1	7.999999979801942E-6

Model 8 vs 7	5.800000008093775E-5
>C1
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C2
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C3
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C4
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C5
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C6
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=238 

C1              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C2              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C3              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C4              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C5              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C6              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
                **************************************************

C1              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C2              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C3              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C4              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C5              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C6              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
                **************************************************

C1              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C2              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C3              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C4              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C5              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C6              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
                **************************************************

C1              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C2              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C3              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C4              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C5              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C6              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
                **************************************************

C1              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C2              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C3              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C4              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C5              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C6              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
                **************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7140]--->[7140]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.480 Mb, Max= 30.778 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C2              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C3              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C4              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C5              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
C6              MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
                **************************************************

C1              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C2              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C3              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C4              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C5              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
C6              KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
                **************************************************

C1              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C2              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C3              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C4              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C5              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
C6              VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
                **************************************************

C1              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C2              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C3              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C4              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C5              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
C6              VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
                **************************************************

C1              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C2              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C3              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C4              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C5              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
C6              SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
                **************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C2              ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C3              ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C4              ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C5              ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
C6              ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
                **************************************************

C1              CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C2              CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C3              CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C4              CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C5              CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
C6              CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
                **************************************************

C1              ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C2              ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C3              ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C4              ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C5              ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
C6              ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
                **************************************************

C1              AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C2              AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C3              AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C4              AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C5              AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
C6              AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
                **************************************************

C1              CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C2              CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C3              CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C4              CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C5              CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
C6              CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
                **************************************************

C1              CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C2              CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C3              CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C4              CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C5              CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
C6              CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
                **************************************************

C1              GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C2              GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C3              GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C4              GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C5              GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
C6              GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
                **************************************************

C1              GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C2              GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C3              GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C4              GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C5              GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
C6              GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
                **************************************************

C1              CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C2              CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C3              CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C4              CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C5              CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
C6              CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
                **************************************************

C1              GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C2              GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C3              GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C4              GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C5              GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
C6              GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
                **************************************************

C1              CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C2              CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C3              CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C4              CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C5              CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
C6              CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
                **************************************************

C1              CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C2              CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C3              CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C4              CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C5              CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
C6              CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
                **************************************************

C1              TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C2              TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C3              TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C4              TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C5              TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
C6              TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
                **************************************************

C1              TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C2              TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C3              TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C4              TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C5              TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
C6              TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
                **************************************************

C1              GGAAGGCAGCGACC
C2              GGAAGGCAGCGACC
C3              GGAAGGCAGCGACC
C4              GGAAGGCAGCGACC
C5              GGAAGGCAGCGACC
C6              GGAAGGCAGCGACC
                **************



>C1
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C2
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C3
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C4
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C5
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C6
ATGGGACTGTTCCACAAGCGAAGGAGCCGTGCGATGCGTCGCGCCGAAGC
CCGTGCAATTAAGGCCCGCGCCAAACTTGAGGCCCGACTGGCCGCCAAAA
ACGAAGCTCGCCGTCTGAACAGCGCTCAGCGCGCCACCAACAAGGCCCTC
AAAGCCCAATTAAAAGCTAAACGAAACAGCGACCGCGTAGCGCTAAAAGT
CGCCGAGACAGAGCTCAAGGCAGCCAAGGAAGGCAAGTTGCTATCGCCAA
CTAGGATCCGCCGGGTGCTGACGGTGTCTCGGCTGCTGGCTCCAATCGTG
GTGCCGTTGATATATCGCGCAGCCATAGCCACCCGCGCGCTAATCGACCA
GCGTCGGGCGGATCAGCTCGGCATTCCACTAGCTCAGATCGGCCAGTTCT
CCGGACCCAGCGCGCGGCTGTCGGCGCGCATAGCCAGATCCGAGCAATCG
GTGCTGCTCGTGCAAGAGAAAAAGCCGAAAGACGCCGAGACCAAGCAGTT
CGTCTCCACGATCACCGAACGGCTAATCGATCTTTCAGCTGCTGTCGCCG
CCGTGGAGAATATGCCGGCCACGCGTCGCCGGGCAGTGCATTCCACGATC
TCATCGCAACTCGACGGCATCGAAGCAGACCTTATGGCACGGCTTGGGGT
TGACCTGACCACGTCCATGGCTGACAACCGGTCCGTAGCGGACTCGACAC
GGAAGGCAGCGACC
>C1
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C2
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C3
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C4
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C5
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT
>C6
MGLFHKRRSRAMRRAEARAIKARAKLEARLAAKNEARRLNSAQRATNKAL
KAQLKAKRNSDRVALKVAETELKAAKEGKLLSPTRIRRVLTVSRLLAPIV
VPLIYRAAIATRALIDQRRADQLGIPLAQIGQFSGPSARLSARIARSEQS
VLLVQEKKPKDAETKQFVSTITERLIDLSAAVAAVENMPATRRRAVHSTI
SSQLDGIEADLMARLGVDLTTSMADNRSVADSTRKAAT


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 714 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790060
      Setting output file names to "/data/3res/ML0068/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1787256145
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0224910771
      Seed = 1299738387
      Swapseed = 1579790060
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1597.966145 -- -24.965149
         Chain 2 -- -1597.966236 -- -24.965149
         Chain 3 -- -1597.966236 -- -24.965149
         Chain 4 -- -1597.966236 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1597.966236 -- -24.965149
         Chain 2 -- -1597.966236 -- -24.965149
         Chain 3 -- -1597.966236 -- -24.965149
         Chain 4 -- -1597.966236 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1597.966] (-1597.966) (-1597.966) (-1597.966) * [-1597.966] (-1597.966) (-1597.966) (-1597.966) 
        500 -- (-980.918) [-976.243] (-998.883) (-980.673) * (-973.346) [-980.107] (-992.547) (-976.045) -- 0:00:00
       1000 -- (-977.752) (-971.532) (-978.915) [-975.321] * (-974.551) (-973.486) (-977.202) [-978.824] -- 0:16:39
       1500 -- (-974.896) (-974.187) (-978.196) [-976.578] * (-974.796) [-974.039] (-973.346) (-975.975) -- 0:11:05
       2000 -- [-975.355] (-980.102) (-972.619) (-985.772) * (-975.004) (-976.972) [-971.693] (-971.185) -- 0:08:19
       2500 -- (-976.131) [-978.002] (-979.949) (-973.500) * (-983.677) (-973.442) [-974.101] (-977.863) -- 0:06:39
       3000 -- [-974.580] (-976.550) (-975.353) (-982.389) * (-973.592) (-988.915) [-980.405] (-972.485) -- 0:05:32
       3500 -- (-978.800) (-971.056) [-973.623] (-977.024) * [-969.073] (-983.636) (-975.874) (-976.186) -- 0:04:44
       4000 -- (-981.502) (-977.292) (-974.440) [-974.278] * (-985.234) (-978.591) [-978.883] (-984.708) -- 0:04:09
       4500 -- (-981.226) [-976.028] (-979.468) (-976.647) * (-975.524) (-983.471) [-975.986] (-979.850) -- 0:03:41
       5000 -- (-977.244) (-975.118) (-983.564) [-985.886] * (-977.167) (-980.169) [-977.248] (-980.496) -- 0:03:19

      Average standard deviation of split frequencies: 0.109311

       5500 -- [-972.414] (-975.682) (-982.867) (-976.865) * [-972.212] (-987.332) (-970.305) (-975.249) -- 0:03:00
       6000 -- (-976.616) (-977.094) [-973.659] (-980.055) * (-981.146) (-982.802) [-971.079] (-973.615) -- 0:02:45
       6500 -- [-985.862] (-977.042) (-977.401) (-975.091) * [-976.903] (-979.150) (-978.098) (-977.461) -- 0:02:32
       7000 -- (-973.600) [-983.015] (-976.067) (-976.378) * [-978.461] (-976.143) (-976.570) (-979.590) -- 0:02:21
       7500 -- (-974.210) (-979.659) [-979.518] (-977.159) * [-975.324] (-976.981) (-973.260) (-985.909) -- 0:02:12
       8000 -- (-973.047) (-981.337) (-981.162) [-975.382] * (-971.336) (-974.091) [-978.089] (-980.266) -- 0:02:04
       8500 -- (-979.589) [-975.080] (-980.671) (-979.941) * (-984.861) (-978.251) [-972.256] (-985.008) -- 0:01:56
       9000 -- (-972.396) (-976.671) [-973.674] (-981.692) * (-981.566) (-985.789) (-978.349) [-974.232] -- 0:01:50
       9500 -- [-982.672] (-988.311) (-989.670) (-973.955) * [-975.428] (-983.643) (-981.078) (-975.965) -- 0:01:44
      10000 -- (-972.778) [-973.861] (-973.683) (-979.620) * (-978.537) (-981.995) [-971.302] (-979.639) -- 0:01:39

      Average standard deviation of split frequencies: 0.057452

      10500 -- (-981.091) (-977.181) (-977.285) [-975.424] * (-974.334) (-979.038) [-973.124] (-979.776) -- 0:01:34
      11000 -- (-977.654) [-977.588] (-973.288) (-973.560) * (-985.247) (-976.713) [-971.642] (-974.484) -- 0:01:29
      11500 -- (-977.996) (-976.682) [-966.216] (-975.145) * (-981.288) (-990.617) (-976.908) [-973.121] -- 0:01:25
      12000 -- [-981.081] (-980.108) (-965.922) (-975.570) * (-975.309) (-966.605) [-975.088] (-981.861) -- 0:01:22
      12500 -- (-976.037) (-979.055) [-967.487] (-976.830) * (-986.374) (-968.582) (-982.466) [-973.363] -- 0:01:19
      13000 -- (-980.925) (-969.989) (-967.761) [-974.396] * [-973.446] (-967.242) (-982.999) (-980.789) -- 0:01:15
      13500 -- (-975.941) [-980.953] (-967.552) (-976.762) * (-972.279) [-967.680] (-976.353) (-976.604) -- 0:01:13
      14000 -- [-976.521] (-977.321) (-970.290) (-976.391) * (-970.736) [-965.989] (-984.753) (-978.324) -- 0:01:10
      14500 -- (-978.567) [-979.273] (-965.915) (-973.302) * (-974.787) (-968.045) [-978.287] (-976.394) -- 0:01:07
      15000 -- (-971.645) (-978.552) [-965.889] (-979.649) * (-969.481) (-966.746) [-977.859] (-975.856) -- 0:01:05

      Average standard deviation of split frequencies: 0.068746

      15500 -- (-978.488) (-971.762) (-968.027) [-971.146] * (-969.018) (-968.950) (-978.129) [-972.466] -- 0:02:07
      16000 -- [-972.827] (-975.396) (-968.019) (-979.963) * (-967.710) [-967.091] (-971.633) (-981.312) -- 0:02:03
      16500 -- (-978.297) (-973.968) [-969.062] (-971.825) * (-969.232) [-966.954] (-977.280) (-983.178) -- 0:01:59
      17000 -- (-979.154) (-977.993) [-968.503] (-972.804) * (-969.448) [-970.202] (-974.000) (-980.347) -- 0:01:55
      17500 -- (-981.387) (-977.563) (-966.743) [-978.522] * (-966.562) [-969.117] (-976.155) (-974.891) -- 0:01:52
      18000 -- (-977.254) [-973.365] (-969.775) (-974.890) * [-967.775] (-970.529) (-972.162) (-977.061) -- 0:01:49
      18500 -- (-968.713) (-974.342) (-970.265) [-975.989] * (-967.779) (-968.540) (-975.612) [-972.322] -- 0:01:46
      19000 -- (-976.848) (-979.790) (-969.362) [-977.594] * (-967.781) [-969.607] (-976.587) (-977.461) -- 0:01:43
      19500 -- (-972.185) (-975.372) [-969.933] (-978.649) * [-966.438] (-967.987) (-971.438) (-981.424) -- 0:01:40
      20000 -- (-982.746) (-978.648) (-967.573) [-980.962] * (-967.510) (-967.401) (-975.450) [-980.683] -- 0:01:38

      Average standard deviation of split frequencies: 0.045620

      20500 -- [-975.174] (-977.538) (-969.845) (-974.329) * [-967.078] (-972.550) (-976.556) (-985.462) -- 0:01:35
      21000 -- [-972.413] (-974.836) (-967.124) (-972.901) * (-967.315) (-967.874) (-982.809) [-967.510] -- 0:01:33
      21500 -- [-976.545] (-981.529) (-968.083) (-974.269) * (-966.734) (-973.003) [-974.792] (-966.727) -- 0:01:31
      22000 -- (-980.029) [-975.184] (-969.155) (-981.749) * [-969.307] (-969.273) (-974.832) (-966.124) -- 0:01:28
      22500 -- (-975.535) [-975.146] (-969.786) (-973.950) * [-966.569] (-969.562) (-974.985) (-966.132) -- 0:01:26
      23000 -- (-975.388) (-972.982) (-969.113) [-977.668] * [-968.448] (-969.218) (-983.577) (-966.070) -- 0:01:24
      23500 -- (-981.053) (-977.285) (-972.190) [-977.982] * (-966.308) (-970.575) (-977.235) [-966.966] -- 0:01:23
      24000 -- [-980.503] (-975.287) (-967.722) (-972.816) * (-969.970) (-969.858) (-989.953) [-967.334] -- 0:01:21
      24500 -- (-972.463) [-984.835] (-966.346) (-976.695) * (-968.846) (-969.036) (-983.261) [-968.272] -- 0:01:19
      25000 -- [-978.597] (-980.700) (-967.048) (-971.448) * (-966.845) (-974.790) [-973.239] (-967.189) -- 0:01:18

      Average standard deviation of split frequencies: 0.036262

      25500 -- (-979.697) [-973.079] (-967.433) (-974.350) * (-966.950) (-968.683) [-977.748] (-966.451) -- 0:01:16
      26000 -- [-977.249] (-979.109) (-966.183) (-980.773) * (-967.511) (-966.545) (-972.761) [-966.682] -- 0:01:14
      26500 -- [-977.888] (-981.487) (-965.692) (-970.404) * (-968.955) [-969.217] (-981.599) (-967.570) -- 0:01:13
      27000 -- [-978.115] (-973.697) (-966.897) (-981.409) * (-966.210) (-971.208) [-978.095] (-968.305) -- 0:01:12
      27500 -- [-974.335] (-982.207) (-967.166) (-978.744) * [-967.434] (-971.208) (-980.588) (-968.246) -- 0:01:10
      28000 -- [-975.814] (-977.990) (-966.031) (-981.656) * (-966.491) (-967.573) (-973.698) [-965.915] -- 0:01:09
      28500 -- (-979.365) (-977.898) (-967.207) [-984.624] * (-966.949) [-970.403] (-979.464) (-966.362) -- 0:01:08
      29000 -- [-975.028] (-979.160) (-966.907) (-982.202) * [-966.859] (-973.264) (-978.769) (-967.957) -- 0:01:06
      29500 -- (-975.364) (-974.001) (-966.406) [-973.658] * (-967.053) [-971.523] (-977.614) (-969.406) -- 0:01:05
      30000 -- (-974.337) (-984.091) [-969.459] (-977.817) * [-966.205] (-968.311) (-979.266) (-966.788) -- 0:01:04

      Average standard deviation of split frequencies: 0.039198

      30500 -- (-976.149) (-990.490) (-967.749) [-980.794] * (-968.352) [-966.936] (-974.032) (-966.822) -- 0:01:03
      31000 -- (-975.954) [-982.406] (-967.178) (-1001.166) * (-967.371) [-966.515] (-984.964) (-968.820) -- 0:01:02
      31500 -- [-973.438] (-975.645) (-972.057) (-966.456) * (-966.684) (-967.229) (-973.354) [-970.446] -- 0:01:32
      32000 -- (-976.224) (-976.748) (-969.165) [-967.746] * [-966.644] (-967.423) (-976.596) (-968.761) -- 0:01:30
      32500 -- (-975.565) (-967.907) [-966.984] (-967.517) * (-967.278) (-967.373) (-979.864) [-968.423] -- 0:01:29
      33000 -- (-975.246) [-968.428] (-966.832) (-968.147) * (-966.830) (-968.979) (-979.577) [-966.667] -- 0:01:27
      33500 -- (-973.811) [-967.635] (-967.398) (-967.096) * (-967.693) [-969.036] (-976.697) (-968.016) -- 0:01:26
      34000 -- (-977.390) (-966.952) [-967.889] (-966.435) * (-968.754) (-970.138) (-973.910) [-968.365] -- 0:01:25
      34500 -- (-973.497) (-969.656) [-966.752] (-968.614) * (-968.047) (-969.563) (-974.788) [-968.796] -- 0:01:23
      35000 -- [-979.700] (-969.817) (-967.198) (-968.032) * (-967.296) (-967.416) [-982.330] (-966.188) -- 0:01:22

      Average standard deviation of split frequencies: 0.035117

      35500 -- (-972.339) (-966.870) [-967.737] (-967.534) * (-967.771) [-967.812] (-976.790) (-972.722) -- 0:01:21
      36000 -- (-985.307) [-966.289] (-969.258) (-966.120) * (-968.218) [-966.260] (-976.011) (-967.998) -- 0:01:20
      36500 -- [-977.276] (-967.226) (-967.701) (-970.710) * (-969.427) (-965.809) [-977.110] (-967.245) -- 0:01:19
      37000 -- [-975.963] (-968.536) (-967.283) (-970.783) * (-968.443) [-966.074] (-978.661) (-968.254) -- 0:01:18
      37500 -- [-977.872] (-967.229) (-966.087) (-971.714) * (-968.155) (-968.583) (-975.457) [-967.079] -- 0:01:17
      38000 -- (-982.793) (-967.360) (-967.904) [-969.841] * (-971.237) (-968.866) (-979.076) [-968.089] -- 0:01:15
      38500 -- (-981.227) (-968.768) [-968.509] (-968.637) * (-966.848) (-967.746) [-969.581] (-967.322) -- 0:01:14
      39000 -- (-974.302) (-968.497) [-967.218] (-968.250) * [-967.113] (-968.059) (-981.419) (-968.524) -- 0:01:13
      39500 -- (-977.183) (-968.272) (-968.286) [-967.432] * (-966.756) [-967.295] (-981.520) (-967.552) -- 0:01:12
      40000 -- (-971.811) (-970.139) [-967.086] (-966.673) * (-967.230) (-972.373) (-985.498) [-969.487] -- 0:01:12

      Average standard deviation of split frequencies: 0.034094

      40500 -- (-969.781) [-968.238] (-967.304) (-967.215) * (-967.339) [-967.497] (-976.188) (-966.829) -- 0:01:11
      41000 -- [-966.162] (-966.759) (-967.423) (-969.176) * (-966.160) (-967.101) [-977.539] (-967.410) -- 0:01:10
      41500 -- (-967.048) (-966.792) [-967.425] (-967.653) * (-967.936) (-966.986) [-979.386] (-973.728) -- 0:01:09
      42000 -- (-968.301) [-968.619] (-967.346) (-966.789) * (-969.213) (-967.966) (-978.046) [-969.088] -- 0:01:08
      42500 -- (-968.302) [-968.446] (-970.483) (-966.247) * [-969.910] (-967.879) (-978.403) (-967.915) -- 0:01:07
      43000 -- (-967.627) (-967.111) [-969.153] (-968.796) * (-974.550) (-967.503) [-974.843] (-966.555) -- 0:01:06
      43500 -- [-967.583] (-966.661) (-967.873) (-968.614) * (-969.209) (-966.879) [-970.468] (-968.015) -- 0:01:05
      44000 -- (-968.190) (-967.298) (-969.462) [-977.328] * [-970.557] (-969.222) (-982.408) (-966.797) -- 0:01:05
      44500 -- [-966.792] (-966.338) (-967.942) (-969.470) * (-970.487) (-967.669) (-975.030) [-966.341] -- 0:01:04
      45000 -- (-966.701) [-966.437] (-968.886) (-967.015) * [-969.120] (-972.766) (-983.248) (-968.061) -- 0:01:03

      Average standard deviation of split frequencies: 0.028304

      45500 -- [-966.423] (-967.087) (-966.310) (-967.032) * [-968.229] (-968.438) (-981.726) (-972.772) -- 0:01:02
      46000 -- (-967.254) (-968.705) (-967.386) [-967.121] * (-968.268) (-968.225) (-977.293) [-966.865] -- 0:01:02
      46500 -- [-971.085] (-967.014) (-967.682) (-967.374) * [-972.262] (-968.321) (-979.002) (-966.796) -- 0:01:01
      47000 -- (-966.908) [-965.758] (-970.701) (-968.219) * [-969.123] (-966.196) (-973.775) (-967.312) -- 0:01:00
      47500 -- (-970.338) [-966.056] (-973.457) (-968.002) * [-968.181] (-967.169) (-981.674) (-972.800) -- 0:01:00
      48000 -- (-968.468) (-968.077) [-967.710] (-970.722) * (-969.787) [-966.195] (-979.338) (-971.274) -- 0:01:19
      48500 -- [-969.989] (-968.945) (-971.039) (-972.452) * (-966.282) [-966.969] (-978.752) (-969.520) -- 0:01:18
      49000 -- [-967.645] (-966.135) (-968.355) (-967.531) * (-966.108) (-965.963) (-980.400) [-967.205] -- 0:01:17
      49500 -- (-969.068) (-966.041) (-966.927) [-968.749] * (-967.266) [-969.508] (-982.443) (-969.930) -- 0:01:16
      50000 -- (-968.667) [-966.041] (-970.949) (-967.396) * [-966.303] (-966.464) (-969.549) (-968.746) -- 0:01:16

      Average standard deviation of split frequencies: 0.032319

      50500 -- (-971.668) (-966.993) (-969.372) [-967.977] * (-968.465) (-966.682) [-968.051] (-969.035) -- 0:01:15
      51000 -- (-970.122) (-965.915) (-966.676) [-969.379] * [-966.640] (-966.946) (-967.016) (-972.922) -- 0:01:14
      51500 -- (-969.889) [-967.172] (-968.150) (-965.871) * (-968.584) [-967.567] (-970.449) (-968.602) -- 0:01:13
      52000 -- (-969.320) [-965.929] (-966.472) (-966.073) * (-968.212) (-969.212) [-968.703] (-969.502) -- 0:01:12
      52500 -- (-968.772) (-971.365) (-967.114) [-966.233] * [-968.166] (-972.588) (-968.709) (-975.833) -- 0:01:12
      53000 -- [-967.667] (-968.388) (-970.281) (-967.147) * (-969.021) (-968.602) [-968.602] (-970.205) -- 0:01:11
      53500 -- (-968.670) [-970.198] (-969.175) (-972.143) * [-972.208] (-966.187) (-966.469) (-970.369) -- 0:01:10
      54000 -- [-967.559] (-969.283) (-969.248) (-969.804) * (-970.005) [-967.003] (-966.465) (-970.485) -- 0:01:10
      54500 -- (-970.636) [-969.534] (-966.849) (-968.644) * (-969.189) [-967.569] (-967.423) (-966.963) -- 0:01:09
      55000 -- [-967.747] (-967.915) (-967.167) (-967.152) * (-970.272) (-968.027) [-966.816] (-968.532) -- 0:01:08

      Average standard deviation of split frequencies: 0.031567

      55500 -- (-967.140) (-967.873) [-966.859] (-969.772) * (-969.964) (-970.622) [-966.393] (-968.744) -- 0:01:08
      56000 -- (-968.789) [-968.928] (-965.771) (-969.566) * (-968.927) [-969.337] (-970.046) (-969.455) -- 0:01:07
      56500 -- (-966.586) (-972.218) [-968.410] (-970.186) * (-968.002) (-970.500) [-966.161] (-966.735) -- 0:01:06
      57000 -- [-967.850] (-973.534) (-972.086) (-969.494) * [-966.023] (-969.655) (-966.507) (-966.497) -- 0:01:06
      57500 -- (-966.061) [-967.778] (-967.204) (-967.277) * (-972.530) [-966.094] (-969.387) (-968.368) -- 0:01:05
      58000 -- (-966.670) [-967.091] (-967.805) (-967.834) * [-967.119] (-970.267) (-966.430) (-966.059) -- 0:01:04
      58500 -- (-972.563) [-973.672] (-966.481) (-969.744) * (-967.181) (-969.331) [-966.203] (-966.704) -- 0:01:04
      59000 -- (-966.695) [-969.615] (-966.539) (-971.327) * (-969.297) (-969.001) [-967.801] (-966.496) -- 0:01:03
      59500 -- [-966.506] (-970.307) (-966.961) (-969.402) * (-968.624) [-967.340] (-969.422) (-966.493) -- 0:01:03
      60000 -- (-969.019) (-970.324) (-969.528) [-966.113] * [-969.050] (-968.786) (-970.373) (-970.147) -- 0:01:02

      Average standard deviation of split frequencies: 0.030650

      60500 -- (-967.513) (-968.495) (-970.382) [-968.178] * (-969.144) (-968.780) (-967.580) [-967.707] -- 0:01:02
      61000 -- (-967.553) (-967.474) (-967.320) [-966.819] * (-968.306) [-966.628] (-966.638) (-968.147) -- 0:01:01
      61500 -- [-966.097] (-966.061) (-968.000) (-970.062) * (-972.013) [-966.637] (-968.488) (-967.905) -- 0:01:01
      62000 -- [-966.669] (-966.715) (-968.289) (-968.535) * (-968.288) (-968.745) [-969.101] (-967.049) -- 0:01:00
      62500 -- [-967.171] (-967.229) (-966.239) (-969.257) * (-967.097) (-967.961) (-969.042) [-969.251] -- 0:01:00
      63000 -- (-966.625) (-968.686) [-968.136] (-972.188) * [-967.818] (-967.615) (-968.406) (-969.109) -- 0:00:59
      63500 -- (-968.438) (-966.140) (-968.092) [-966.369] * (-968.642) (-968.197) [-967.211] (-966.220) -- 0:01:13
      64000 -- (-966.767) [-971.858] (-968.602) (-967.184) * [-967.884] (-966.486) (-972.384) (-971.192) -- 0:01:13
      64500 -- [-969.597] (-973.400) (-968.765) (-969.507) * (-966.432) (-966.007) (-966.133) [-968.060] -- 0:01:12
      65000 -- (-968.160) [-973.465] (-966.870) (-969.894) * (-966.424) (-968.348) [-968.864] (-970.047) -- 0:01:11

      Average standard deviation of split frequencies: 0.029998

      65500 -- (-976.835) [-970.714] (-966.874) (-966.812) * (-967.128) [-965.693] (-970.309) (-965.999) -- 0:01:11
      66000 -- (-971.145) (-966.936) (-967.428) [-966.593] * [-968.181] (-966.943) (-968.155) (-968.599) -- 0:01:10
      66500 -- (-968.828) [-970.126] (-969.005) (-968.993) * (-968.933) (-967.571) [-970.254] (-971.266) -- 0:01:10
      67000 -- (-966.645) [-970.360] (-973.595) (-967.524) * (-968.200) [-966.828] (-967.770) (-970.636) -- 0:01:09
      67500 -- (-965.757) (-967.462) [-966.447] (-968.507) * (-968.560) (-967.631) (-969.524) [-967.489] -- 0:01:09
      68000 -- (-966.481) [-969.502] (-968.038) (-967.289) * [-966.560] (-968.208) (-970.746) (-968.066) -- 0:01:08
      68500 -- (-971.336) [-969.419] (-969.349) (-972.487) * (-967.826) (-968.853) (-969.777) [-971.525] -- 0:01:07
      69000 -- (-966.741) [-972.798] (-966.489) (-972.305) * (-967.377) [-967.358] (-971.331) (-969.645) -- 0:01:07
      69500 -- (-967.819) [-969.990] (-968.320) (-968.672) * (-966.698) (-970.119) (-968.650) [-969.333] -- 0:01:06
      70000 -- (-973.125) (-968.330) [-967.760] (-967.973) * [-967.757] (-969.740) (-969.990) (-968.886) -- 0:01:06

      Average standard deviation of split frequencies: 0.026350

      70500 -- (-965.585) [-969.808] (-972.254) (-970.590) * (-967.662) (-969.703) (-968.742) [-967.391] -- 0:01:05
      71000 -- (-966.512) [-966.992] (-966.518) (-970.362) * (-971.545) [-965.878] (-970.093) (-966.711) -- 0:01:05
      71500 -- (-968.070) [-966.383] (-966.449) (-968.163) * (-967.837) [-967.316] (-967.295) (-966.563) -- 0:01:04
      72000 -- (-969.812) [-966.744] (-966.520) (-966.835) * (-970.470) (-970.190) (-968.857) [-967.594] -- 0:01:04
      72500 -- (-968.460) [-966.577] (-966.695) (-969.475) * (-967.922) (-968.625) (-967.375) [-969.441] -- 0:01:03
      73000 -- (-967.477) [-965.679] (-968.315) (-966.990) * (-966.795) (-968.650) (-968.150) [-966.550] -- 0:01:03
      73500 -- (-968.767) (-968.051) (-967.476) [-966.743] * (-966.604) (-969.796) [-967.325] (-969.283) -- 0:01:03
      74000 -- (-969.144) (-967.146) (-967.134) [-968.547] * [-968.054] (-969.493) (-966.320) (-971.372) -- 0:01:02
      74500 -- (-967.586) [-967.775] (-967.380) (-968.627) * (-968.560) [-971.148] (-965.638) (-967.819) -- 0:01:02
      75000 -- [-967.982] (-968.038) (-966.520) (-967.919) * (-967.990) (-968.126) (-967.316) [-967.065] -- 0:01:01

      Average standard deviation of split frequencies: 0.024158

      75500 -- (-968.018) [-967.278] (-970.585) (-967.970) * (-967.025) (-969.573) [-966.206] (-965.692) -- 0:01:01
      76000 -- (-967.128) [-966.802] (-968.556) (-972.007) * (-966.982) [-969.537] (-968.145) (-969.749) -- 0:01:00
      76500 -- (-970.095) [-967.606] (-970.112) (-967.534) * (-967.982) (-968.297) (-968.252) [-968.781] -- 0:01:00
      77000 -- (-968.102) (-969.710) [-974.344] (-966.109) * (-966.809) [-967.741] (-966.683) (-968.441) -- 0:00:59
      77500 -- (-966.929) (-968.361) (-969.472) [-966.505] * [-965.646] (-967.697) (-967.956) (-970.055) -- 0:00:59
      78000 -- (-969.488) (-968.475) (-968.734) [-968.657] * (-966.335) [-967.080] (-968.971) (-968.509) -- 0:00:59
      78500 -- [-967.276] (-967.736) (-969.211) (-969.914) * [-966.158] (-972.962) (-968.411) (-968.775) -- 0:00:58
      79000 -- [-967.032] (-966.559) (-967.636) (-966.810) * [-966.209] (-973.171) (-968.245) (-968.037) -- 0:00:58
      79500 -- (-966.140) [-966.234] (-971.654) (-970.499) * (-966.648) (-974.980) [-967.994] (-967.504) -- 0:00:57
      80000 -- (-968.265) (-971.782) (-969.669) [-968.976] * [-966.011] (-970.321) (-968.050) (-968.202) -- 0:01:09

      Average standard deviation of split frequencies: 0.030142

      80500 -- (-970.641) [-966.971] (-970.353) (-968.292) * (-965.882) (-966.821) [-968.799] (-968.864) -- 0:01:08
      81000 -- [-968.812] (-969.416) (-966.884) (-968.194) * (-969.550) (-968.590) (-969.022) [-968.829] -- 0:01:08
      81500 -- (-968.100) (-967.847) (-967.022) [-967.333] * (-970.951) (-967.440) (-967.922) [-968.233] -- 0:01:07
      82000 -- (-968.932) [-966.979] (-969.575) (-967.888) * (-970.997) [-967.773] (-966.371) (-968.881) -- 0:01:07
      82500 -- (-968.445) [-966.907] (-969.952) (-968.323) * (-966.422) (-970.845) (-966.631) [-968.061] -- 0:01:06
      83000 -- (-966.441) [-970.935] (-970.227) (-970.392) * (-966.228) (-967.720) (-967.829) [-966.927] -- 0:01:06
      83500 -- (-967.032) (-969.017) (-968.284) [-968.836] * (-966.289) (-972.472) [-966.755] (-967.511) -- 0:01:05
      84000 -- (-967.294) (-970.552) (-968.767) [-968.419] * [-966.985] (-971.254) (-966.578) (-968.941) -- 0:01:05
      84500 -- (-967.145) [-966.650] (-968.682) (-968.581) * (-970.695) (-972.414) [-971.427] (-969.280) -- 0:01:05
      85000 -- (-966.694) [-971.752] (-967.232) (-970.142) * [-966.813] (-969.513) (-970.620) (-970.721) -- 0:01:04

      Average standard deviation of split frequencies: 0.029874

      85500 -- (-966.574) [-968.233] (-970.807) (-966.999) * (-970.627) [-969.377] (-968.446) (-971.686) -- 0:01:04
      86000 -- (-965.924) [-970.046] (-966.374) (-969.503) * [-968.763] (-967.463) (-970.582) (-970.113) -- 0:01:03
      86500 -- [-965.641] (-966.688) (-966.322) (-970.679) * (-970.344) (-967.516) [-968.363] (-968.042) -- 0:01:03
      87000 -- (-967.068) [-966.757] (-974.139) (-968.616) * (-966.446) (-966.549) [-969.078] (-971.005) -- 0:01:02
      87500 -- (-965.627) (-972.230) [-966.377] (-968.806) * (-966.599) [-968.157] (-966.775) (-967.416) -- 0:01:02
      88000 -- (-967.027) [-971.275] (-966.946) (-974.258) * (-966.876) (-967.849) (-967.399) [-968.082] -- 0:01:02
      88500 -- (-968.029) (-967.461) [-967.516] (-970.727) * [-967.539] (-967.840) (-966.898) (-967.781) -- 0:01:01
      89000 -- (-967.223) (-968.684) [-966.911] (-968.740) * (-968.309) [-969.723] (-968.531) (-971.569) -- 0:01:01
      89500 -- (-967.135) (-970.147) (-977.023) [-967.070] * (-967.648) (-966.224) (-969.999) [-969.866] -- 0:01:01
      90000 -- (-967.010) [-970.485] (-968.055) (-968.049) * (-965.724) (-967.086) [-969.412] (-969.404) -- 0:01:00

      Average standard deviation of split frequencies: 0.024697

      90500 -- (-970.211) [-967.847] (-967.139) (-968.759) * [-965.891] (-970.226) (-967.552) (-969.348) -- 0:01:00
      91000 -- (-969.676) (-967.655) (-967.868) [-968.022] * (-967.898) (-966.484) [-965.969] (-966.772) -- 0:00:59
      91500 -- (-969.024) (-970.096) [-968.155] (-969.974) * (-966.166) [-967.205] (-966.052) (-966.826) -- 0:00:59
      92000 -- (-969.606) [-968.562] (-970.435) (-969.691) * (-967.490) (-966.003) (-966.109) [-968.581] -- 0:00:59
      92500 -- (-969.468) (-967.760) [-968.052] (-968.172) * (-967.576) (-970.079) (-967.652) [-967.938] -- 0:00:58
      93000 -- (-968.569) (-967.736) [-967.587] (-968.812) * (-970.936) (-969.175) (-967.055) [-966.920] -- 0:00:58
      93500 -- (-966.750) [-967.263] (-967.222) (-969.814) * (-967.235) (-966.070) [-967.234] (-968.347) -- 0:00:58
      94000 -- [-971.145] (-967.608) (-966.662) (-969.979) * [-966.783] (-965.924) (-966.912) (-967.115) -- 0:00:57
      94500 -- (-966.310) (-966.320) (-967.807) [-967.238] * (-968.679) (-967.539) [-966.693] (-967.909) -- 0:00:57
      95000 -- (-967.570) [-966.331] (-967.925) (-967.373) * [-971.999] (-969.637) (-967.282) (-967.066) -- 0:00:57

      Average standard deviation of split frequencies: 0.024307

      95500 -- (-969.861) (-968.349) (-966.549) [-966.662] * (-970.286) (-970.452) [-973.285] (-968.378) -- 0:00:56
      96000 -- (-968.191) (-972.053) [-967.317] (-966.997) * (-969.539) (-966.748) [-972.137] (-969.237) -- 0:00:56
      96500 -- (-970.064) [-967.330] (-966.576) (-966.514) * (-966.736) (-968.209) (-966.315) [-971.244] -- 0:01:05
      97000 -- (-968.434) [-966.198] (-968.368) (-966.446) * (-968.100) (-968.517) (-969.570) [-968.618] -- 0:01:05
      97500 -- (-968.142) (-966.782) [-967.284] (-967.260) * [-967.940] (-967.364) (-970.355) (-967.374) -- 0:01:04
      98000 -- (-969.035) [-967.819] (-967.340) (-965.879) * (-970.393) (-971.949) [-969.489] (-966.390) -- 0:01:04
      98500 -- (-966.864) [-967.181] (-966.746) (-967.932) * [-966.673] (-974.864) (-966.452) (-965.818) -- 0:01:04
      99000 -- (-966.858) [-966.904] (-967.207) (-967.518) * (-969.890) (-974.824) [-966.722] (-967.286) -- 0:01:03
      99500 -- [-965.685] (-966.630) (-968.292) (-967.122) * (-967.386) (-969.491) [-967.795] (-966.669) -- 0:01:03
      100000 -- (-973.876) (-965.776) (-966.882) [-967.704] * (-969.219) [-967.695] (-968.434) (-966.740) -- 0:01:02

      Average standard deviation of split frequencies: 0.027316

      100500 -- (-970.990) [-965.929] (-971.518) (-967.454) * [-967.271] (-967.210) (-969.959) (-967.135) -- 0:01:02
      101000 -- (-966.850) [-965.930] (-976.223) (-968.743) * (-967.614) [-966.663] (-969.939) (-967.365) -- 0:01:02
      101500 -- [-968.464] (-967.170) (-973.233) (-966.870) * [-966.723] (-970.403) (-967.684) (-965.761) -- 0:01:01
      102000 -- (-966.792) (-966.789) (-973.239) [-968.651] * [-967.818] (-969.213) (-968.426) (-966.952) -- 0:01:01
      102500 -- (-971.270) (-966.611) (-969.943) [-966.699] * (-967.220) (-968.548) (-968.626) [-966.756] -- 0:01:01
      103000 -- [-966.933] (-970.351) (-969.635) (-967.690) * [-967.638] (-966.623) (-967.282) (-966.276) -- 0:01:00
      103500 -- [-968.226] (-966.057) (-968.650) (-967.829) * (-969.384) (-967.929) (-966.309) [-967.669] -- 0:01:00
      104000 -- [-965.901] (-967.316) (-966.679) (-969.090) * [-967.255] (-969.699) (-975.370) (-967.245) -- 0:01:00
      104500 -- (-965.805) [-966.406] (-965.994) (-968.341) * (-967.555) (-969.520) (-969.854) [-966.285] -- 0:00:59
      105000 -- (-967.696) (-969.139) [-967.373] (-970.855) * [-968.088] (-967.724) (-969.016) (-967.203) -- 0:00:59

      Average standard deviation of split frequencies: 0.024989

      105500 -- (-969.200) (-967.959) [-965.616] (-968.607) * [-968.331] (-971.496) (-969.653) (-969.348) -- 0:00:59
      106000 -- [-968.174] (-967.276) (-968.042) (-968.120) * (-971.089) [-967.263] (-968.166) (-967.082) -- 0:00:59
      106500 -- (-970.297) [-968.234] (-967.937) (-968.256) * (-970.461) (-968.514) (-969.115) [-968.069] -- 0:00:58
      107000 -- (-974.327) [-967.392] (-970.439) (-968.969) * [-969.839] (-968.700) (-968.579) (-967.573) -- 0:00:58
      107500 -- (-967.775) [-969.749] (-971.283) (-968.364) * (-969.363) (-968.715) [-967.087] (-967.456) -- 0:00:58
      108000 -- (-967.220) [-973.867] (-972.188) (-969.207) * (-968.964) (-971.462) (-967.014) [-966.500] -- 0:00:57
      108500 -- (-970.964) (-968.942) [-970.898] (-970.363) * (-970.139) (-969.719) [-966.838] (-965.780) -- 0:00:57
      109000 -- (-970.269) (-968.713) (-970.687) [-969.124] * (-970.898) (-969.526) (-968.051) [-966.534] -- 0:00:57
      109500 -- (-967.517) (-967.974) (-968.817) [-967.577] * (-967.914) [-967.161] (-968.051) (-966.786) -- 0:00:56
      110000 -- (-967.827) [-966.553] (-969.999) (-966.702) * (-966.534) [-969.272] (-968.051) (-966.786) -- 0:00:56

      Average standard deviation of split frequencies: 0.026231

      110500 -- [-966.900] (-966.288) (-972.004) (-966.125) * (-966.534) (-967.322) [-967.371] (-968.623) -- 0:00:56
      111000 -- (-968.285) [-967.693] (-969.147) (-969.102) * (-967.269) [-967.572] (-967.947) (-967.213) -- 0:00:56
      111500 -- (-970.082) [-967.163] (-968.559) (-967.674) * (-969.525) (-965.883) [-967.403] (-967.812) -- 0:00:55
      112000 -- (-971.780) [-967.534] (-967.039) (-966.214) * (-971.700) (-966.203) [-966.227] (-967.759) -- 0:00:55
      112500 -- (-968.586) [-967.140] (-970.162) (-966.551) * (-965.788) (-966.152) (-966.196) [-966.926] -- 0:00:55
      113000 -- (-971.021) (-966.473) [-969.391] (-968.016) * [-968.061] (-970.418) (-966.711) (-968.254) -- 0:01:02
      113500 -- (-967.169) (-966.620) [-968.028] (-966.058) * (-973.969) [-966.534] (-966.615) (-967.173) -- 0:01:02
      114000 -- (-967.909) (-967.738) [-965.862] (-968.617) * (-973.916) [-966.355] (-972.543) (-966.268) -- 0:01:02
      114500 -- [-969.963] (-966.180) (-966.002) (-967.384) * (-971.127) (-965.528) (-966.731) [-966.966] -- 0:01:01
      115000 -- (-968.182) (-966.208) [-966.722] (-969.164) * (-967.255) (-969.881) (-967.890) [-966.181] -- 0:01:01

      Average standard deviation of split frequencies: 0.023977

      115500 -- (-966.587) (-968.439) (-970.591) [-966.164] * (-966.755) (-967.352) [-970.956] (-970.009) -- 0:01:01
      116000 -- (-966.415) (-967.839) (-967.225) [-966.299] * [-966.706] (-970.912) (-973.014) (-966.080) -- 0:01:00
      116500 -- (-969.185) (-968.008) (-969.755) [-965.951] * (-967.731) [-966.105] (-968.573) (-966.483) -- 0:01:00
      117000 -- (-971.355) (-967.097) [-972.182] (-978.064) * [-966.321] (-967.810) (-967.000) (-966.198) -- 0:01:00
      117500 -- [-966.185] (-968.003) (-969.694) (-968.038) * (-968.961) (-967.375) [-967.545] (-966.169) -- 0:01:00
      118000 -- (-966.078) (-967.321) (-970.972) [-966.268] * (-968.158) (-967.031) (-967.646) [-967.459] -- 0:00:59
      118500 -- (-967.362) (-966.336) (-970.400) [-966.115] * (-968.135) (-969.643) [-966.380] (-967.112) -- 0:00:59
      119000 -- (-966.277) [-966.033] (-974.742) (-966.136) * [-969.927] (-968.453) (-967.189) (-970.308) -- 0:00:59
      119500 -- (-967.964) [-967.251] (-969.295) (-972.362) * (-971.937) (-968.487) (-967.468) [-965.995] -- 0:00:58
      120000 -- (-966.431) [-965.896] (-967.677) (-966.795) * (-969.440) (-970.105) (-970.446) [-965.848] -- 0:00:58

      Average standard deviation of split frequencies: 0.024468

      120500 -- (-969.168) [-966.077] (-968.838) (-967.084) * (-968.690) (-969.941) (-970.066) [-968.116] -- 0:00:58
      121000 -- (-967.633) (-967.374) (-968.100) [-966.266] * [-969.459] (-967.962) (-972.304) (-967.993) -- 0:00:58
      121500 -- [-968.847] (-967.191) (-970.287) (-969.048) * (-971.653) [-967.648] (-975.199) (-969.257) -- 0:00:57
      122000 -- (-969.152) (-967.390) [-967.035] (-971.419) * (-970.520) [-965.929] (-968.866) (-968.637) -- 0:00:57
      122500 -- (-968.381) (-967.597) (-965.918) [-967.660] * (-969.654) (-966.090) (-968.648) [-966.701] -- 0:00:57
      123000 -- (-967.785) (-966.405) (-968.420) [-969.122] * (-967.437) (-966.194) (-967.766) [-968.421] -- 0:00:57
      123500 -- [-967.432] (-968.293) (-966.438) (-971.413) * (-967.016) (-966.183) [-967.645] (-966.602) -- 0:00:56
      124000 -- (-967.871) (-967.646) (-966.351) [-967.813] * (-968.633) [-966.382] (-967.704) (-967.862) -- 0:00:56
      124500 -- [-966.401] (-968.431) (-967.460) (-968.833) * (-968.619) [-966.002] (-967.751) (-967.028) -- 0:00:56
      125000 -- [-968.202] (-968.258) (-968.271) (-966.998) * (-969.850) (-967.280) [-971.747] (-968.273) -- 0:00:56

      Average standard deviation of split frequencies: 0.022842

      125500 -- (-966.414) [-968.149] (-968.320) (-967.465) * (-974.883) (-968.039) [-969.884] (-968.352) -- 0:00:55
      126000 -- [-966.057] (-969.300) (-966.514) (-970.712) * (-967.638) (-966.868) (-970.360) [-965.909] -- 0:00:55
      126500 -- (-967.694) (-968.025) (-966.642) [-968.304] * (-966.453) [-968.960] (-966.584) (-966.894) -- 0:00:55
      127000 -- (-969.092) (-968.404) [-966.096] (-969.732) * (-968.028) (-966.673) (-966.100) [-969.571] -- 0:00:54
      127500 -- (-965.880) (-966.858) (-968.887) [-966.989] * (-966.236) [-968.345] (-966.183) (-968.220) -- 0:00:54
      128000 -- (-969.470) (-970.551) [-970.075] (-965.715) * [-968.163] (-966.189) (-967.032) (-972.456) -- 0:00:54
      128500 -- (-968.801) (-967.387) (-968.351) [-968.267] * (-968.673) [-967.454] (-967.734) (-969.737) -- 0:00:54
      129000 -- (-968.890) (-969.568) (-966.929) [-966.406] * (-968.712) (-968.818) (-968.949) [-972.038] -- 0:00:54
      129500 -- (-969.097) (-968.465) [-966.225] (-965.528) * (-968.255) [-967.608] (-966.382) (-969.854) -- 0:01:00
      130000 -- (-971.033) (-968.859) [-965.781] (-968.016) * (-967.836) (-968.655) (-968.181) [-967.908] -- 0:01:00

      Average standard deviation of split frequencies: 0.023250

      130500 -- (-969.408) (-967.927) (-966.714) [-967.480] * (-966.893) (-969.963) (-968.482) [-968.254] -- 0:00:59
      131000 -- [-965.820] (-969.085) (-967.602) (-966.569) * [-966.160] (-968.244) (-967.845) (-971.738) -- 0:00:59
      131500 -- (-966.114) (-967.930) [-966.945] (-966.881) * [-969.591] (-966.177) (-968.337) (-969.082) -- 0:00:59
      132000 -- (-967.282) [-967.252] (-965.901) (-968.026) * (-968.376) (-965.765) [-968.129] (-968.939) -- 0:00:59
      132500 -- (-966.948) [-966.896] (-966.522) (-967.024) * (-966.888) [-965.745] (-968.115) (-967.368) -- 0:00:58
      133000 -- (-966.025) (-969.235) [-966.417] (-971.408) * (-966.564) (-966.029) (-968.640) [-969.155] -- 0:00:58
      133500 -- (-967.535) [-966.316] (-966.121) (-971.881) * (-967.618) (-967.917) [-967.432] (-967.980) -- 0:00:58
      134000 -- (-970.568) [-966.114] (-966.891) (-969.133) * [-967.798] (-966.703) (-967.155) (-972.168) -- 0:00:58
      134500 -- (-971.063) (-965.623) [-966.692] (-970.093) * (-967.191) [-969.160] (-969.051) (-968.327) -- 0:00:57
      135000 -- (-972.842) (-966.731) (-966.355) [-967.717] * (-966.748) (-966.582) [-968.814] (-972.598) -- 0:00:57

      Average standard deviation of split frequencies: 0.023108

      135500 -- (-969.502) [-966.558] (-968.469) (-967.430) * (-966.296) (-966.895) [-968.061] (-968.280) -- 0:00:57
      136000 -- (-970.672) [-969.844] (-967.537) (-966.953) * [-966.295] (-966.658) (-973.870) (-969.105) -- 0:00:57
      136500 -- (-970.507) (-967.406) [-967.272] (-969.760) * (-967.062) [-966.226] (-969.935) (-968.550) -- 0:00:56
      137000 -- (-966.286) (-966.635) [-967.504] (-966.975) * [-970.376] (-966.856) (-966.791) (-968.794) -- 0:00:56
      137500 -- (-966.569) [-966.561] (-967.892) (-969.839) * (-968.129) (-969.993) [-966.333] (-968.946) -- 0:00:56
      138000 -- [-969.104] (-966.411) (-968.729) (-970.017) * (-969.896) (-969.305) (-969.282) [-969.807] -- 0:00:56
      138500 -- [-968.051] (-966.154) (-966.324) (-971.872) * [-970.085] (-972.785) (-966.091) (-974.950) -- 0:00:55
      139000 -- [-967.868] (-966.054) (-968.586) (-971.117) * (-969.256) (-975.058) (-966.096) [-970.789] -- 0:00:55
      139500 -- (-967.356) (-967.109) [-972.705] (-970.335) * (-968.680) (-969.721) (-968.106) [-966.951] -- 0:00:55
      140000 -- (-969.023) (-967.680) [-970.980] (-967.831) * (-973.493) [-968.029] (-968.444) (-968.257) -- 0:00:55

      Average standard deviation of split frequencies: 0.021783

      140500 -- (-965.657) [-966.268] (-968.909) (-970.049) * (-968.066) (-967.224) [-968.747] (-968.447) -- 0:00:55
      141000 -- (-969.384) (-967.766) [-967.822] (-972.648) * [-968.349] (-968.069) (-969.230) (-970.286) -- 0:00:54
      141500 -- [-968.973] (-970.280) (-971.857) (-970.723) * (-967.807) [-967.287] (-969.075) (-968.379) -- 0:00:54
      142000 -- (-970.451) [-967.400] (-969.033) (-968.164) * (-967.220) (-967.264) [-966.569] (-968.651) -- 0:00:54
      142500 -- (-966.213) [-967.159] (-968.385) (-971.212) * (-965.961) (-966.541) [-966.783] (-971.487) -- 0:00:54
      143000 -- [-966.449] (-967.014) (-969.262) (-967.026) * (-972.401) [-966.456] (-966.844) (-968.490) -- 0:00:53
      143500 -- (-966.581) [-968.243] (-969.316) (-969.871) * (-968.494) [-968.667] (-966.779) (-968.430) -- 0:00:53
      144000 -- (-966.889) [-967.322] (-967.259) (-968.321) * (-967.916) (-970.219) [-967.599] (-970.004) -- 0:00:53
      144500 -- (-969.530) [-968.084] (-967.136) (-967.921) * (-970.269) [-966.262] (-966.250) (-971.597) -- 0:00:53
      145000 -- (-966.546) (-967.545) [-970.238] (-967.329) * [-971.081] (-967.733) (-967.344) (-967.328) -- 0:00:53

      Average standard deviation of split frequencies: 0.020503

      145500 -- (-969.736) (-966.875) (-967.890) [-966.118] * [-969.612] (-971.195) (-966.742) (-966.814) -- 0:00:58
      146000 -- (-966.828) (-968.670) [-970.110] (-966.281) * (-969.032) (-968.582) (-970.921) [-966.593] -- 0:00:58
      146500 -- (-970.457) (-965.879) [-967.162] (-968.095) * (-970.096) [-967.548] (-967.793) (-966.749) -- 0:00:58
      147000 -- (-968.176) (-967.989) [-969.072] (-967.387) * [-971.014] (-968.463) (-968.638) (-966.139) -- 0:00:58
      147500 -- (-968.301) (-966.384) [-967.878] (-967.827) * [-969.809] (-970.058) (-974.517) (-965.881) -- 0:00:57
      148000 -- (-968.397) (-969.599) (-969.908) [-968.099] * (-969.492) (-972.305) [-974.742] (-967.513) -- 0:00:57
      148500 -- (-966.150) (-967.925) (-967.152) [-967.729] * (-969.609) [-970.110] (-969.569) (-966.986) -- 0:00:57
      149000 -- [-967.066] (-967.229) (-968.125) (-967.054) * [-968.806] (-967.307) (-967.037) (-968.977) -- 0:00:57
      149500 -- (-970.334) (-967.142) [-968.820] (-967.832) * (-968.533) [-966.642] (-968.773) (-969.676) -- 0:00:56
      150000 -- (-966.328) (-966.317) (-968.140) [-965.824] * (-968.207) (-966.722) (-968.167) [-968.306] -- 0:00:56

      Average standard deviation of split frequencies: 0.020806

      150500 -- (-965.537) (-969.389) (-968.632) [-965.691] * (-968.755) [-967.461] (-971.777) (-969.942) -- 0:00:56
      151000 -- (-965.517) (-967.972) [-968.617] (-969.703) * (-971.194) [-967.491] (-968.578) (-971.979) -- 0:00:56
      151500 -- (-966.148) (-971.489) (-967.276) [-969.807] * (-969.811) (-966.154) [-966.842] (-968.880) -- 0:00:56
      152000 -- (-965.871) (-966.645) [-969.295] (-969.423) * (-970.261) (-966.682) [-966.266] (-967.533) -- 0:00:55
      152500 -- (-966.617) (-967.076) (-966.581) [-968.666] * (-970.037) (-967.355) [-966.285] (-968.353) -- 0:00:55
      153000 -- [-967.566] (-967.468) (-969.918) (-970.134) * (-967.326) (-967.909) [-967.091] (-969.422) -- 0:00:55
      153500 -- [-967.257] (-968.157) (-965.831) (-968.849) * [-966.945] (-973.312) (-967.275) (-968.425) -- 0:00:55
      154000 -- [-967.790] (-970.467) (-969.890) (-966.963) * [-967.290] (-971.258) (-967.214) (-967.194) -- 0:00:54
      154500 -- (-966.104) (-968.172) (-968.269) [-966.871] * (-968.509) (-965.980) [-969.138] (-967.728) -- 0:00:54
      155000 -- (-966.377) (-968.534) [-967.194] (-968.015) * (-966.064) [-966.259] (-968.205) (-968.117) -- 0:00:54

      Average standard deviation of split frequencies: 0.019037

      155500 -- (-968.486) (-970.634) [-966.492] (-967.548) * (-968.209) (-966.524) (-966.432) [-968.308] -- 0:00:54
      156000 -- (-967.708) (-969.382) (-967.317) [-967.254] * (-967.016) [-965.667] (-966.675) (-976.270) -- 0:00:54
      156500 -- (-968.357) (-967.312) [-966.545] (-969.256) * (-971.755) (-966.974) (-970.868) [-973.169] -- 0:00:53
      157000 -- (-967.894) (-969.071) (-966.187) [-966.603] * (-971.311) (-966.657) (-967.311) [-968.278] -- 0:00:53
      157500 -- (-966.851) [-966.963] (-966.162) (-966.059) * [-966.408] (-968.874) (-970.079) (-967.759) -- 0:00:53
      158000 -- (-966.644) [-967.222] (-965.777) (-967.886) * [-971.775] (-966.145) (-966.855) (-971.405) -- 0:00:53
      158500 -- (-966.884) (-970.220) (-970.417) [-967.981] * [-967.494] (-971.404) (-970.424) (-972.282) -- 0:00:53
      159000 -- (-967.120) (-967.919) (-965.841) [-966.107] * (-967.015) (-969.830) [-967.402] (-970.626) -- 0:00:52
      159500 -- (-966.678) (-970.448) [-966.605] (-968.030) * [-968.105] (-972.543) (-970.045) (-973.751) -- 0:00:52
      160000 -- [-967.638] (-968.317) (-966.863) (-973.168) * (-968.726) (-968.549) (-971.197) [-968.847] -- 0:00:52

      Average standard deviation of split frequencies: 0.020049

      160500 -- [-966.619] (-966.061) (-968.568) (-971.830) * (-967.389) [-968.375] (-968.214) (-968.704) -- 0:00:52
      161000 -- (-966.837) (-969.569) (-967.297) [-967.466] * [-967.821] (-967.862) (-966.958) (-966.054) -- 0:00:52
      161500 -- (-966.503) (-966.701) (-968.628) [-966.151] * (-966.821) (-968.733) (-969.010) [-967.478] -- 0:00:57
      162000 -- (-966.838) (-966.683) [-967.926] (-969.270) * (-967.660) (-966.491) [-967.792] (-967.162) -- 0:00:56
      162500 -- (-966.707) (-968.063) [-967.635] (-970.362) * (-968.407) (-966.270) [-968.528] (-967.782) -- 0:00:56
      163000 -- (-966.430) [-972.398] (-969.728) (-968.177) * (-969.801) (-970.260) (-966.447) [-968.777] -- 0:00:56
      163500 -- (-965.973) (-968.131) (-966.310) [-967.981] * (-970.102) (-968.448) (-966.434) [-968.699] -- 0:00:56
      164000 -- (-966.299) [-970.816] (-967.857) (-966.428) * (-970.190) (-967.019) [-967.430] (-968.126) -- 0:00:56
      164500 -- (-967.199) [-968.119] (-968.942) (-967.260) * (-966.925) [-967.188] (-967.035) (-968.756) -- 0:00:55
      165000 -- (-969.489) (-968.816) [-970.288] (-967.330) * (-969.381) (-971.738) [-966.961] (-968.299) -- 0:00:55

      Average standard deviation of split frequencies: 0.017786

      165500 -- (-969.658) (-972.735) (-968.769) [-968.424] * (-970.317) (-966.785) (-966.796) [-966.354] -- 0:00:55
      166000 -- [-967.387] (-966.882) (-968.751) (-966.649) * (-969.441) (-966.954) [-966.397] (-966.107) -- 0:00:55
      166500 -- (-966.086) (-971.192) [-967.190] (-968.598) * [-967.752] (-968.589) (-967.628) (-968.470) -- 0:00:55
      167000 -- (-970.286) (-971.658) [-968.499] (-968.935) * (-967.764) (-968.218) (-967.346) [-971.833] -- 0:00:54
      167500 -- (-967.594) (-970.263) [-965.665] (-966.024) * [-971.271] (-968.268) (-971.251) (-967.802) -- 0:00:54
      168000 -- (-972.104) [-967.591] (-967.268) (-966.989) * [-968.040] (-971.413) (-972.608) (-966.357) -- 0:00:54
      168500 -- [-968.677] (-967.305) (-966.546) (-966.934) * (-966.880) (-968.390) [-969.076] (-966.264) -- 0:00:54
      169000 -- (-966.743) [-966.842] (-965.799) (-967.999) * (-966.678) (-968.898) [-968.873] (-966.805) -- 0:00:54
      169500 -- [-965.889] (-967.392) (-966.716) (-966.657) * [-966.580] (-968.877) (-971.351) (-967.949) -- 0:00:53
      170000 -- [-967.905] (-966.531) (-966.716) (-968.237) * (-968.377) (-968.877) [-968.983] (-967.378) -- 0:00:53

      Average standard deviation of split frequencies: 0.017033

      170500 -- (-966.731) [-969.255] (-967.801) (-966.899) * (-966.708) [-967.439] (-974.056) (-966.024) -- 0:00:53
      171000 -- (-967.093) (-968.902) (-967.167) [-967.178] * [-969.798] (-968.951) (-971.235) (-968.671) -- 0:00:53
      171500 -- (-969.505) [-967.596] (-967.525) (-969.306) * (-971.550) [-968.807] (-971.951) (-967.706) -- 0:00:53
      172000 -- (-966.360) (-969.906) [-966.490] (-972.120) * [-973.781] (-966.482) (-967.136) (-972.624) -- 0:00:52
      172500 -- [-965.941] (-966.176) (-966.782) (-970.279) * (-968.147) (-966.519) (-967.921) [-966.886] -- 0:00:52
      173000 -- (-965.975) (-967.426) (-968.049) [-968.554] * (-966.126) [-966.995] (-967.264) (-971.541) -- 0:00:52
      173500 -- (-966.282) (-969.651) [-966.676] (-968.785) * (-967.140) (-968.427) [-966.468] (-968.282) -- 0:00:52
      174000 -- (-966.173) (-972.390) (-970.296) [-969.405] * (-965.705) (-966.177) [-967.835] (-968.726) -- 0:00:52
      174500 -- (-966.226) (-969.009) (-967.470) [-969.054] * (-969.385) [-966.077] (-967.641) (-968.130) -- 0:00:52
      175000 -- (-966.913) (-972.618) [-969.804] (-967.795) * (-967.217) [-966.347] (-966.649) (-970.754) -- 0:00:51

      Average standard deviation of split frequencies: 0.018185

      175500 -- [-966.833] (-974.273) (-968.020) (-967.670) * [-969.777] (-967.251) (-967.403) (-968.493) -- 0:00:51
      176000 -- (-966.763) (-973.039) [-969.613] (-968.739) * (-965.891) (-967.222) [-968.915] (-973.612) -- 0:00:51
      176500 -- (-973.274) (-970.586) (-968.427) [-968.237] * (-967.481) [-967.222] (-974.043) (-970.441) -- 0:00:51
      177000 -- (-967.123) (-969.783) (-967.819) [-966.906] * [-966.893] (-968.590) (-968.532) (-970.547) -- 0:00:51
      177500 -- (-967.690) (-967.555) (-966.894) [-967.481] * [-968.479] (-968.658) (-968.842) (-968.134) -- 0:00:50
      178000 -- (-966.871) (-972.094) (-971.875) [-970.258] * (-969.451) [-968.501] (-967.423) (-967.868) -- 0:00:50
      178500 -- (-968.517) [-968.264] (-968.040) (-965.958) * (-966.731) [-969.487] (-966.011) (-967.063) -- 0:00:55
      179000 -- (-966.030) (-968.545) (-966.422) [-966.895] * (-966.804) [-969.465] (-968.466) (-967.370) -- 0:00:55
      179500 -- (-967.394) (-969.178) [-966.383] (-967.616) * (-966.885) [-967.604] (-968.092) (-967.834) -- 0:00:54
      180000 -- (-970.798) (-965.827) (-966.397) [-966.082] * (-968.792) (-968.631) (-966.751) [-968.117] -- 0:00:54

      Average standard deviation of split frequencies: 0.018555

      180500 -- [-968.664] (-968.915) (-968.264) (-966.637) * (-968.379) [-966.370] (-965.996) (-968.378) -- 0:00:54
      181000 -- (-965.772) (-969.899) (-966.570) [-967.344] * (-970.332) (-966.655) [-967.483] (-970.134) -- 0:00:54
      181500 -- (-965.809) [-972.712] (-968.885) (-973.686) * [-970.807] (-966.983) (-968.227) (-966.399) -- 0:00:54
      182000 -- [-967.678] (-969.202) (-967.796) (-966.053) * (-967.928) [-967.665] (-967.294) (-969.612) -- 0:00:53
      182500 -- [-966.691] (-971.481) (-968.968) (-967.447) * [-967.578] (-971.336) (-970.321) (-969.683) -- 0:00:53
      183000 -- (-967.209) (-970.252) [-966.171] (-970.639) * [-966.631] (-967.869) (-967.028) (-973.227) -- 0:00:53
      183500 -- (-967.625) (-967.609) [-966.683] (-967.451) * (-971.964) [-968.011] (-970.541) (-968.357) -- 0:00:53
      184000 -- (-971.118) (-967.898) [-969.041] (-968.989) * (-968.111) (-967.665) (-967.235) [-971.118] -- 0:00:53
      184500 -- [-969.227] (-966.785) (-966.607) (-969.387) * (-966.733) (-967.625) (-967.304) [-966.535] -- 0:00:53
      185000 -- [-967.603] (-967.813) (-966.607) (-973.522) * (-967.076) (-970.112) [-967.132] (-966.530) -- 0:00:52

      Average standard deviation of split frequencies: 0.017319

      185500 -- (-966.633) (-966.874) [-967.781] (-968.282) * (-967.794) (-970.054) (-966.852) [-969.157] -- 0:00:52
      186000 -- [-968.036] (-967.689) (-970.347) (-971.773) * (-967.222) (-967.277) (-969.226) [-966.868] -- 0:00:52
      186500 -- [-967.615] (-968.178) (-969.149) (-970.132) * (-971.483) (-966.959) [-967.468] (-967.220) -- 0:00:52
      187000 -- (-967.457) (-966.528) [-965.551] (-972.983) * (-967.727) [-968.710] (-967.242) (-968.839) -- 0:00:52
      187500 -- (-968.292) (-969.312) [-966.787] (-966.182) * (-969.064) [-967.785] (-968.553) (-967.288) -- 0:00:52
      188000 -- (-966.466) (-965.836) (-966.487) [-967.876] * (-970.155) [-972.872] (-968.291) (-968.392) -- 0:00:51
      188500 -- (-967.638) (-966.555) (-967.839) [-967.901] * (-968.577) (-970.119) (-968.133) [-969.647] -- 0:00:51
      189000 -- (-968.548) [-967.854] (-967.757) (-970.973) * (-971.736) (-966.460) (-971.487) [-965.830] -- 0:00:51
      189500 -- (-970.976) [-966.493] (-969.406) (-967.328) * [-970.732] (-967.574) (-967.054) (-965.863) -- 0:00:51
      190000 -- (-969.249) (-970.010) (-970.337) [-967.488] * (-971.777) (-965.814) [-966.634] (-966.454) -- 0:00:51

      Average standard deviation of split frequencies: 0.016757

      190500 -- (-971.054) (-965.973) (-968.063) [-966.248] * [-967.042] (-967.271) (-967.216) (-967.212) -- 0:00:50
      191000 -- [-972.250] (-967.101) (-966.608) (-965.554) * (-967.295) (-965.912) [-969.009] (-967.199) -- 0:00:50
      191500 -- [-969.716] (-967.762) (-970.721) (-969.886) * (-967.610) [-965.785] (-971.359) (-970.954) -- 0:00:50
      192000 -- [-965.837] (-966.339) (-969.323) (-967.046) * (-967.412) (-968.255) [-970.285] (-968.533) -- 0:00:50
      192500 -- [-965.760] (-965.736) (-968.971) (-966.969) * (-969.398) (-968.429) [-967.092] (-967.056) -- 0:00:50
      193000 -- (-966.301) (-966.456) (-970.720) [-969.447] * (-969.244) [-968.313] (-967.755) (-966.347) -- 0:00:50
      193500 -- [-966.790] (-975.223) (-969.326) (-966.203) * [-966.348] (-969.539) (-967.270) (-967.488) -- 0:00:50
      194000 -- [-966.739] (-967.329) (-969.592) (-965.940) * [-966.458] (-967.748) (-966.976) (-968.528) -- 0:00:49
      194500 -- (-972.256) (-969.345) (-967.758) [-965.819] * (-968.087) [-966.663] (-969.631) (-967.344) -- 0:00:53
      195000 -- (-968.869) (-969.127) [-971.039] (-966.506) * (-974.676) (-967.471) (-965.967) [-967.567] -- 0:00:53

      Average standard deviation of split frequencies: 0.015500

      195500 -- (-967.781) (-966.928) (-968.247) [-967.214] * (-965.811) [-967.252] (-967.953) (-967.687) -- 0:00:53
      196000 -- (-969.978) (-967.832) [-971.192] (-966.544) * (-968.221) (-966.537) [-966.086] (-966.321) -- 0:00:53
      196500 -- (-969.679) (-969.737) (-970.214) [-967.935] * [-969.534] (-970.019) (-966.047) (-971.789) -- 0:00:53
      197000 -- [-968.344] (-969.061) (-968.963) (-967.123) * [-967.201] (-970.715) (-968.255) (-967.313) -- 0:00:52
      197500 -- [-968.278] (-968.285) (-968.603) (-967.229) * (-971.502) (-967.862) (-967.166) [-969.376] -- 0:00:52
      198000 -- (-970.412) (-967.919) [-969.065] (-966.408) * [-972.853] (-967.712) (-967.378) (-967.315) -- 0:00:52
      198500 -- (-968.450) (-968.260) (-966.485) [-968.486] * (-966.650) (-970.150) (-971.011) [-968.189] -- 0:00:52
      199000 -- [-968.985] (-968.680) (-967.438) (-966.997) * (-969.461) [-966.943] (-970.941) (-967.276) -- 0:00:52
      199500 -- [-968.092] (-968.676) (-967.057) (-966.873) * (-974.188) [-967.003] (-966.146) (-968.807) -- 0:00:52
      200000 -- (-967.645) [-967.638] (-971.412) (-967.616) * [-967.609] (-966.494) (-969.855) (-967.290) -- 0:00:51

      Average standard deviation of split frequencies: 0.014095

      200500 -- (-966.539) [-967.810] (-967.817) (-970.864) * (-968.806) [-967.992] (-968.678) (-967.737) -- 0:00:51
      201000 -- [-966.981] (-967.300) (-968.582) (-966.031) * (-966.482) (-968.792) (-966.840) [-967.865] -- 0:00:51
      201500 -- (-966.407) [-969.929] (-967.482) (-970.091) * (-967.585) (-972.137) [-966.207] (-968.689) -- 0:00:51
      202000 -- [-965.787] (-971.970) (-968.320) (-968.086) * (-969.927) (-973.832) (-967.849) [-969.045] -- 0:00:51
      202500 -- (-968.303) (-972.069) [-970.019] (-976.876) * (-968.424) (-973.496) [-968.492] (-970.109) -- 0:00:51
      203000 -- [-970.578] (-971.110) (-966.676) (-969.409) * (-971.263) [-972.894] (-966.403) (-972.187) -- 0:00:51
      203500 -- [-968.753] (-969.742) (-968.188) (-971.470) * [-973.541] (-969.197) (-969.465) (-969.932) -- 0:00:50
      204000 -- [-966.980] (-970.027) (-966.789) (-970.338) * (-974.458) [-967.115] (-967.866) (-967.934) -- 0:00:50
      204500 -- [-967.032] (-971.898) (-970.838) (-966.428) * (-970.851) (-969.278) (-969.686) [-966.503] -- 0:00:50
      205000 -- (-970.519) [-968.013] (-966.461) (-965.975) * [-966.408] (-966.505) (-970.285) (-968.112) -- 0:00:50

      Average standard deviation of split frequencies: 0.013730

      205500 -- (-969.820) [-967.471] (-969.484) (-968.497) * (-967.866) (-969.115) (-970.892) [-968.976] -- 0:00:50
      206000 -- (-968.959) (-967.548) [-969.974] (-966.291) * (-970.619) (-969.278) [-969.709] (-966.757) -- 0:00:50
      206500 -- (-968.757) (-966.095) (-970.451) [-965.934] * [-969.266] (-967.843) (-968.306) (-970.945) -- 0:00:49
      207000 -- (-967.336) (-968.347) [-967.526] (-966.738) * (-968.704) (-967.677) (-969.959) [-968.048] -- 0:00:49
      207500 -- [-969.523] (-969.776) (-971.458) (-969.962) * [-967.553] (-966.520) (-973.843) (-971.018) -- 0:00:49
      208000 -- [-967.568] (-968.279) (-970.323) (-968.615) * [-968.214] (-966.947) (-974.233) (-967.794) -- 0:00:49
      208500 -- (-971.156) (-965.942) [-968.189] (-970.442) * [-966.325] (-966.475) (-971.966) (-967.401) -- 0:00:49
      209000 -- (-968.029) [-965.942] (-978.378) (-966.476) * (-968.076) (-972.472) [-970.549] (-968.714) -- 0:00:49
      209500 -- (-966.458) (-969.280) [-968.183] (-967.822) * (-966.107) (-968.441) (-973.788) [-968.340] -- 0:00:49
      210000 -- (-967.876) (-966.327) [-967.177] (-968.499) * [-970.683] (-967.648) (-968.016) (-969.102) -- 0:00:48

      Average standard deviation of split frequencies: 0.013426

      210500 -- (-969.435) (-966.279) (-968.061) [-967.410] * (-968.381) (-967.808) [-968.396] (-969.075) -- 0:00:48
      211000 -- (-967.823) (-966.969) (-967.678) [-967.275] * [-967.449] (-973.164) (-968.323) (-970.074) -- 0:00:52
      211500 -- (-969.209) (-966.542) (-967.665) [-966.500] * (-966.299) (-968.440) [-966.711] (-969.759) -- 0:00:52
      212000 -- (-967.568) [-966.538] (-967.128) (-966.730) * (-965.937) (-967.434) [-970.739] (-968.426) -- 0:00:52
      212500 -- (-967.372) (-966.176) (-966.748) [-966.848] * [-965.796] (-969.313) (-969.031) (-966.508) -- 0:00:51
      213000 -- [-968.549] (-972.067) (-967.061) (-969.761) * (-968.321) (-968.359) (-966.193) [-969.203] -- 0:00:51
      213500 -- [-967.690] (-970.719) (-968.628) (-966.177) * [-967.965] (-967.288) (-968.226) (-965.937) -- 0:00:51
      214000 -- (-965.517) (-967.800) [-967.691] (-965.900) * [-967.113] (-968.345) (-971.895) (-965.733) -- 0:00:51
      214500 -- (-965.556) (-968.182) [-967.206] (-966.385) * (-968.014) (-971.549) (-969.599) [-967.496] -- 0:00:51
      215000 -- (-966.021) [-967.145] (-970.631) (-966.911) * (-974.716) [-967.892] (-966.630) (-970.963) -- 0:00:51

      Average standard deviation of split frequencies: 0.013784

      215500 -- [-966.841] (-967.191) (-968.233) (-967.355) * [-968.888] (-966.150) (-967.129) (-968.474) -- 0:00:50
      216000 -- (-968.874) (-970.321) (-966.738) [-966.477] * (-968.177) (-966.630) (-966.531) [-967.751] -- 0:00:50
      216500 -- (-967.371) (-969.408) [-969.493] (-968.427) * (-970.559) (-968.270) [-966.703] (-966.270) -- 0:00:50
      217000 -- (-969.206) (-968.355) [-967.843] (-968.438) * (-970.053) (-967.942) [-967.307] (-971.298) -- 0:00:50
      217500 -- (-969.803) [-968.233] (-975.168) (-969.494) * (-968.333) (-969.471) [-966.802] (-968.986) -- 0:00:50
      218000 -- [-967.998] (-965.697) (-969.195) (-969.027) * (-967.204) (-969.175) (-968.319) [-966.351] -- 0:00:50
      218500 -- (-967.609) (-971.846) (-966.636) [-970.478] * (-968.664) (-967.985) [-968.374] (-967.258) -- 0:00:50
      219000 -- [-966.816] (-967.932) (-966.664) (-967.258) * (-965.964) (-971.572) [-967.968] (-967.689) -- 0:00:49
      219500 -- (-967.457) [-966.759] (-968.482) (-969.166) * (-966.152) [-967.833] (-969.985) (-967.170) -- 0:00:49
      220000 -- (-970.621) [-966.894] (-971.987) (-967.715) * (-965.937) (-967.453) (-969.354) [-967.108] -- 0:00:49

      Average standard deviation of split frequencies: 0.013767

      220500 -- (-967.603) (-965.932) (-968.862) [-965.918] * [-965.929] (-966.238) (-970.442) (-969.469) -- 0:00:49
      221000 -- (-967.551) (-969.605) [-967.293] (-968.207) * (-965.852) (-966.607) (-968.621) [-966.230] -- 0:00:49
      221500 -- [-967.412] (-966.177) (-967.414) (-969.255) * [-966.476] (-965.582) (-966.260) (-966.133) -- 0:00:49
      222000 -- (-968.981) [-966.678] (-968.096) (-967.755) * (-966.599) (-967.276) [-968.760] (-969.571) -- 0:00:49
      222500 -- (-968.115) [-968.629] (-973.683) (-968.247) * (-969.949) [-966.216] (-966.205) (-966.125) -- 0:00:48
      223000 -- (-966.516) [-966.559] (-974.751) (-966.800) * (-968.959) (-968.981) [-966.645] (-966.800) -- 0:00:48
      223500 -- (-967.302) (-965.972) [-968.056] (-967.747) * (-969.901) [-971.512] (-966.541) (-966.708) -- 0:00:48
      224000 -- (-967.395) [-967.500] (-966.362) (-968.143) * [-969.386] (-967.591) (-972.085) (-968.594) -- 0:00:48
      224500 -- (-969.754) (-968.335) (-968.978) [-967.732] * (-969.326) (-967.424) (-967.710) [-967.648] -- 0:00:48
      225000 -- [-969.847] (-968.359) (-969.391) (-966.493) * (-974.265) (-968.384) [-966.896] (-966.863) -- 0:00:48

      Average standard deviation of split frequencies: 0.013871

      225500 -- (-969.764) (-968.888) [-971.161] (-966.259) * [-968.351] (-967.826) (-966.896) (-966.751) -- 0:00:48
      226000 -- (-966.783) [-968.025] (-970.996) (-966.366) * (-967.747) (-967.859) [-966.118] (-970.606) -- 0:00:47
      226500 -- (-969.718) (-970.021) [-967.835] (-968.576) * [-967.056] (-971.029) (-966.863) (-966.981) -- 0:00:47
      227000 -- (-970.026) [-966.380] (-967.229) (-966.689) * (-966.978) [-969.848] (-966.053) (-967.829) -- 0:00:47
      227500 -- (-968.721) [-966.452] (-969.157) (-967.226) * [-966.340] (-965.865) (-969.723) (-966.936) -- 0:00:50
      228000 -- [-966.860] (-966.353) (-968.692) (-967.204) * (-967.137) [-966.663] (-970.308) (-969.014) -- 0:00:50
      228500 -- [-968.703] (-967.716) (-966.718) (-968.203) * (-968.118) [-967.647] (-968.156) (-967.200) -- 0:00:50
      229000 -- (-967.625) [-967.102] (-967.021) (-966.634) * [-969.323] (-967.884) (-970.356) (-967.629) -- 0:00:50
      229500 -- [-966.841] (-965.681) (-966.977) (-967.555) * (-965.638) [-966.335] (-969.675) (-968.737) -- 0:00:50
      230000 -- [-967.861] (-965.689) (-967.297) (-971.537) * [-966.728] (-966.845) (-966.007) (-967.812) -- 0:00:50

      Average standard deviation of split frequencies: 0.015381

      230500 -- (-968.851) (-968.307) (-969.603) [-968.743] * [-965.775] (-966.807) (-966.684) (-966.375) -- 0:00:50
      231000 -- (-968.852) [-969.626] (-969.520) (-969.444) * (-966.260) (-966.755) (-967.412) [-966.873] -- 0:00:49
      231500 -- (-968.711) (-968.017) [-968.979] (-970.978) * (-967.014) (-967.906) (-966.623) [-966.810] -- 0:00:49
      232000 -- [-967.597] (-967.143) (-970.141) (-967.908) * (-966.499) (-967.205) [-967.152] (-967.856) -- 0:00:49
      232500 -- [-966.463] (-967.794) (-967.741) (-966.835) * [-975.351] (-965.718) (-967.951) (-968.389) -- 0:00:49
      233000 -- [-968.990] (-968.514) (-968.542) (-969.130) * (-969.512) [-966.055] (-967.049) (-969.394) -- 0:00:49
      233500 -- (-968.876) [-966.974] (-968.630) (-967.665) * [-968.966] (-967.634) (-967.282) (-970.191) -- 0:00:49
      234000 -- [-969.497] (-967.575) (-967.211) (-967.425) * (-968.623) [-965.680] (-967.500) (-966.639) -- 0:00:49
      234500 -- [-967.175] (-967.239) (-967.553) (-968.473) * (-966.626) (-967.875) (-967.773) [-967.258] -- 0:00:48
      235000 -- (-970.002) (-965.854) [-967.547] (-966.721) * (-968.548) [-971.419] (-966.445) (-969.083) -- 0:00:48

      Average standard deviation of split frequencies: 0.016190

      235500 -- [-968.631] (-967.509) (-971.675) (-967.021) * (-970.009) (-975.698) [-970.200] (-967.200) -- 0:00:48
      236000 -- (-965.976) (-968.816) (-968.979) [-966.398] * (-968.025) (-967.667) [-967.850] (-968.776) -- 0:00:48
      236500 -- (-966.223) (-966.230) (-976.665) [-968.526] * (-969.947) [-971.321] (-972.258) (-967.930) -- 0:00:48
      237000 -- (-967.775) [-967.515] (-968.803) (-966.443) * (-966.534) [-969.512] (-968.323) (-969.569) -- 0:00:48
      237500 -- [-967.364] (-971.280) (-968.994) (-967.287) * (-968.015) (-969.973) [-966.239] (-967.399) -- 0:00:48
      238000 -- (-966.978) [-967.655] (-968.050) (-975.713) * (-968.162) (-969.898) (-966.915) [-966.424] -- 0:00:48
      238500 -- (-967.889) [-966.435] (-971.524) (-968.966) * (-968.378) [-968.538] (-967.581) (-966.227) -- 0:00:47
      239000 -- (-967.824) [-967.099] (-971.236) (-967.773) * [-968.107] (-967.108) (-969.226) (-968.931) -- 0:00:47
      239500 -- (-967.464) (-968.247) [-969.371] (-967.069) * (-968.232) (-969.634) (-968.675) [-966.696] -- 0:00:47
      240000 -- (-969.198) (-968.241) (-967.089) [-967.115] * (-967.332) (-973.397) [-968.883] (-967.168) -- 0:00:47

      Average standard deviation of split frequencies: 0.015343

      240500 -- (-968.448) [-971.107] (-967.810) (-967.304) * (-968.526) [-966.992] (-966.593) (-967.347) -- 0:00:47
      241000 -- (-970.700) (-967.339) (-967.277) [-966.925] * [-966.282] (-967.976) (-966.015) (-965.916) -- 0:00:47
      241500 -- (-968.524) [-967.375] (-968.000) (-968.017) * (-966.282) [-969.095] (-967.661) (-972.655) -- 0:00:47
      242000 -- [-968.724] (-970.074) (-968.987) (-972.337) * [-967.121] (-970.294) (-970.748) (-970.795) -- 0:00:46
      242500 -- (-967.640) [-969.250] (-966.554) (-970.183) * (-966.793) [-969.006] (-967.857) (-971.477) -- 0:00:46
      243000 -- (-974.559) (-969.476) (-969.520) [-967.487] * [-966.805] (-972.380) (-969.282) (-969.108) -- 0:00:46
      243500 -- [-971.988] (-966.322) (-969.899) (-967.204) * (-967.282) (-968.011) (-969.669) [-966.182] -- 0:00:46
      244000 -- (-969.686) (-969.452) (-967.730) [-970.605] * (-969.439) (-968.289) (-967.207) [-966.147] -- 0:00:49
      244500 -- (-975.703) (-967.137) (-967.391) [-966.976] * [-969.160] (-968.612) (-967.538) (-965.727) -- 0:00:49
      245000 -- (-968.922) [-967.514] (-967.005) (-966.543) * (-967.938) (-968.054) (-969.904) [-967.656] -- 0:00:49

      Average standard deviation of split frequencies: 0.015734

      245500 -- [-967.074] (-968.058) (-968.447) (-968.297) * [-966.495] (-971.420) (-970.725) (-966.178) -- 0:00:49
      246000 -- (-967.461) (-970.590) (-972.463) [-967.489] * (-968.374) [-968.443] (-966.739) (-967.467) -- 0:00:49
      246500 -- (-967.969) (-971.711) (-968.808) [-967.679] * (-967.935) (-968.280) [-967.475] (-966.265) -- 0:00:48
      247000 -- [-966.695] (-966.294) (-968.287) (-967.756) * (-967.027) (-967.172) [-967.056] (-968.313) -- 0:00:48
      247500 -- (-966.760) (-974.010) (-967.335) [-966.494] * (-967.248) [-967.398] (-966.930) (-967.503) -- 0:00:48
      248000 -- (-969.126) [-971.613] (-967.536) (-968.187) * [-966.410] (-967.739) (-968.318) (-965.826) -- 0:00:48
      248500 -- (-972.275) [-966.166] (-969.283) (-967.789) * (-972.080) (-965.783) (-970.827) [-966.976] -- 0:00:48
      249000 -- (-968.226) [-966.864] (-968.588) (-967.789) * (-968.236) (-967.427) (-966.340) [-967.703] -- 0:00:48
      249500 -- (-970.293) [-966.370] (-970.559) (-968.746) * [-967.046] (-969.531) (-965.868) (-970.891) -- 0:00:48
      250000 -- [-967.928] (-968.648) (-968.297) (-966.736) * (-965.966) (-969.714) (-968.030) [-970.004] -- 0:00:48

      Average standard deviation of split frequencies: 0.015342

      250500 -- (-967.818) (-968.288) (-968.667) [-966.396] * (-968.466) [-969.687] (-971.197) (-966.326) -- 0:00:47
      251000 -- (-967.838) (-971.444) [-968.307] (-967.008) * (-967.892) (-970.690) [-974.429] (-966.390) -- 0:00:47
      251500 -- [-967.874] (-968.810) (-967.983) (-965.984) * [-967.474] (-966.808) (-972.881) (-968.535) -- 0:00:47
      252000 -- (-967.312) [-968.903] (-969.045) (-965.974) * (-969.394) (-967.905) (-968.013) [-970.181] -- 0:00:47
      252500 -- (-967.440) [-966.687] (-968.648) (-966.244) * [-968.443] (-968.774) (-968.510) (-966.710) -- 0:00:47
      253000 -- (-970.407) (-968.255) [-968.557] (-967.857) * [-966.416] (-969.289) (-970.851) (-970.267) -- 0:00:47
      253500 -- [-974.605] (-968.257) (-968.318) (-969.360) * (-966.733) (-970.596) (-968.234) [-968.129] -- 0:00:47
      254000 -- (-969.558) [-967.857] (-969.972) (-969.164) * (-966.577) (-966.035) (-967.050) [-971.794] -- 0:00:46
      254500 -- (-969.263) (-965.971) [-969.668] (-966.528) * (-969.221) (-968.183) [-967.473] (-970.559) -- 0:00:46
      255000 -- (-969.423) [-968.114] (-967.255) (-966.035) * (-970.039) [-968.001] (-967.535) (-966.946) -- 0:00:46

      Average standard deviation of split frequencies: 0.014731

      255500 -- (-966.907) (-967.412) (-967.752) [-968.112] * (-972.321) [-966.728] (-969.042) (-966.468) -- 0:00:46
      256000 -- (-968.561) [-967.337] (-967.470) (-968.503) * (-968.323) (-968.919) [-966.990] (-968.749) -- 0:00:46
      256500 -- (-968.771) (-967.510) (-966.347) [-968.460] * (-966.052) (-970.107) (-971.819) [-968.612] -- 0:00:46
      257000 -- (-969.626) [-967.838] (-970.605) (-972.090) * [-966.906] (-971.647) (-967.421) (-969.815) -- 0:00:46
      257500 -- (-969.960) (-969.786) [-967.467] (-968.370) * (-966.682) (-973.128) (-968.686) [-969.163] -- 0:00:46
      258000 -- (-967.669) (-967.494) (-967.924) [-969.200] * (-968.572) [-967.084] (-968.556) (-968.354) -- 0:00:46
      258500 -- (-967.510) (-970.331) [-967.184] (-968.742) * [-968.692] (-965.750) (-968.753) (-969.676) -- 0:00:45
      259000 -- (-969.535) [-971.061] (-968.681) (-967.618) * (-969.280) (-965.457) [-967.856] (-970.672) -- 0:00:45
      259500 -- (-971.308) (-966.528) [-969.368] (-968.930) * (-968.054) (-968.080) [-967.062] (-970.492) -- 0:00:45
      260000 -- (-966.792) (-966.153) (-974.051) [-968.192] * (-970.152) (-965.918) [-971.773] (-971.209) -- 0:00:45

      Average standard deviation of split frequencies: 0.014574

      260500 -- (-967.810) [-969.572] (-974.599) (-968.565) * (-967.320) (-967.239) [-970.700] (-966.011) -- 0:00:48
      261000 -- (-969.210) (-968.713) [-966.653] (-974.465) * (-970.372) (-969.009) (-969.336) [-966.321] -- 0:00:48
      261500 -- (-966.454) (-967.194) (-971.216) [-968.235] * (-971.585) [-967.081] (-971.376) (-969.951) -- 0:00:48
      262000 -- [-966.271] (-966.762) (-967.116) (-980.415) * (-968.012) (-966.972) (-969.884) [-970.706] -- 0:00:47
      262500 -- (-966.579) (-968.326) (-966.603) [-968.322] * [-966.233] (-966.974) (-966.789) (-967.471) -- 0:00:47
      263000 -- (-966.579) [-967.474] (-969.584) (-967.837) * (-968.385) (-968.030) [-966.571] (-967.746) -- 0:00:47
      263500 -- (-967.484) [-969.728] (-968.967) (-966.610) * [-967.349] (-967.351) (-971.729) (-967.776) -- 0:00:47
      264000 -- (-966.783) (-968.930) [-969.067] (-967.702) * (-968.408) [-967.187] (-969.850) (-966.883) -- 0:00:47
      264500 -- [-969.411] (-975.695) (-972.002) (-966.353) * [-966.786] (-968.160) (-967.265) (-966.114) -- 0:00:47
      265000 -- (-966.510) (-967.701) (-967.379) [-966.074] * (-970.223) [-967.923] (-969.283) (-968.362) -- 0:00:47

      Average standard deviation of split frequencies: 0.015556

      265500 -- (-966.646) (-966.196) (-969.179) [-970.441] * (-966.938) (-969.340) [-966.519] (-967.380) -- 0:00:47
      266000 -- (-970.054) [-969.743] (-970.886) (-969.267) * (-966.135) (-966.788) (-966.532) [-966.810] -- 0:00:46
      266500 -- (-967.590) (-967.802) [-972.428] (-971.929) * (-969.602) (-966.410) [-966.432] (-967.223) -- 0:00:46
      267000 -- (-966.300) (-967.593) (-970.349) [-967.650] * (-968.147) [-966.829] (-966.600) (-968.998) -- 0:00:46
      267500 -- (-973.913) (-966.455) [-969.528] (-965.848) * (-971.516) [-969.850] (-967.408) (-971.240) -- 0:00:46
      268000 -- (-967.913) (-966.457) [-969.474] (-966.684) * (-970.396) (-969.968) [-966.876] (-967.927) -- 0:00:46
      268500 -- (-967.106) (-966.501) (-968.554) [-967.759] * (-968.559) (-967.073) [-966.784] (-966.846) -- 0:00:46
      269000 -- (-967.200) [-966.733] (-968.289) (-967.326) * (-969.416) [-966.491] (-967.451) (-966.961) -- 0:00:46
      269500 -- (-967.636) (-969.259) (-966.384) [-967.583] * (-968.972) (-966.412) [-966.844] (-970.521) -- 0:00:46
      270000 -- (-966.521) (-973.166) [-968.536] (-968.500) * (-969.702) [-970.507] (-967.453) (-970.088) -- 0:00:45

      Average standard deviation of split frequencies: 0.015675

      270500 -- (-966.357) (-967.491) (-966.876) [-967.876] * (-967.716) (-967.737) [-968.389] (-966.860) -- 0:00:45
      271000 -- (-969.383) [-967.286] (-968.482) (-966.932) * [-967.603] (-969.101) (-967.325) (-967.964) -- 0:00:45
      271500 -- (-967.251) (-966.894) (-971.929) [-966.718] * (-968.479) [-971.770] (-969.322) (-971.675) -- 0:00:45
      272000 -- [-967.835] (-966.702) (-968.282) (-968.383) * (-970.650) (-968.355) [-968.534] (-967.897) -- 0:00:45
      272500 -- (-968.143) (-967.362) [-970.041] (-971.014) * (-968.290) (-967.591) [-968.106] (-970.166) -- 0:00:45
      273000 -- (-967.214) (-967.370) [-966.935] (-968.392) * (-971.839) (-967.875) (-967.054) [-968.248] -- 0:00:45
      273500 -- [-967.370] (-967.275) (-967.468) (-968.094) * (-969.173) (-968.466) [-968.966] (-969.096) -- 0:00:45
      274000 -- [-968.678] (-967.293) (-966.103) (-966.109) * (-969.389) [-968.210] (-969.806) (-970.269) -- 0:00:45
      274500 -- (-971.367) (-971.768) (-966.260) [-967.519] * (-969.621) [-966.713] (-966.912) (-968.792) -- 0:00:44
      275000 -- [-970.199] (-969.362) (-966.718) (-967.343) * (-968.128) (-967.928) [-967.829] (-967.728) -- 0:00:44

      Average standard deviation of split frequencies: 0.016276

      275500 -- [-970.045] (-968.020) (-967.469) (-967.015) * (-972.142) (-965.570) (-968.376) [-967.778] -- 0:00:44
      276000 -- (-976.315) (-967.867) (-967.235) [-968.220] * [-966.330] (-966.967) (-973.843) (-966.963) -- 0:00:44
      276500 -- (-972.087) (-966.950) (-969.062) [-970.420] * [-965.995] (-967.808) (-969.017) (-967.254) -- 0:00:44
      277000 -- (-967.968) [-971.370] (-967.023) (-971.054) * [-969.333] (-966.159) (-967.911) (-967.410) -- 0:00:46
      277500 -- [-967.365] (-966.959) (-967.225) (-968.561) * (-967.250) (-968.951) (-967.964) [-966.195] -- 0:00:46
      278000 -- (-970.245) (-969.613) [-968.371] (-968.235) * (-967.783) [-966.449] (-966.828) (-967.042) -- 0:00:46
      278500 -- [-968.397] (-967.271) (-972.069) (-967.370) * (-967.339) (-966.233) [-967.033] (-970.900) -- 0:00:46
      279000 -- [-968.214] (-967.719) (-968.410) (-966.793) * [-967.182] (-968.665) (-966.388) (-971.790) -- 0:00:46
      279500 -- [-968.070] (-969.282) (-969.302) (-969.611) * [-966.552] (-966.407) (-967.176) (-969.832) -- 0:00:46
      280000 -- (-966.581) (-968.530) [-966.715] (-966.957) * [-966.480] (-970.366) (-966.807) (-975.767) -- 0:00:46

      Average standard deviation of split frequencies: 0.015011

      280500 -- [-966.052] (-966.772) (-968.306) (-967.223) * (-967.837) (-967.268) (-967.626) [-969.536] -- 0:00:46
      281000 -- (-966.821) (-970.830) (-967.005) [-967.660] * [-970.567] (-965.759) (-969.146) (-970.155) -- 0:00:46
      281500 -- (-966.564) (-974.193) [-967.008] (-968.320) * (-966.974) [-966.781] (-968.584) (-969.216) -- 0:00:45
      282000 -- [-966.160] (-969.655) (-966.745) (-967.188) * (-966.514) (-968.342) (-967.840) [-966.784] -- 0:00:45
      282500 -- (-967.159) (-970.229) [-967.318] (-970.262) * (-966.514) (-967.306) (-967.094) [-966.805] -- 0:00:45
      283000 -- (-967.391) (-970.908) (-967.326) [-969.056] * (-968.933) (-967.771) [-967.110] (-966.566) -- 0:00:45
      283500 -- (-969.490) (-966.072) [-967.911] (-971.497) * (-967.152) (-967.717) [-966.757] (-966.152) -- 0:00:45
      284000 -- [-967.149] (-967.602) (-967.105) (-966.613) * (-967.933) (-967.679) (-969.362) [-966.144] -- 0:00:45
      284500 -- (-966.617) (-968.099) [-966.768] (-967.349) * (-970.957) (-976.866) [-968.799] (-966.795) -- 0:00:45
      285000 -- (-969.355) (-968.807) [-966.733] (-969.503) * (-970.069) (-971.318) (-971.103) [-966.788] -- 0:00:45

      Average standard deviation of split frequencies: 0.015143

      285500 -- (-970.871) (-969.642) (-966.632) [-967.959] * (-970.239) [-968.049] (-969.824) (-966.387) -- 0:00:45
      286000 -- (-968.453) [-966.186] (-966.454) (-968.866) * (-967.692) (-967.626) (-968.264) [-970.058] -- 0:00:44
      286500 -- (-970.388) [-967.983] (-970.342) (-970.135) * (-966.392) (-968.009) [-967.536] (-969.353) -- 0:00:44
      287000 -- (-968.699) (-969.392) (-966.624) [-968.419] * (-967.986) [-970.144] (-966.807) (-968.738) -- 0:00:44
      287500 -- (-967.233) [-967.062] (-966.635) (-968.201) * (-965.872) (-971.537) [-968.429] (-970.784) -- 0:00:44
      288000 -- (-967.052) (-968.450) [-967.389] (-967.124) * (-966.722) (-971.572) (-969.892) [-967.249] -- 0:00:44
      288500 -- (-968.775) [-967.845] (-967.247) (-967.714) * [-966.931] (-971.157) (-972.688) (-967.019) -- 0:00:44
      289000 -- [-967.132] (-966.487) (-968.501) (-968.030) * [-967.104] (-971.389) (-967.151) (-970.945) -- 0:00:44
      289500 -- [-966.881] (-966.474) (-966.876) (-968.229) * (-966.582) [-966.944] (-966.643) (-970.312) -- 0:00:44
      290000 -- (-970.094) (-966.296) [-969.462] (-967.656) * (-967.099) (-969.227) (-966.515) [-968.846] -- 0:00:44

      Average standard deviation of split frequencies: 0.014596

      290500 -- (-968.293) [-968.870] (-966.824) (-968.277) * [-966.422] (-968.804) (-969.443) (-969.806) -- 0:00:43
      291000 -- (-970.225) [-969.061] (-967.443) (-967.450) * (-968.751) (-966.306) [-967.916] (-969.244) -- 0:00:43
      291500 -- (-967.024) (-971.043) [-969.190] (-967.578) * [-966.810] (-966.106) (-968.805) (-970.483) -- 0:00:43
      292000 -- (-966.047) [-968.127] (-973.141) (-966.429) * (-966.338) (-966.446) [-968.217] (-968.066) -- 0:00:43
      292500 -- [-966.920] (-973.345) (-966.374) (-966.742) * [-971.990] (-969.280) (-967.268) (-968.841) -- 0:00:43
      293000 -- (-966.766) (-969.080) [-967.106] (-970.971) * (-980.031) [-970.439] (-967.014) (-967.509) -- 0:00:43
      293500 -- (-970.452) (-968.076) (-966.090) [-968.228] * [-972.671] (-966.600) (-967.331) (-969.657) -- 0:00:45
      294000 -- (-971.391) (-967.067) [-966.715] (-967.018) * (-969.371) (-970.500) (-965.597) [-970.681] -- 0:00:45
      294500 -- (-971.069) (-966.277) (-966.711) [-966.904] * (-971.505) [-968.825] (-965.813) (-967.982) -- 0:00:45
      295000 -- [-966.971] (-967.028) (-966.869) (-967.675) * [-968.076] (-968.750) (-967.214) (-969.208) -- 0:00:45

      Average standard deviation of split frequencies: 0.014895

      295500 -- (-966.909) (-968.873) [-967.503] (-970.191) * (-966.583) (-968.684) (-969.262) [-966.863] -- 0:00:45
      296000 -- [-967.769] (-966.243) (-966.480) (-970.465) * [-966.047] (-968.656) (-967.708) (-970.654) -- 0:00:45
      296500 -- (-967.572) (-966.118) (-966.808) [-969.233] * (-968.100) [-968.231] (-967.237) (-968.286) -- 0:00:45
      297000 -- (-967.284) (-966.068) (-966.606) [-967.465] * (-967.935) (-969.345) (-966.535) [-969.517] -- 0:00:44
      297500 -- (-967.136) (-968.662) (-967.696) [-967.160] * (-970.994) [-968.311] (-967.380) (-968.711) -- 0:00:44
      298000 -- [-969.120] (-969.615) (-968.768) (-969.268) * (-968.531) (-967.731) (-968.318) [-967.225] -- 0:00:44
      298500 -- [-969.616] (-970.685) (-968.161) (-969.392) * (-966.944) [-967.680] (-969.005) (-965.950) -- 0:00:44
      299000 -- (-968.316) [-969.339] (-967.660) (-969.195) * (-970.050) (-967.061) (-967.521) [-968.008] -- 0:00:44
      299500 -- (-968.194) (-970.136) [-966.871] (-969.664) * (-966.266) [-966.659] (-966.718) (-970.128) -- 0:00:44
      300000 -- (-965.863) (-969.878) [-966.334] (-967.059) * (-967.569) [-970.517] (-965.745) (-967.294) -- 0:00:44

      Average standard deviation of split frequencies: 0.014797

      300500 -- (-967.065) (-966.192) [-966.773] (-969.598) * (-967.937) (-967.301) (-969.362) [-968.111] -- 0:00:44
      301000 -- (-973.223) (-968.375) [-965.922] (-969.358) * [-965.984] (-967.380) (-969.919) (-970.402) -- 0:00:44
      301500 -- (-970.215) (-968.453) (-965.690) [-968.085] * (-967.912) (-970.110) (-970.011) [-967.249] -- 0:00:44
      302000 -- [-970.658] (-966.851) (-967.754) (-970.624) * (-967.827) (-969.617) [-967.515] (-967.836) -- 0:00:43
      302500 -- [-966.763] (-967.211) (-967.519) (-967.080) * (-966.694) [-966.970] (-970.239) (-969.447) -- 0:00:43
      303000 -- (-972.114) (-967.757) [-967.705] (-967.589) * (-966.413) [-967.097] (-970.399) (-969.167) -- 0:00:43
      303500 -- (-968.113) [-968.358] (-968.423) (-967.607) * (-968.120) (-970.339) (-967.769) [-967.613] -- 0:00:43
      304000 -- (-966.637) [-968.150] (-968.237) (-967.711) * [-966.771] (-971.516) (-968.539) (-967.795) -- 0:00:43
      304500 -- (-969.865) (-967.431) (-966.905) [-967.659] * (-968.358) (-970.859) (-971.398) [-966.698] -- 0:00:43
      305000 -- (-967.668) [-967.753] (-968.726) (-967.866) * [-967.807] (-967.525) (-969.179) (-967.977) -- 0:00:43

      Average standard deviation of split frequencies: 0.012868

      305500 -- (-967.979) (-970.811) [-966.088] (-968.110) * (-966.976) (-967.226) (-970.280) [-970.993] -- 0:00:43
      306000 -- [-967.132] (-971.561) (-970.738) (-971.134) * [-969.699] (-968.032) (-970.559) (-970.678) -- 0:00:43
      306500 -- [-968.873] (-967.387) (-970.001) (-967.719) * (-968.821) (-967.695) [-967.547] (-968.898) -- 0:00:42
      307000 -- [-966.792] (-966.640) (-966.979) (-967.805) * (-965.786) (-967.244) (-967.440) [-967.200] -- 0:00:42
      307500 -- [-966.111] (-967.442) (-965.930) (-967.490) * [-967.354] (-972.690) (-969.547) (-968.478) -- 0:00:42
      308000 -- (-969.218) (-966.312) [-966.019] (-968.416) * (-967.862) (-968.058) (-968.438) [-967.468] -- 0:00:42
      308500 -- (-969.452) (-966.372) (-966.977) [-969.093] * (-968.774) (-969.914) [-967.637] (-968.395) -- 0:00:42
      309000 -- (-969.402) (-968.048) (-967.655) [-966.913] * [-968.404] (-970.748) (-968.934) (-968.486) -- 0:00:42
      309500 -- (-970.411) (-966.560) (-967.967) [-966.925] * (-970.998) (-966.592) [-970.585] (-966.580) -- 0:00:42
      310000 -- (-970.590) (-968.376) [-967.698] (-966.987) * (-968.092) (-967.772) [-972.425] (-967.843) -- 0:00:44

      Average standard deviation of split frequencies: 0.012050

      310500 -- [-969.044] (-969.873) (-969.181) (-966.130) * (-974.955) (-971.033) [-966.330] (-966.947) -- 0:00:44
      311000 -- (-969.145) (-970.833) (-969.644) [-968.637] * [-970.709] (-966.920) (-966.898) (-967.448) -- 0:00:44
      311500 -- [-968.217] (-967.989) (-968.385) (-971.812) * (-967.898) (-969.509) [-966.398] (-967.610) -- 0:00:44
      312000 -- (-966.676) (-967.361) (-968.082) [-967.653] * (-970.785) (-973.239) [-966.871] (-969.666) -- 0:00:44
      312500 -- [-967.238] (-970.773) (-967.752) (-965.911) * [-971.173] (-973.447) (-966.417) (-967.511) -- 0:00:44
      313000 -- (-969.800) (-968.738) [-968.771] (-972.515) * [-968.818] (-967.452) (-967.553) (-968.378) -- 0:00:43
      313500 -- (-971.522) (-967.561) [-968.192] (-969.973) * (-967.375) [-970.439] (-967.781) (-971.264) -- 0:00:43
      314000 -- (-969.339) (-967.300) [-969.266] (-971.016) * (-965.903) (-968.227) [-968.224] (-966.818) -- 0:00:43
      314500 -- [-968.931] (-966.663) (-968.724) (-969.424) * (-967.800) (-968.881) [-969.215] (-967.843) -- 0:00:43
      315000 -- (-967.205) [-967.950] (-968.676) (-968.095) * [-967.109] (-968.192) (-969.155) (-968.243) -- 0:00:43

      Average standard deviation of split frequencies: 0.012987

      315500 -- (-967.797) (-970.428) [-970.026] (-969.574) * [-971.200] (-967.377) (-973.383) (-970.546) -- 0:00:43
      316000 -- (-966.866) (-967.017) [-966.637] (-969.826) * [-968.679] (-966.795) (-974.494) (-967.243) -- 0:00:43
      316500 -- (-967.449) (-965.769) [-966.980] (-969.810) * [-967.232] (-967.823) (-970.582) (-968.007) -- 0:00:43
      317000 -- (-967.573) (-966.994) (-967.062) [-966.615] * [-967.295] (-967.216) (-965.915) (-966.596) -- 0:00:43
      317500 -- (-969.776) (-967.203) (-971.098) [-968.726] * (-966.975) (-966.934) [-965.883] (-966.139) -- 0:00:42
      318000 -- (-966.406) (-967.381) [-966.997] (-968.561) * (-969.005) [-965.847] (-965.819) (-968.539) -- 0:00:42
      318500 -- (-966.155) (-966.515) (-971.224) [-968.259] * (-966.389) (-966.493) [-968.195] (-965.809) -- 0:00:42
      319000 -- (-966.695) (-966.572) (-968.684) [-966.727] * (-966.505) (-966.054) (-968.195) [-966.374] -- 0:00:42
      319500 -- (-970.935) (-969.896) [-966.153] (-966.860) * [-970.743] (-970.870) (-968.605) (-967.988) -- 0:00:42
      320000 -- [-966.458] (-966.814) (-966.927) (-966.630) * (-968.311) (-970.775) (-966.836) [-967.858] -- 0:00:42

      Average standard deviation of split frequencies: 0.011944

      320500 -- (-969.672) [-969.525] (-969.262) (-972.875) * [-969.541] (-971.515) (-966.555) (-967.551) -- 0:00:42
      321000 -- (-966.921) (-967.567) [-967.123] (-975.855) * (-966.425) (-970.358) [-967.468] (-966.357) -- 0:00:42
      321500 -- [-965.934] (-966.922) (-970.496) (-970.300) * [-966.457] (-969.114) (-968.470) (-969.319) -- 0:00:42
      322000 -- (-968.415) [-966.585] (-965.940) (-967.648) * (-966.304) (-968.854) [-968.479] (-968.848) -- 0:00:42
      322500 -- (-968.533) [-965.975] (-966.008) (-967.253) * (-971.246) (-968.339) [-967.466] (-966.895) -- 0:00:42
      323000 -- (-967.052) (-966.657) (-967.315) [-966.361] * (-965.778) (-971.619) [-965.965] (-966.894) -- 0:00:41
      323500 -- [-966.979] (-968.398) (-969.573) (-966.331) * (-966.955) (-971.003) [-968.073] (-966.146) -- 0:00:41
      324000 -- [-966.781] (-967.658) (-967.285) (-970.224) * (-967.698) (-967.711) (-972.348) [-970.651] -- 0:00:41
      324500 -- (-970.197) [-966.167] (-966.917) (-971.369) * (-971.868) [-966.193] (-974.862) (-969.430) -- 0:00:41
      325000 -- (-972.379) (-966.426) [-967.747] (-968.110) * [-965.986] (-969.597) (-968.030) (-969.928) -- 0:00:41

      Average standard deviation of split frequencies: 0.012291

      325500 -- (-968.708) [-966.830] (-969.200) (-966.581) * (-965.590) (-967.285) (-968.540) [-970.492] -- 0:00:41
      326000 -- (-967.978) (-970.728) [-967.621] (-967.984) * (-966.270) (-966.747) [-967.741] (-972.277) -- 0:00:41
      326500 -- (-966.378) [-969.022] (-965.992) (-970.088) * (-970.721) (-967.656) (-966.708) [-967.846] -- 0:00:43
      327000 -- (-967.304) (-969.300) [-967.280] (-967.376) * (-967.677) (-966.505) [-966.028] (-969.397) -- 0:00:43
      327500 -- (-967.218) (-967.152) (-967.260) [-967.678] * (-967.259) (-966.667) [-967.622] (-967.131) -- 0:00:43
      328000 -- (-966.259) (-968.345) (-966.951) [-968.860] * [-967.752] (-966.004) (-969.331) (-967.134) -- 0:00:43
      328500 -- (-966.260) [-967.145] (-966.353) (-969.196) * (-967.750) (-975.139) [-969.237] (-966.824) -- 0:00:42
      329000 -- (-967.951) (-966.298) [-967.066] (-969.061) * (-967.253) (-967.921) [-967.528] (-968.574) -- 0:00:42
      329500 -- (-967.343) (-966.100) [-966.434] (-968.349) * (-966.264) (-966.036) (-968.127) [-968.553] -- 0:00:42
      330000 -- [-966.850] (-971.998) (-969.238) (-971.819) * (-966.650) (-966.191) [-970.003] (-967.831) -- 0:00:42

      Average standard deviation of split frequencies: 0.010818

      330500 -- [-967.206] (-970.187) (-965.770) (-968.362) * (-966.164) (-972.513) (-970.615) [-967.059] -- 0:00:42
      331000 -- [-967.401] (-966.643) (-968.646) (-968.533) * (-967.926) (-966.996) (-966.925) [-968.680] -- 0:00:42
      331500 -- (-967.920) [-966.911] (-969.705) (-970.099) * (-969.170) [-967.953] (-965.816) (-968.522) -- 0:00:42
      332000 -- (-967.980) [-968.088] (-970.678) (-968.736) * (-967.662) (-968.563) [-967.367] (-969.048) -- 0:00:42
      332500 -- (-966.932) (-974.169) (-968.305) [-966.551] * (-966.957) [-967.224] (-966.563) (-966.730) -- 0:00:42
      333000 -- (-967.468) [-967.268] (-970.703) (-970.863) * (-966.505) (-975.727) (-967.662) [-968.961] -- 0:00:42
      333500 -- (-966.695) (-967.805) [-966.645] (-967.637) * (-969.463) (-971.780) [-967.076] (-970.334) -- 0:00:41
      334000 -- [-970.109] (-966.232) (-968.854) (-966.235) * (-967.893) [-969.492] (-970.020) (-969.390) -- 0:00:41
      334500 -- (-968.546) (-967.981) (-968.130) [-967.015] * (-970.596) (-968.200) (-969.808) [-967.659] -- 0:00:41
      335000 -- (-969.742) (-973.267) [-967.693] (-967.575) * (-971.224) (-971.013) [-968.758] (-967.659) -- 0:00:41

      Average standard deviation of split frequencies: 0.010151

      335500 -- [-965.758] (-970.276) (-967.302) (-969.239) * (-968.765) (-967.076) (-969.485) [-967.490] -- 0:00:41
      336000 -- (-969.483) (-970.221) (-968.441) [-967.649] * (-967.861) (-968.210) [-968.468] (-970.524) -- 0:00:41
      336500 -- (-971.939) (-967.164) (-967.896) [-968.843] * (-968.735) [-968.492] (-967.720) (-969.586) -- 0:00:41
      337000 -- (-969.669) (-967.159) [-968.910] (-967.681) * (-967.651) (-972.775) [-970.469] (-966.443) -- 0:00:41
      337500 -- (-969.678) [-969.663] (-967.227) (-967.307) * [-967.716] (-967.231) (-969.959) (-967.873) -- 0:00:41
      338000 -- (-969.076) (-968.990) [-966.699] (-968.031) * (-967.615) (-967.610) [-971.800] (-967.764) -- 0:00:41
      338500 -- (-968.365) [-969.753] (-969.861) (-966.854) * [-966.475] (-967.753) (-969.231) (-967.969) -- 0:00:41
      339000 -- (-968.225) (-970.325) (-968.409) [-965.841] * (-966.165) (-966.971) (-970.303) [-966.996] -- 0:00:40
      339500 -- [-967.012] (-967.827) (-967.465) (-965.850) * (-967.478) [-967.190] (-968.424) (-967.504) -- 0:00:40
      340000 -- [-967.008] (-967.997) (-970.566) (-966.161) * [-968.572] (-966.600) (-966.259) (-967.440) -- 0:00:40

      Average standard deviation of split frequencies: 0.008710

      340500 -- [-966.952] (-967.937) (-970.184) (-966.745) * (-970.595) [-966.547] (-967.427) (-967.766) -- 0:00:40
      341000 -- [-967.331] (-968.003) (-968.053) (-966.349) * (-969.025) [-966.739] (-966.313) (-967.397) -- 0:00:40
      341500 -- (-967.610) (-968.398) (-966.783) [-966.404] * (-967.276) (-966.820) (-966.767) [-965.786] -- 0:00:40
      342000 -- (-966.435) [-965.879] (-967.426) (-966.918) * (-966.963) (-967.967) (-968.923) [-965.575] -- 0:00:40
      342500 -- (-973.208) [-965.942] (-967.952) (-968.205) * (-966.783) (-968.667) (-970.321) [-967.060] -- 0:00:40
      343000 -- (-968.711) (-966.714) [-965.857] (-968.291) * (-967.035) (-967.516) (-969.515) [-966.850] -- 0:00:42
      343500 -- [-968.159] (-967.916) (-965.978) (-967.957) * (-972.124) [-967.410] (-967.862) (-970.159) -- 0:00:42
      344000 -- [-966.765] (-968.599) (-975.932) (-970.055) * (-970.722) (-968.151) [-966.149] (-970.493) -- 0:00:41
      344500 -- (-970.108) [-967.797] (-968.723) (-967.836) * (-968.615) (-968.752) [-966.645] (-969.139) -- 0:00:41
      345000 -- (-967.339) (-968.594) [-967.235] (-975.560) * (-968.375) (-970.405) [-969.289] (-966.190) -- 0:00:41

      Average standard deviation of split frequencies: 0.009697

      345500 -- [-966.865] (-967.211) (-969.759) (-969.304) * [-968.390] (-966.797) (-967.202) (-968.231) -- 0:00:41
      346000 -- (-969.242) (-967.679) (-970.515) [-967.562] * (-966.971) (-968.032) (-966.938) [-966.917] -- 0:00:41
      346500 -- (-968.624) (-966.543) [-966.539] (-966.947) * [-969.032] (-968.714) (-966.348) (-969.553) -- 0:00:41
      347000 -- [-969.270] (-967.470) (-967.546) (-969.903) * (-967.245) (-969.090) [-966.640] (-969.365) -- 0:00:41
      347500 -- [-971.201] (-968.871) (-967.096) (-972.264) * (-967.467) (-967.606) [-966.609] (-967.432) -- 0:00:41
      348000 -- [-966.292] (-969.887) (-971.411) (-969.074) * [-967.031] (-970.472) (-965.922) (-968.553) -- 0:00:41
      348500 -- (-968.263) (-968.687) [-966.172] (-966.665) * [-967.912] (-968.592) (-968.377) (-969.684) -- 0:00:41
      349000 -- (-967.303) (-969.463) [-967.236] (-966.787) * (-966.566) (-971.278) [-965.625] (-972.685) -- 0:00:41
      349500 -- (-967.338) [-968.635] (-966.091) (-965.829) * (-969.825) [-968.817] (-966.641) (-969.166) -- 0:00:40
      350000 -- (-967.690) (-967.667) (-965.979) [-966.863] * (-968.741) (-973.458) (-966.847) [-967.693] -- 0:00:40

      Average standard deviation of split frequencies: 0.009331

      350500 -- [-967.363] (-968.319) (-969.134) (-966.052) * [-966.887] (-968.655) (-967.890) (-966.645) -- 0:00:40
      351000 -- (-970.334) (-969.788) [-969.081] (-966.838) * [-968.071] (-967.881) (-968.777) (-967.288) -- 0:00:40
      351500 -- (-967.620) (-969.895) [-966.985] (-966.730) * [-967.880] (-967.166) (-968.350) (-966.477) -- 0:00:40
      352000 -- (-967.374) [-968.763] (-968.470) (-966.368) * (-967.663) [-967.807] (-967.653) (-968.211) -- 0:00:40
      352500 -- (-970.064) (-970.472) (-967.662) [-968.821] * (-967.353) (-969.582) (-967.927) [-969.308] -- 0:00:40
      353000 -- (-967.090) (-966.272) (-969.045) [-966.363] * (-966.949) (-970.313) (-971.206) [-967.433] -- 0:00:40
      353500 -- [-967.571] (-969.807) (-968.476) (-967.519) * [-967.693] (-967.916) (-967.774) (-967.605) -- 0:00:40
      354000 -- (-970.388) [-969.563] (-972.230) (-969.639) * (-968.169) [-970.173] (-967.433) (-967.669) -- 0:00:40
      354500 -- [-966.991] (-967.013) (-965.948) (-968.610) * (-967.151) (-971.952) (-970.021) [-966.336] -- 0:00:40
      355000 -- (-967.127) [-969.284] (-969.137) (-966.516) * [-967.011] (-971.324) (-969.963) (-968.420) -- 0:00:39

      Average standard deviation of split frequencies: 0.008313

      355500 -- (-967.131) [-965.994] (-969.227) (-968.363) * (-967.085) [-967.150] (-966.488) (-967.931) -- 0:00:39
      356000 -- (-968.603) [-966.496] (-967.907) (-970.053) * [-970.717] (-967.066) (-966.565) (-968.088) -- 0:00:39
      356500 -- [-969.914] (-970.847) (-966.906) (-968.127) * (-968.647) (-967.548) (-968.345) [-967.963] -- 0:00:39
      357000 -- (-968.866) (-968.356) [-967.204] (-967.402) * [-966.116] (-970.008) (-969.125) (-970.585) -- 0:00:39
      357500 -- (-967.541) [-967.955] (-966.992) (-972.375) * (-972.334) (-968.719) [-967.401] (-965.796) -- 0:00:39
      358000 -- (-970.028) (-971.015) (-967.968) [-969.949] * (-966.808) (-967.334) [-969.261] (-967.069) -- 0:00:39
      358500 -- (-969.649) (-968.208) (-968.527) [-970.338] * (-975.417) (-966.979) [-969.576] (-968.463) -- 0:00:39
      359000 -- (-968.827) [-967.900] (-973.619) (-967.492) * (-966.167) (-968.962) (-967.480) [-968.797] -- 0:00:39
      359500 -- (-969.418) [-966.385] (-973.922) (-970.953) * (-970.721) (-966.463) (-966.861) [-967.250] -- 0:00:40
      360000 -- [-969.674] (-965.986) (-967.922) (-967.289) * [-969.211] (-966.848) (-966.067) (-967.234) -- 0:00:40

      Average standard deviation of split frequencies: 0.008227

      360500 -- (-967.840) (-967.347) [-966.809] (-966.764) * (-967.920) [-967.438] (-968.769) (-967.840) -- 0:00:40
      361000 -- [-971.067] (-968.553) (-966.064) (-968.531) * (-970.433) (-967.618) [-967.924] (-966.677) -- 0:00:40
      361500 -- (-967.741) [-968.019] (-968.665) (-968.765) * (-969.238) (-968.295) [-968.586] (-967.929) -- 0:00:40
      362000 -- (-967.881) (-967.963) (-968.818) [-968.698] * (-966.245) (-967.468) [-966.018] (-968.035) -- 0:00:40
      362500 -- [-969.832] (-968.515) (-968.294) (-967.348) * (-966.447) [-969.827] (-967.012) (-968.441) -- 0:00:40
      363000 -- (-969.787) (-968.777) (-968.720) [-966.666] * (-966.368) (-966.848) [-966.646] (-972.953) -- 0:00:40
      363500 -- (-967.602) (-967.679) [-968.820] (-968.477) * [-968.290] (-968.910) (-967.091) (-970.081) -- 0:00:40
      364000 -- (-967.096) (-967.637) [-970.402] (-966.236) * (-967.685) (-968.240) (-969.134) [-969.155] -- 0:00:40
      364500 -- (-968.759) [-969.614] (-968.277) (-969.368) * (-968.069) [-966.297] (-967.522) (-969.414) -- 0:00:40
      365000 -- (-968.757) (-970.142) (-966.368) [-966.997] * (-969.368) (-966.846) (-968.602) [-966.031] -- 0:00:40

      Average standard deviation of split frequencies: 0.009016

      365500 -- (-966.582) [-969.525] (-967.584) (-966.253) * (-970.692) (-967.143) [-967.556] (-967.664) -- 0:00:39
      366000 -- [-966.248] (-975.214) (-967.284) (-968.175) * (-967.790) (-966.692) (-969.093) [-969.125] -- 0:00:39
      366500 -- (-966.072) (-968.915) (-967.390) [-966.546] * (-966.912) (-966.566) [-970.195] (-966.171) -- 0:00:39
      367000 -- (-966.317) (-972.555) (-966.782) [-971.614] * [-968.181] (-969.230) (-972.631) (-971.418) -- 0:00:39
      367500 -- (-966.083) (-966.211) (-966.731) [-972.508] * [-965.781] (-965.969) (-969.894) (-971.035) -- 0:00:39
      368000 -- (-968.249) (-968.168) [-968.135] (-966.662) * [-965.844] (-968.171) (-967.554) (-969.317) -- 0:00:39
      368500 -- [-967.772] (-967.656) (-966.600) (-965.714) * (-965.941) [-967.308] (-967.072) (-968.132) -- 0:00:39
      369000 -- (-968.502) (-969.044) [-968.179] (-967.034) * (-966.910) [-967.792] (-966.102) (-970.630) -- 0:00:39
      369500 -- (-967.112) (-969.318) [-968.267] (-967.111) * (-967.481) (-967.567) [-965.810] (-970.531) -- 0:00:39
      370000 -- (-968.848) (-966.353) [-967.518] (-965.919) * (-968.970) (-968.960) [-966.589] (-967.233) -- 0:00:39

      Average standard deviation of split frequencies: 0.008902

      370500 -- (-970.692) (-967.866) [-967.714] (-965.943) * (-966.905) (-966.663) [-966.969] (-966.660) -- 0:00:39
      371000 -- [-969.121] (-968.373) (-970.254) (-966.013) * [-966.915] (-967.733) (-969.215) (-969.787) -- 0:00:38
      371500 -- (-972.960) [-967.159] (-967.707) (-967.378) * (-967.619) (-967.753) (-967.471) [-969.186] -- 0:00:38
      372000 -- [-968.334] (-967.515) (-967.412) (-970.734) * (-967.369) (-966.867) [-967.196] (-967.604) -- 0:00:38
      372500 -- (-969.207) (-969.392) [-968.839] (-967.498) * (-967.313) (-966.701) (-966.903) [-966.299] -- 0:00:38
      373000 -- (-968.988) (-967.411) [-967.412] (-969.320) * (-973.197) (-969.290) [-966.987] (-968.737) -- 0:00:38
      373500 -- (-966.895) (-966.248) [-968.973] (-966.842) * (-970.862) [-967.123] (-966.190) (-968.639) -- 0:00:38
      374000 -- (-969.393) [-966.070] (-968.235) (-967.458) * (-968.929) (-967.012) (-968.923) [-966.894] -- 0:00:38
      374500 -- (-966.448) [-967.438] (-969.854) (-967.575) * (-969.156) (-970.772) [-969.591] (-975.713) -- 0:00:38
      375000 -- [-968.654] (-974.290) (-967.473) (-967.571) * (-969.161) (-970.664) [-966.639] (-969.619) -- 0:00:38

      Average standard deviation of split frequencies: 0.008850

      375500 -- (-969.055) [-969.934] (-965.542) (-969.222) * (-969.534) (-969.526) (-967.951) [-968.417] -- 0:00:38
      376000 -- (-971.229) (-968.550) [-966.623] (-971.815) * (-968.626) (-967.819) (-968.160) [-966.268] -- 0:00:39
      376500 -- (-966.365) (-967.697) (-967.846) [-968.935] * (-967.985) (-968.494) [-966.068] (-968.871) -- 0:00:39
      377000 -- (-966.051) (-972.449) [-966.950] (-967.780) * (-968.192) (-967.446) (-967.426) [-966.369] -- 0:00:39
      377500 -- [-966.898] (-967.150) (-967.258) (-965.756) * (-968.745) [-967.286] (-966.324) (-967.179) -- 0:00:39
      378000 -- [-966.288] (-967.797) (-968.062) (-968.347) * (-968.369) [-967.192] (-967.371) (-967.786) -- 0:00:39
      378500 -- (-966.819) [-967.797] (-966.353) (-968.482) * [-971.521] (-966.880) (-967.286) (-968.089) -- 0:00:39
      379000 -- (-968.399) (-967.852) (-967.440) [-967.327] * (-969.848) (-967.006) [-969.819] (-967.823) -- 0:00:39
      379500 -- [-968.256] (-967.385) (-966.735) (-966.912) * (-969.545) (-967.350) (-970.983) [-967.366] -- 0:00:39
      380000 -- (-973.733) (-966.024) (-967.000) [-968.067] * (-966.254) (-970.525) [-968.333] (-968.441) -- 0:00:39

      Average standard deviation of split frequencies: 0.008282

      380500 -- (-969.710) (-966.294) [-966.503] (-969.310) * [-967.059] (-969.655) (-970.405) (-969.489) -- 0:00:39
      381000 -- (-967.297) (-966.359) (-966.321) [-967.317] * [-966.297] (-967.106) (-967.051) (-969.059) -- 0:00:38
      381500 -- [-968.057] (-970.793) (-967.632) (-967.182) * (-967.344) (-966.760) [-966.430] (-967.970) -- 0:00:38
      382000 -- (-968.460) (-968.042) [-967.052] (-969.045) * [-967.737] (-966.385) (-967.730) (-969.055) -- 0:00:38
      382500 -- (-967.141) [-967.762] (-969.352) (-970.481) * (-967.344) [-967.371] (-971.261) (-968.875) -- 0:00:38
      383000 -- [-967.531] (-966.440) (-968.203) (-971.205) * (-968.488) (-968.534) [-966.398] (-968.184) -- 0:00:38
      383500 -- (-969.049) (-968.035) (-967.883) [-967.040] * [-965.643] (-965.723) (-968.168) (-970.795) -- 0:00:38
      384000 -- [-965.809] (-967.303) (-966.175) (-970.766) * (-968.481) (-966.388) (-969.658) [-967.872] -- 0:00:38
      384500 -- (-965.809) (-966.917) (-967.382) [-968.564] * [-968.588] (-967.124) (-969.989) (-970.818) -- 0:00:38
      385000 -- (-966.175) (-967.798) [-967.634] (-972.744) * (-969.476) (-967.549) (-968.457) [-966.714] -- 0:00:38

      Average standard deviation of split frequencies: 0.008625

      385500 -- (-967.639) [-968.747] (-967.612) (-970.723) * (-969.708) [-966.739] (-967.382) (-968.358) -- 0:00:38
      386000 -- (-966.799) (-972.042) [-967.597] (-966.085) * (-970.940) [-965.774] (-967.164) (-968.499) -- 0:00:38
      386500 -- (-966.145) (-971.752) [-967.504] (-966.387) * (-971.432) (-966.224) [-967.607] (-967.226) -- 0:00:38
      387000 -- [-968.857] (-971.353) (-966.420) (-966.946) * (-970.121) (-968.221) [-969.458] (-967.614) -- 0:00:38
      387500 -- (-967.592) [-969.540] (-969.381) (-972.772) * (-967.613) (-967.475) (-967.276) [-968.974] -- 0:00:37
      388000 -- (-967.127) (-968.341) (-969.423) [-970.239] * (-967.030) (-970.785) (-966.199) [-966.960] -- 0:00:37
      388500 -- (-967.690) [-967.159] (-967.420) (-967.399) * (-967.772) (-967.452) (-966.410) [-967.344] -- 0:00:37
      389000 -- (-968.882) (-967.833) (-966.352) [-967.201] * (-970.380) (-969.552) [-967.035] (-968.259) -- 0:00:37
      389500 -- (-967.596) (-969.252) (-969.806) [-967.053] * (-968.676) (-970.218) (-966.611) [-967.816] -- 0:00:37
      390000 -- (-967.179) (-966.987) [-967.402] (-968.115) * (-970.270) [-967.528] (-967.483) (-968.550) -- 0:00:37

      Average standard deviation of split frequencies: 0.008220

      390500 -- (-966.234) (-968.694) (-968.493) [-970.545] * (-973.519) [-967.166] (-967.570) (-968.453) -- 0:00:37
      391000 -- (-966.495) (-968.372) [-968.597] (-968.162) * (-974.233) (-966.208) (-966.958) [-967.683] -- 0:00:37
      391500 -- (-966.374) (-970.965) [-966.326] (-970.202) * (-973.425) (-968.115) [-970.945] (-967.923) -- 0:00:37
      392000 -- (-966.417) (-973.199) (-966.408) [-970.065] * (-968.345) (-969.058) (-967.974) [-972.063] -- 0:00:37
      392500 -- (-968.599) (-971.104) [-966.931] (-967.945) * (-968.224) [-968.958] (-967.511) (-966.876) -- 0:00:38
      393000 -- (-969.586) (-972.315) [-968.095] (-966.882) * (-967.942) (-968.826) [-966.733] (-967.489) -- 0:00:38
      393500 -- (-970.612) [-969.940] (-967.374) (-966.450) * (-967.725) [-967.165] (-968.577) (-973.334) -- 0:00:38
      394000 -- (-965.881) (-969.719) [-967.538] (-966.289) * (-966.914) (-970.896) (-969.944) [-967.594] -- 0:00:38
      394500 -- (-969.283) (-968.463) [-969.387] (-968.084) * [-969.288] (-968.236) (-968.235) (-968.127) -- 0:00:38
      395000 -- (-968.085) (-969.688) [-966.772] (-966.576) * (-969.279) [-969.118] (-970.192) (-967.028) -- 0:00:38

      Average standard deviation of split frequencies: 0.009375

      395500 -- (-967.492) (-969.591) (-966.699) [-969.727] * (-968.044) [-968.177] (-969.395) (-968.795) -- 0:00:38
      396000 -- [-967.717] (-969.591) (-967.300) (-966.334) * (-966.585) [-968.887] (-970.300) (-969.280) -- 0:00:38
      396500 -- (-969.635) (-965.700) (-973.462) [-965.855] * (-966.969) [-973.296] (-966.043) (-970.546) -- 0:00:38
      397000 -- (-967.639) (-967.668) [-968.081] (-967.605) * [-967.163] (-972.959) (-966.404) (-969.235) -- 0:00:37
      397500 -- (-966.595) (-967.995) (-966.054) [-969.265] * (-967.855) (-969.566) (-966.690) [-970.270] -- 0:00:37
      398000 -- (-966.366) (-965.649) [-968.386] (-966.794) * (-968.620) (-973.451) [-966.842] (-969.285) -- 0:00:37
      398500 -- (-968.126) (-967.301) (-967.975) [-965.753] * (-968.989) [-972.682] (-969.193) (-969.040) -- 0:00:37
      399000 -- (-968.247) (-966.571) [-968.695] (-965.929) * [-968.413] (-966.433) (-969.135) (-966.399) -- 0:00:37
      399500 -- (-969.308) (-968.027) (-968.468) [-969.543] * (-969.866) [-975.714] (-971.312) (-968.737) -- 0:00:37
      400000 -- [-965.710] (-970.812) (-970.141) (-968.903) * (-968.241) (-966.329) (-969.932) [-967.521] -- 0:00:37

      Average standard deviation of split frequencies: 0.009334

      400500 -- [-967.056] (-968.686) (-971.152) (-966.705) * (-966.918) (-965.953) (-968.627) [-969.538] -- 0:00:37
      401000 -- [-966.589] (-965.747) (-967.939) (-967.590) * [-966.926] (-965.950) (-967.362) (-982.562) -- 0:00:37
      401500 -- (-966.985) (-966.221) (-968.198) [-966.104] * (-966.737) (-966.249) (-967.474) [-968.153] -- 0:00:37
      402000 -- (-966.914) (-967.571) (-968.151) [-966.354] * (-966.769) (-966.736) [-971.392] (-970.108) -- 0:00:37
      402500 -- (-968.236) [-966.541] (-969.084) (-965.534) * (-966.951) [-967.841] (-967.735) (-968.637) -- 0:00:37
      403000 -- (-968.353) (-967.785) (-967.231) [-966.454] * (-967.163) (-967.926) [-970.044] (-974.090) -- 0:00:37
      403500 -- [-968.294] (-968.992) (-967.344) (-969.172) * (-966.899) [-966.873] (-968.424) (-966.604) -- 0:00:36
      404000 -- (-968.107) (-969.595) [-967.102] (-967.214) * (-966.270) (-967.248) [-967.236] (-971.092) -- 0:00:36
      404500 -- [-969.010] (-967.639) (-971.325) (-966.427) * (-971.831) [-967.366] (-969.306) (-969.038) -- 0:00:36
      405000 -- (-967.143) [-969.269] (-967.683) (-967.086) * [-965.992] (-967.176) (-966.237) (-972.057) -- 0:00:36

      Average standard deviation of split frequencies: 0.008998

      405500 -- [-966.751] (-966.926) (-966.716) (-968.571) * (-966.950) (-969.884) [-967.285] (-969.807) -- 0:00:36
      406000 -- (-966.479) [-966.367] (-967.620) (-968.343) * (-969.219) [-975.107] (-967.373) (-966.343) -- 0:00:36
      406500 -- (-967.226) (-966.133) [-966.176] (-968.809) * (-970.290) (-977.435) [-966.761] (-966.233) -- 0:00:36
      407000 -- (-969.606) (-967.041) (-968.276) [-965.870] * (-968.394) [-966.360] (-968.899) (-965.672) -- 0:00:36
      407500 -- (-966.372) (-972.018) (-968.935) [-966.330] * [-970.036] (-967.003) (-966.993) (-966.514) -- 0:00:36
      408000 -- (-970.308) (-966.837) (-970.350) [-966.832] * (-970.717) (-973.478) [-967.022] (-967.843) -- 0:00:36
      408500 -- (-969.927) (-967.348) [-969.361] (-968.059) * [-966.186] (-973.376) (-970.647) (-969.652) -- 0:00:36
      409000 -- (-968.295) [-968.030] (-970.750) (-972.226) * (-966.991) [-966.925] (-971.014) (-969.658) -- 0:00:37
      409500 -- (-968.153) (-972.260) [-969.368] (-968.397) * (-966.509) (-967.022) (-965.998) [-966.536] -- 0:00:37
      410000 -- (-968.526) (-971.875) [-969.438] (-967.566) * (-969.244) (-970.408) (-965.998) [-967.647] -- 0:00:37

      Average standard deviation of split frequencies: 0.009030

      410500 -- (-968.237) [-969.919] (-973.789) (-968.919) * (-969.657) (-969.705) [-966.969] (-967.313) -- 0:00:37
      411000 -- (-968.318) (-968.595) (-969.466) [-968.407] * (-972.464) (-970.544) (-967.421) [-968.257] -- 0:00:37
      411500 -- (-966.564) (-969.331) [-971.041] (-969.361) * (-969.532) (-970.962) (-966.874) [-966.447] -- 0:00:37
      412000 -- (-966.831) (-971.431) [-969.790] (-966.592) * (-969.725) (-970.996) (-966.836) [-966.356] -- 0:00:37
      412500 -- (-966.851) (-968.921) (-969.543) [-970.985] * (-967.998) (-968.344) [-966.687] (-967.927) -- 0:00:37
      413000 -- (-965.881) (-968.191) (-972.599) [-969.908] * (-965.783) (-968.137) [-967.301] (-967.163) -- 0:00:36
      413500 -- [-968.006] (-967.744) (-971.743) (-970.304) * (-966.965) [-966.884] (-967.543) (-967.897) -- 0:00:36
      414000 -- (-967.967) [-967.751] (-970.652) (-968.325) * (-972.486) [-966.225] (-966.454) (-968.152) -- 0:00:36
      414500 -- [-966.688] (-967.655) (-967.515) (-967.402) * (-968.456) (-971.457) (-969.036) [-967.796] -- 0:00:36
      415000 -- [-968.404] (-966.513) (-967.624) (-965.902) * (-968.791) (-969.502) [-968.508] (-968.693) -- 0:00:36

      Average standard deviation of split frequencies: 0.009490

      415500 -- (-968.444) [-966.209] (-968.729) (-968.328) * [-968.102] (-968.595) (-966.319) (-967.841) -- 0:00:36
      416000 -- (-967.847) (-966.534) (-966.151) [-965.970] * (-969.560) (-966.988) [-968.208] (-970.004) -- 0:00:36
      416500 -- (-970.093) (-971.960) [-966.238] (-969.598) * (-969.709) (-966.560) (-967.814) [-968.865] -- 0:00:36
      417000 -- (-966.887) (-966.313) [-966.554] (-968.288) * (-966.827) (-966.837) (-974.493) [-965.696] -- 0:00:36
      417500 -- [-970.156] (-968.681) (-966.694) (-967.269) * [-966.849] (-966.171) (-968.644) (-966.631) -- 0:00:36
      418000 -- [-968.956] (-967.580) (-965.776) (-971.230) * [-966.610] (-966.332) (-968.050) (-968.843) -- 0:00:36
      418500 -- (-967.965) [-966.030] (-974.359) (-967.080) * (-967.427) (-966.373) (-970.929) [-968.413] -- 0:00:36
      419000 -- (-969.611) (-966.067) (-966.579) [-967.004] * (-966.851) [-968.784] (-965.634) (-967.692) -- 0:00:36
      419500 -- (-966.841) (-966.067) [-966.739] (-967.405) * [-967.928] (-966.639) (-967.180) (-967.668) -- 0:00:35
      420000 -- (-967.061) [-968.657] (-973.498) (-967.166) * (-966.742) (-970.633) (-969.099) [-967.694] -- 0:00:35

      Average standard deviation of split frequencies: 0.009875

      420500 -- [-966.826] (-968.772) (-966.384) (-968.108) * (-965.591) (-969.427) [-965.565] (-967.749) -- 0:00:35
      421000 -- [-967.906] (-966.015) (-967.863) (-966.439) * (-969.075) (-967.337) [-965.971] (-967.660) -- 0:00:35
      421500 -- (-967.749) [-966.720] (-968.935) (-968.494) * (-971.964) [-966.626] (-966.993) (-967.745) -- 0:00:35
      422000 -- (-968.676) (-967.322) [-967.360] (-970.742) * (-966.048) (-967.283) [-967.478] (-968.079) -- 0:00:35
      422500 -- (-969.358) (-967.323) (-966.774) [-970.443] * (-967.361) [-966.604] (-966.436) (-969.371) -- 0:00:35
      423000 -- [-967.219] (-967.757) (-967.089) (-968.873) * [-967.167] (-970.062) (-966.500) (-970.696) -- 0:00:35
      423500 -- (-969.283) (-965.802) (-968.250) [-966.535] * [-966.790] (-966.962) (-966.231) (-966.591) -- 0:00:35
      424000 -- (-970.337) (-968.875) (-968.118) [-967.259] * (-966.805) (-966.998) [-966.641] (-967.432) -- 0:00:35
      424500 -- (-968.502) [-970.039] (-967.342) (-966.208) * (-967.721) [-965.886] (-966.641) (-967.519) -- 0:00:35
      425000 -- (-967.783) (-968.912) [-968.180] (-966.355) * (-966.769) (-966.268) (-965.916) [-968.733] -- 0:00:35

      Average standard deviation of split frequencies: 0.009683

      425500 -- (-967.286) [-967.872] (-966.331) (-968.624) * (-966.729) [-968.023] (-965.755) (-968.483) -- 0:00:35
      426000 -- (-967.786) (-968.884) [-965.654] (-967.903) * (-969.115) (-968.830) [-966.386] (-965.788) -- 0:00:36
      426500 -- (-968.271) (-968.738) [-967.199] (-966.964) * (-967.302) (-968.899) (-969.398) [-968.367] -- 0:00:36
      427000 -- (-969.558) (-969.810) (-969.115) [-967.070] * (-965.714) (-975.547) [-966.240] (-968.670) -- 0:00:36
      427500 -- (-969.553) (-967.774) [-967.953] (-966.671) * (-969.751) [-967.324] (-966.253) (-968.106) -- 0:00:36
      428000 -- (-967.861) (-966.529) [-970.282] (-968.867) * (-968.015) (-970.432) (-967.061) [-966.314] -- 0:00:36
      428500 -- (-967.724) [-969.140] (-968.743) (-967.432) * (-968.781) [-966.296] (-967.082) (-966.104) -- 0:00:36
      429000 -- (-968.676) (-969.379) (-969.378) [-967.618] * (-967.424) [-969.604] (-968.522) (-970.303) -- 0:00:35
      429500 -- (-968.984) [-967.018] (-967.845) (-967.703) * (-968.334) (-970.504) (-967.959) [-967.288] -- 0:00:35
      430000 -- (-970.397) (-967.410) [-967.506] (-970.325) * (-970.374) (-966.017) [-966.990] (-967.817) -- 0:00:35

      Average standard deviation of split frequencies: 0.009167

      430500 -- (-966.660) (-967.659) [-971.602] (-969.291) * (-969.516) [-968.301] (-968.372) (-966.942) -- 0:00:35
      431000 -- (-969.297) [-966.693] (-970.770) (-967.021) * (-967.483) (-970.360) (-971.665) [-965.737] -- 0:00:35
      431500 -- (-971.735) (-966.867) (-966.830) [-968.171] * [-966.262] (-968.268) (-971.098) (-965.776) -- 0:00:35
      432000 -- (-974.432) [-970.442] (-969.948) (-967.232) * (-968.388) [-967.604] (-968.015) (-971.830) -- 0:00:35
      432500 -- (-966.867) (-966.496) (-968.277) [-968.887] * (-965.765) (-968.880) (-969.043) [-971.128] -- 0:00:35
      433000 -- [-967.775] (-968.858) (-967.568) (-968.756) * (-965.731) (-966.068) [-967.004] (-968.137) -- 0:00:35
      433500 -- (-969.309) (-968.310) (-968.543) [-968.572] * [-966.613] (-967.307) (-972.282) (-968.391) -- 0:00:35
      434000 -- (-966.638) (-971.504) [-966.767] (-967.938) * [-970.086] (-967.922) (-968.096) (-968.237) -- 0:00:35
      434500 -- (-969.133) [-974.125] (-965.629) (-967.636) * (-969.578) (-968.602) [-968.394] (-967.506) -- 0:00:35
      435000 -- (-973.356) (-974.062) (-965.733) [-969.152] * (-969.308) (-967.691) (-968.927) [-967.342] -- 0:00:35

      Average standard deviation of split frequencies: 0.008717

      435500 -- [-971.900] (-969.344) (-966.406) (-967.200) * (-966.569) (-970.256) [-970.163] (-969.508) -- 0:00:34
      436000 -- (-967.329) [-969.317] (-968.480) (-968.502) * (-966.832) (-967.088) (-968.210) [-967.359] -- 0:00:34
      436500 -- (-969.146) [-970.295] (-967.850) (-968.510) * (-966.826) (-968.033) (-966.970) [-967.236] -- 0:00:34
      437000 -- [-967.300] (-967.235) (-967.336) (-968.841) * [-967.531] (-975.654) (-966.570) (-966.939) -- 0:00:34
      437500 -- [-967.348] (-967.693) (-967.943) (-967.346) * [-966.557] (-971.421) (-969.532) (-967.607) -- 0:00:34
      438000 -- (-971.037) (-967.971) (-971.064) [-969.347] * (-966.376) [-967.322] (-970.521) (-968.989) -- 0:00:34
      438500 -- [-966.500] (-967.763) (-972.370) (-969.503) * (-967.124) (-969.745) (-966.735) [-968.869] -- 0:00:34
      439000 -- (-968.353) (-968.003) [-969.446] (-971.755) * [-967.282] (-973.353) (-969.390) (-967.634) -- 0:00:34
      439500 -- (-967.879) (-967.886) [-968.075] (-968.396) * [-968.225] (-973.147) (-968.778) (-968.176) -- 0:00:34
      440000 -- (-968.887) (-968.189) [-967.358] (-968.611) * (-967.222) (-969.197) (-968.263) [-966.492] -- 0:00:34

      Average standard deviation of split frequencies: 0.008692

      440500 -- (-967.909) [-966.781] (-972.306) (-968.266) * (-966.162) [-966.497] (-972.355) (-967.656) -- 0:00:34
      441000 -- (-968.173) (-968.305) (-970.987) [-968.199] * [-966.629] (-969.010) (-967.904) (-968.394) -- 0:00:34
      441500 -- [-967.269] (-967.456) (-968.341) (-966.960) * (-966.200) [-967.219] (-970.361) (-967.812) -- 0:00:34
      442000 -- [-967.207] (-969.201) (-966.671) (-967.961) * [-966.203] (-969.760) (-967.172) (-973.194) -- 0:00:34
      442500 -- (-973.763) [-968.149] (-966.396) (-967.430) * (-968.678) [-967.253] (-967.351) (-968.404) -- 0:00:35
      443000 -- (-970.076) (-966.732) (-966.667) [-968.811] * [-967.175] (-967.385) (-967.261) (-969.092) -- 0:00:35
      443500 -- (-973.527) (-967.740) [-967.077] (-969.355) * (-966.522) (-971.324) [-968.864] (-969.104) -- 0:00:35
      444000 -- (-973.760) (-967.437) [-967.149] (-966.019) * [-966.225] (-971.125) (-966.532) (-972.645) -- 0:00:35
      444500 -- (-975.900) (-968.489) [-967.286] (-968.859) * (-966.717) [-972.585] (-968.367) (-967.977) -- 0:00:34
      445000 -- (-967.096) [-966.210] (-968.327) (-965.973) * (-967.893) [-970.750] (-968.805) (-968.039) -- 0:00:34

      Average standard deviation of split frequencies: 0.008654

      445500 -- (-969.242) (-967.305) (-970.270) [-967.229] * (-969.695) (-973.850) (-971.664) [-966.998] -- 0:00:34
      446000 -- (-966.586) (-967.363) (-967.564) [-967.949] * (-967.096) (-967.822) [-970.383] (-970.703) -- 0:00:34
      446500 -- (-966.589) (-967.718) [-969.864] (-969.166) * (-967.368) (-965.903) [-969.116] (-967.209) -- 0:00:34
      447000 -- (-967.679) (-966.074) (-967.869) [-968.434] * (-968.360) (-965.703) (-970.106) [-967.208] -- 0:00:34
      447500 -- (-969.885) (-969.966) (-966.728) [-967.508] * (-971.367) (-966.847) [-968.957] (-969.138) -- 0:00:34
      448000 -- [-966.906] (-967.639) (-969.026) (-965.733) * (-968.455) (-967.513) (-965.999) [-966.426] -- 0:00:34
      448500 -- [-966.188] (-967.363) (-969.458) (-967.384) * (-970.048) (-967.075) [-968.401] (-967.022) -- 0:00:34
      449000 -- (-967.332) (-967.210) [-970.196] (-968.174) * [-967.884] (-966.804) (-971.051) (-966.555) -- 0:00:34
      449500 -- (-967.529) (-966.824) (-968.362) [-967.246] * (-967.332) (-969.218) (-969.720) [-969.106] -- 0:00:34
      450000 -- (-968.467) (-974.267) (-969.139) [-968.267] * (-967.867) (-966.795) (-968.434) [-967.394] -- 0:00:34

      Average standard deviation of split frequencies: 0.008303

      450500 -- (-971.119) (-968.718) [-971.056] (-968.906) * (-967.195) (-968.047) (-969.042) [-970.743] -- 0:00:34
      451000 -- (-966.614) [-966.946] (-967.344) (-968.690) * (-966.878) [-969.692] (-968.726) (-967.635) -- 0:00:34
      451500 -- (-968.052) (-967.231) [-966.762] (-969.107) * (-966.082) (-967.680) (-966.768) [-969.373] -- 0:00:34
      452000 -- (-968.111) [-967.397] (-966.752) (-967.520) * [-965.790] (-972.612) (-967.999) (-969.377) -- 0:00:33
      452500 -- (-966.466) [-968.248] (-968.002) (-967.683) * (-966.417) [-972.303] (-968.233) (-970.389) -- 0:00:33
      453000 -- (-966.427) [-966.238] (-966.927) (-966.964) * [-969.034] (-967.626) (-968.085) (-971.919) -- 0:00:33
      453500 -- (-966.943) [-966.575] (-967.314) (-965.906) * (-973.149) [-968.135] (-966.135) (-971.947) -- 0:00:33
      454000 -- (-968.688) (-966.408) [-967.483] (-971.564) * (-971.061) (-968.659) (-968.622) [-966.536] -- 0:00:33
      454500 -- (-966.881) (-970.099) [-967.389] (-969.431) * (-968.837) (-967.139) [-970.080] (-965.701) -- 0:00:33
      455000 -- (-968.273) [-967.793] (-966.781) (-968.148) * (-966.006) [-967.155] (-966.603) (-967.213) -- 0:00:33

      Average standard deviation of split frequencies: 0.008753

      455500 -- (-967.433) (-971.349) [-967.230] (-973.243) * [-969.036] (-968.160) (-969.340) (-966.617) -- 0:00:33
      456000 -- [-967.493] (-968.057) (-969.647) (-969.987) * (-969.817) (-967.814) [-966.438] (-968.513) -- 0:00:33
      456500 -- [-967.431] (-967.777) (-967.596) (-965.824) * (-969.628) (-968.613) [-968.345] (-968.432) -- 0:00:33
      457000 -- (-968.422) (-966.578) (-968.243) [-966.426] * (-970.668) (-968.632) (-966.667) [-966.582] -- 0:00:33
      457500 -- (-970.684) (-966.998) [-966.864] (-966.226) * (-966.119) (-970.608) (-968.314) [-967.195] -- 0:00:33
      458000 -- (-968.996) (-966.130) [-966.281] (-966.200) * [-966.137] (-969.194) (-966.108) (-967.119) -- 0:00:33
      458500 -- (-966.152) (-966.265) [-967.251] (-969.497) * (-966.880) (-968.364) (-970.234) [-966.032] -- 0:00:33
      459000 -- [-967.425] (-966.253) (-965.894) (-967.901) * (-966.301) (-966.767) [-965.788] (-969.139) -- 0:00:34
      459500 -- (-966.196) (-968.074) (-966.017) [-969.796] * (-966.552) (-967.317) (-965.639) [-966.188] -- 0:00:34
      460000 -- [-968.355] (-967.636) (-967.022) (-967.246) * (-973.426) (-966.464) (-965.669) [-970.409] -- 0:00:34

      Average standard deviation of split frequencies: 0.008255

      460500 -- (-967.437) (-971.154) (-966.174) [-966.374] * (-967.619) (-967.170) (-965.906) [-968.720] -- 0:00:33
      461000 -- [-967.576] (-970.573) (-966.470) (-967.073) * (-966.424) (-968.886) [-965.735] (-972.646) -- 0:00:33
      461500 -- (-966.463) [-967.460] (-966.742) (-973.610) * (-966.590) [-967.743] (-966.605) (-968.431) -- 0:00:33
      462000 -- [-968.578] (-970.520) (-966.901) (-967.121) * (-966.235) [-967.865] (-966.373) (-968.011) -- 0:00:33
      462500 -- (-968.335) [-967.936] (-968.566) (-967.956) * [-967.184] (-972.595) (-966.339) (-967.831) -- 0:00:33
      463000 -- [-969.165] (-967.587) (-967.087) (-968.007) * [-967.880] (-967.167) (-966.244) (-969.001) -- 0:00:33
      463500 -- (-968.204) (-972.488) [-966.321] (-977.060) * (-966.904) (-968.744) [-969.604] (-967.923) -- 0:00:33
      464000 -- (-970.743) [-967.726] (-967.133) (-974.892) * (-966.393) (-972.776) [-969.765] (-967.012) -- 0:00:33
      464500 -- (-968.898) (-968.450) (-970.001) [-967.251] * [-966.865] (-968.186) (-975.575) (-966.969) -- 0:00:33
      465000 -- (-967.872) (-967.849) (-972.705) [-971.516] * [-967.419] (-968.809) (-972.148) (-969.430) -- 0:00:33

      Average standard deviation of split frequencies: 0.008565

      465500 -- (-967.048) (-966.416) (-971.072) [-969.113] * (-969.245) (-966.646) [-966.084] (-969.152) -- 0:00:33
      466000 -- (-966.677) (-969.119) [-966.300] (-969.330) * [-967.277] (-967.833) (-967.922) (-967.632) -- 0:00:33
      466500 -- (-967.438) (-969.604) [-967.395] (-969.108) * [-966.955] (-968.975) (-968.766) (-967.413) -- 0:00:33
      467000 -- (-966.317) (-967.265) (-966.222) [-967.592] * (-966.161) (-968.254) (-969.217) [-967.239] -- 0:00:33
      467500 -- (-970.604) (-967.248) (-968.504) [-966.460] * [-969.286] (-968.201) (-968.873) (-969.028) -- 0:00:33
      468000 -- [-969.903] (-970.985) (-970.047) (-968.925) * (-968.489) [-967.364] (-972.503) (-967.967) -- 0:00:32
      468500 -- (-967.660) (-969.198) [-969.678] (-967.340) * (-968.690) (-969.214) (-968.657) [-971.179] -- 0:00:32
      469000 -- (-967.898) (-966.550) (-971.044) [-967.380] * (-968.680) (-970.903) [-967.810] (-968.052) -- 0:00:32
      469500 -- (-967.240) (-966.973) [-968.978] (-968.381) * (-965.936) [-969.326] (-972.030) (-971.843) -- 0:00:32
      470000 -- (-967.820) (-975.175) [-968.486] (-967.823) * (-966.414) (-968.869) [-966.728] (-966.782) -- 0:00:32

      Average standard deviation of split frequencies: 0.009214

      470500 -- (-969.729) (-966.867) (-968.022) [-967.023] * (-970.629) (-965.594) (-967.127) [-968.042] -- 0:00:32
      471000 -- [-967.931] (-970.544) (-968.075) (-967.869) * (-969.113) [-965.597] (-966.680) (-967.971) -- 0:00:32
      471500 -- (-967.680) [-966.669] (-966.866) (-966.570) * (-967.067) (-969.850) (-967.332) [-968.487] -- 0:00:32
      472000 -- (-973.902) (-969.230) [-969.707] (-966.804) * (-968.866) [-968.565] (-966.784) (-967.569) -- 0:00:32
      472500 -- (-973.248) [-966.186] (-968.827) (-969.771) * (-970.227) (-971.656) (-968.554) [-968.337] -- 0:00:32
      473000 -- (-973.507) (-966.498) [-966.157] (-967.964) * [-969.856] (-974.381) (-966.782) (-966.238) -- 0:00:32
      473500 -- (-966.214) (-966.570) [-966.085] (-968.920) * (-967.369) [-971.277] (-968.100) (-966.064) -- 0:00:32
      474000 -- (-966.535) [-969.446] (-970.105) (-966.103) * (-966.501) (-971.274) (-971.344) [-969.861] -- 0:00:32
      474500 -- [-966.284] (-968.831) (-970.086) (-965.853) * (-966.153) (-973.586) [-968.313] (-966.560) -- 0:00:32
      475000 -- (-967.559) (-969.997) [-971.794] (-966.595) * [-965.918] (-967.634) (-968.956) (-966.891) -- 0:00:32

      Average standard deviation of split frequencies: 0.008480

      475500 -- (-965.938) (-968.522) (-966.860) [-967.976] * (-968.009) (-967.778) [-967.124] (-967.468) -- 0:00:33
      476000 -- [-969.204] (-970.206) (-967.207) (-966.193) * [-966.427] (-966.241) (-969.509) (-966.951) -- 0:00:33
      476500 -- [-966.894] (-968.265) (-966.146) (-967.685) * (-969.319) (-967.325) (-971.089) [-971.829] -- 0:00:32
      477000 -- (-967.238) (-967.801) (-969.102) [-975.852] * [-966.152] (-966.623) (-969.798) (-968.321) -- 0:00:32
      477500 -- (-968.312) [-967.143] (-969.709) (-970.853) * (-967.028) [-968.861] (-971.028) (-967.358) -- 0:00:32
      478000 -- [-965.755] (-966.019) (-969.178) (-971.323) * (-966.133) (-970.128) (-966.410) [-968.100] -- 0:00:32
      478500 -- (-966.128) (-972.178) [-967.038] (-966.660) * (-965.637) (-967.061) (-966.924) [-969.998] -- 0:00:32
      479000 -- [-966.095] (-968.506) (-967.416) (-970.181) * (-967.297) (-975.956) [-968.544] (-970.318) -- 0:00:32
      479500 -- (-967.530) (-969.679) (-967.227) [-969.578] * (-969.364) (-968.889) (-968.748) [-971.561] -- 0:00:32
      480000 -- (-967.392) (-968.364) (-966.500) [-967.192] * (-967.337) (-968.012) (-968.822) [-968.554] -- 0:00:32

      Average standard deviation of split frequencies: 0.008238

      480500 -- [-969.004] (-966.536) (-966.524) (-968.038) * (-972.465) [-966.586] (-967.765) (-971.036) -- 0:00:32
      481000 -- (-969.128) (-968.102) [-966.676] (-966.169) * [-966.787] (-967.210) (-966.271) (-966.471) -- 0:00:32
      481500 -- (-966.573) [-968.588] (-968.902) (-966.796) * [-969.368] (-966.236) (-966.426) (-969.441) -- 0:00:32
      482000 -- (-968.923) (-970.560) [-967.570] (-965.782) * (-968.138) (-967.903) (-967.207) [-969.196] -- 0:00:32
      482500 -- (-967.954) (-967.652) [-970.888] (-966.529) * (-968.351) (-967.451) (-966.034) [-967.075] -- 0:00:32
      483000 -- [-969.301] (-966.073) (-965.907) (-965.682) * (-970.814) [-967.924] (-969.124) (-968.468) -- 0:00:32
      483500 -- (-967.685) [-966.136] (-966.471) (-965.682) * (-966.643) (-967.628) (-968.380) [-967.824] -- 0:00:32
      484000 -- (-966.723) (-967.870) [-965.696] (-967.251) * (-968.118) (-969.994) (-972.082) [-966.391] -- 0:00:31
      484500 -- [-965.950] (-967.126) (-966.645) (-966.463) * (-970.779) (-971.429) (-968.962) [-968.067] -- 0:00:31
      485000 -- (-967.501) [-967.152] (-967.375) (-972.818) * (-970.230) [-970.466] (-968.266) (-970.332) -- 0:00:31

      Average standard deviation of split frequencies: 0.007578

      485500 -- (-966.955) (-968.237) [-967.098] (-969.403) * (-969.259) [-969.715] (-968.953) (-967.016) -- 0:00:31
      486000 -- (-966.767) (-969.685) [-965.886] (-969.033) * (-968.278) (-969.488) [-966.178] (-971.500) -- 0:00:31
      486500 -- (-970.504) (-972.461) [-967.329] (-969.812) * (-967.835) (-968.056) (-966.889) [-969.022] -- 0:00:31
      487000 -- (-968.875) (-971.630) (-968.532) [-967.270] * (-967.882) (-968.165) [-973.756] (-973.602) -- 0:00:31
      487500 -- [-967.591] (-968.985) (-966.449) (-967.690) * (-967.012) [-968.703] (-969.882) (-967.091) -- 0:00:31
      488000 -- (-972.194) (-967.059) (-966.773) [-967.388] * (-968.111) (-966.845) [-967.059] (-966.290) -- 0:00:31
      488500 -- (-966.040) (-966.281) [-968.144] (-965.947) * (-969.583) (-969.358) (-969.281) [-967.010] -- 0:00:31
      489000 -- (-967.584) (-966.281) (-967.905) [-966.253] * (-968.512) (-969.123) (-966.986) [-966.549] -- 0:00:31
      489500 -- (-966.783) [-966.854] (-969.017) (-967.421) * (-967.724) [-966.059] (-966.174) (-971.323) -- 0:00:31
      490000 -- [-966.851] (-969.844) (-966.584) (-967.996) * (-967.234) (-965.894) [-966.862] (-966.116) -- 0:00:31

      Average standard deviation of split frequencies: 0.007085

      490500 -- (-967.606) (-970.893) [-968.817] (-968.507) * (-966.971) (-967.124) (-967.880) [-973.110] -- 0:00:31
      491000 -- [-969.036] (-968.630) (-966.396) (-968.503) * (-968.235) (-966.590) [-970.398] (-969.341) -- 0:00:31
      491500 -- [-967.003] (-967.044) (-969.782) (-967.733) * (-972.936) [-966.500] (-967.454) (-969.909) -- 0:00:32
      492000 -- (-969.049) (-968.918) (-967.301) [-967.499] * (-966.520) (-968.093) [-967.736] (-969.131) -- 0:00:32
      492500 -- (-969.285) [-972.904] (-968.945) (-966.653) * [-968.515] (-971.456) (-967.772) (-969.075) -- 0:00:31
      493000 -- (-969.319) (-966.525) [-967.582] (-969.820) * (-966.646) [-968.371] (-968.417) (-967.051) -- 0:00:31
      493500 -- [-966.867] (-967.671) (-970.086) (-969.015) * [-967.481] (-969.216) (-965.979) (-966.359) -- 0:00:31
      494000 -- [-966.518] (-973.170) (-969.988) (-967.656) * (-967.897) (-968.709) [-969.208] (-969.236) -- 0:00:31
      494500 -- [-967.799] (-973.550) (-967.240) (-968.684) * [-966.472] (-966.659) (-970.362) (-970.924) -- 0:00:31
      495000 -- (-969.709) (-968.360) [-969.348] (-966.371) * (-967.405) [-967.596] (-969.725) (-969.034) -- 0:00:31

      Average standard deviation of split frequencies: 0.007484

      495500 -- (-968.820) (-967.175) (-970.537) [-971.398] * (-965.685) (-969.782) (-967.951) [-965.989] -- 0:00:31
      496000 -- (-968.477) (-967.080) (-967.670) [-967.370] * (-966.259) [-966.659] (-968.478) (-965.953) -- 0:00:31
      496500 -- (-966.809) [-967.510] (-966.450) (-966.337) * (-969.621) [-967.749] (-966.137) (-966.815) -- 0:00:31
      497000 -- [-965.925] (-967.371) (-969.677) (-968.166) * (-968.953) (-968.943) [-966.488] (-972.657) -- 0:00:31
      497500 -- (-965.516) (-966.896) [-969.242] (-967.171) * (-968.831) (-967.406) (-966.505) [-969.934] -- 0:00:31
      498000 -- [-969.029] (-970.411) (-966.178) (-968.750) * (-968.048) [-967.480] (-967.391) (-966.377) -- 0:00:31
      498500 -- (-966.851) (-970.842) (-971.072) [-967.919] * (-966.701) (-968.443) (-966.694) [-966.467] -- 0:00:31
      499000 -- (-967.212) (-966.553) (-971.873) [-967.041] * (-968.474) (-967.118) [-966.782] (-967.323) -- 0:00:31
      499500 -- (-968.872) (-966.681) (-967.454) [-969.062] * (-968.520) (-966.343) [-967.939] (-967.032) -- 0:00:31
      500000 -- (-967.662) [-970.818] (-970.712) (-968.538) * (-970.556) [-969.210] (-968.519) (-966.393) -- 0:00:31

      Average standard deviation of split frequencies: 0.008062

      500500 -- [-967.689] (-969.152) (-967.303) (-968.831) * (-968.723) (-966.260) [-967.817] (-966.874) -- 0:00:30
      501000 -- [-967.054] (-966.832) (-969.795) (-967.659) * (-967.746) (-968.287) [-968.176] (-966.683) -- 0:00:30
      501500 -- (-968.512) (-968.689) (-969.688) [-966.440] * [-966.135] (-966.259) (-970.599) (-967.599) -- 0:00:30
      502000 -- (-968.977) [-967.838] (-967.531) (-967.996) * (-970.419) (-965.976) [-967.341] (-968.062) -- 0:00:30
      502500 -- [-967.258] (-967.273) (-967.288) (-966.368) * (-967.647) (-968.388) (-969.419) [-967.375] -- 0:00:30
      503000 -- [-966.208] (-969.205) (-967.764) (-969.804) * [-966.037] (-967.369) (-971.155) (-967.504) -- 0:00:30
      503500 -- (-969.171) (-968.011) (-966.540) [-970.323] * [-968.407] (-966.257) (-968.332) (-969.978) -- 0:00:30
      504000 -- [-966.112] (-967.355) (-970.881) (-969.393) * [-967.887] (-969.334) (-967.908) (-970.646) -- 0:00:30
      504500 -- (-966.364) [-969.083] (-971.845) (-971.604) * (-967.358) [-967.160] (-971.456) (-967.449) -- 0:00:30
      505000 -- (-967.250) [-966.117] (-969.518) (-968.534) * [-966.277] (-968.219) (-967.647) (-968.412) -- 0:00:30

      Average standard deviation of split frequencies: 0.008210

      505500 -- (-967.417) (-969.696) (-967.180) [-966.189] * (-966.395) (-968.467) (-966.061) [-972.064] -- 0:00:30
      506000 -- (-974.131) (-966.387) (-967.489) [-966.867] * [-966.303] (-966.843) (-967.846) (-972.409) -- 0:00:30
      506500 -- (-971.766) (-967.495) [-969.577] (-967.770) * [-973.127] (-965.961) (-970.614) (-967.499) -- 0:00:30
      507000 -- (-969.310) (-968.921) (-968.380) [-967.285] * [-967.187] (-966.126) (-967.757) (-967.851) -- 0:00:30
      507500 -- (-967.687) (-967.575) [-968.777] (-970.074) * (-966.893) (-967.531) [-966.551] (-966.608) -- 0:00:30
      508000 -- (-968.744) (-967.173) [-967.566] (-968.964) * (-967.282) (-968.611) [-966.416] (-969.526) -- 0:00:30
      508500 -- (-967.897) (-967.525) (-966.543) [-967.699] * (-966.753) (-967.573) [-966.059] (-971.303) -- 0:00:30
      509000 -- (-966.754) (-965.917) [-965.948] (-967.931) * [-967.733] (-968.964) (-965.640) (-967.663) -- 0:00:30
      509500 -- (-966.930) [-968.947] (-966.184) (-967.164) * (-974.160) (-968.123) (-968.811) [-968.396] -- 0:00:30
      510000 -- (-966.833) [-967.664] (-967.812) (-968.363) * (-968.222) (-967.830) (-968.808) [-968.770] -- 0:00:30

      Average standard deviation of split frequencies: 0.008943

      510500 -- (-967.659) (-971.905) (-968.007) [-966.709] * (-966.320) [-967.176] (-974.678) (-970.568) -- 0:00:30
      511000 -- (-971.260) [-967.677] (-966.341) (-969.506) * (-965.824) (-971.222) (-976.263) [-966.599] -- 0:00:30
      511500 -- (-968.626) [-968.531] (-966.663) (-969.645) * (-968.538) (-971.078) [-973.096] (-968.317) -- 0:00:30
      512000 -- (-967.939) (-969.120) [-966.265] (-967.448) * (-966.462) [-968.212] (-970.005) (-966.725) -- 0:00:30
      512500 -- (-968.231) [-968.879] (-967.134) (-967.552) * (-970.350) (-968.131) [-966.363] (-969.154) -- 0:00:30
      513000 -- [-967.726] (-969.527) (-969.170) (-967.394) * (-966.375) [-967.323] (-970.929) (-968.533) -- 0:00:30
      513500 -- (-969.354) (-968.749) (-971.407) [-966.728] * [-967.648] (-967.491) (-968.571) (-967.638) -- 0:00:30
      514000 -- [-969.822] (-971.447) (-966.708) (-966.850) * [-970.470] (-969.564) (-971.003) (-968.132) -- 0:00:30
      514500 -- (-970.865) (-973.441) [-969.092] (-968.943) * (-968.310) (-970.132) [-969.012] (-972.448) -- 0:00:30
      515000 -- (-969.351) (-969.932) (-973.259) [-971.919] * (-966.270) [-967.988] (-966.562) (-968.123) -- 0:00:30

      Average standard deviation of split frequencies: 0.008222

      515500 -- [-967.987] (-966.652) (-967.408) (-969.853) * [-968.021] (-966.429) (-966.836) (-967.013) -- 0:00:30
      516000 -- (-968.710) [-967.150] (-973.755) (-967.236) * [-967.780] (-966.021) (-967.984) (-968.064) -- 0:00:30
      516500 -- (-969.920) (-967.129) [-968.376] (-967.932) * [-968.979] (-966.415) (-966.830) (-968.367) -- 0:00:29
      517000 -- (-968.140) (-968.272) (-970.453) [-968.956] * [-966.313] (-968.539) (-968.192) (-966.263) -- 0:00:29
      517500 -- (-967.080) (-968.102) [-967.064] (-967.689) * (-966.774) (-968.184) (-970.275) [-969.096] -- 0:00:29
      518000 -- (-967.328) (-966.601) [-970.626] (-966.823) * (-969.781) (-968.576) (-966.539) [-966.172] -- 0:00:29
      518500 -- (-968.522) (-968.989) (-971.144) [-968.377] * (-967.524) (-967.990) [-966.996] (-969.132) -- 0:00:29
      519000 -- (-971.439) (-968.820) (-973.734) [-970.639] * (-966.053) [-967.903] (-970.666) (-973.936) -- 0:00:29
      519500 -- (-966.297) (-968.789) (-972.203) [-968.051] * (-966.710) [-969.720] (-975.786) (-973.399) -- 0:00:29
      520000 -- (-966.293) (-966.877) (-966.750) [-968.461] * (-968.178) (-971.186) (-972.555) [-974.000] -- 0:00:29

      Average standard deviation of split frequencies: 0.008488

      520500 -- [-968.360] (-966.349) (-968.801) (-971.377) * [-966.031] (-967.358) (-968.271) (-970.890) -- 0:00:29
      521000 -- [-968.127] (-966.840) (-969.741) (-969.494) * (-968.038) (-967.175) [-968.101] (-970.843) -- 0:00:29
      521500 -- (-969.652) [-967.572] (-966.986) (-968.331) * (-970.705) [-967.317] (-969.638) (-968.505) -- 0:00:29
      522000 -- (-967.679) (-966.114) (-967.557) [-967.914] * (-965.914) [-968.572] (-969.287) (-966.187) -- 0:00:29
      522500 -- [-969.403] (-968.185) (-967.147) (-969.343) * [-968.453] (-966.976) (-968.568) (-969.138) -- 0:00:29
      523000 -- (-974.082) [-965.993] (-965.974) (-968.937) * (-967.202) [-965.731] (-965.895) (-968.548) -- 0:00:29
      523500 -- [-967.054] (-973.138) (-969.842) (-968.334) * [-971.463] (-970.421) (-967.242) (-968.567) -- 0:00:29
      524000 -- (-970.906) (-969.133) (-970.727) [-965.764] * (-968.727) [-966.266] (-969.118) (-967.962) -- 0:00:29
      524500 -- (-969.409) (-969.715) (-966.688) [-968.141] * (-970.205) (-967.614) (-970.688) [-966.735] -- 0:00:29
      525000 -- (-967.964) (-972.525) (-969.548) [-966.792] * (-966.986) (-966.758) (-970.567) [-966.675] -- 0:00:29

      Average standard deviation of split frequencies: 0.009410

      525500 -- (-969.387) [-972.354] (-970.221) (-968.375) * [-971.393] (-966.626) (-966.678) (-968.252) -- 0:00:29
      526000 -- (-967.536) [-969.641] (-965.819) (-967.800) * (-972.294) (-967.568) (-966.699) [-967.170] -- 0:00:29
      526500 -- [-969.645] (-969.498) (-966.642) (-966.612) * [-966.951] (-968.289) (-967.301) (-965.875) -- 0:00:29
      527000 -- (-969.134) (-967.074) [-967.583] (-967.060) * (-967.287) (-970.129) (-967.477) [-967.636] -- 0:00:29
      527500 -- (-970.734) (-968.329) (-967.165) [-967.380] * (-967.339) (-967.322) (-968.054) [-966.891] -- 0:00:29
      528000 -- (-967.278) (-970.341) [-967.461] (-970.457) * (-970.477) (-970.770) (-968.793) [-969.400] -- 0:00:29
      528500 -- [-966.443] (-967.186) (-968.679) (-967.871) * (-968.328) [-965.935] (-968.555) (-969.447) -- 0:00:29
      529000 -- (-967.607) (-969.933) [-967.821] (-968.946) * [-966.079] (-965.768) (-973.044) (-969.030) -- 0:00:29
      529500 -- (-967.728) [-972.362] (-967.609) (-972.455) * (-966.434) [-968.055] (-966.199) (-968.884) -- 0:00:29
      530000 -- (-971.112) (-969.288) (-968.260) [-966.317] * (-966.589) (-967.501) [-966.992] (-969.433) -- 0:00:29

      Average standard deviation of split frequencies: 0.009272

      530500 -- (-967.373) [-967.259] (-967.937) (-967.248) * (-966.945) [-968.855] (-966.395) (-973.604) -- 0:00:29
      531000 -- [-968.478] (-969.437) (-969.641) (-971.401) * (-968.887) (-967.027) [-966.668] (-966.722) -- 0:00:29
      531500 -- (-969.490) (-968.913) [-969.064] (-968.648) * (-970.982) (-969.772) (-971.501) [-968.196] -- 0:00:29
      532000 -- (-967.243) [-968.201] (-966.225) (-967.053) * (-966.111) [-968.008] (-967.594) (-968.135) -- 0:00:29
      532500 -- (-969.040) (-971.081) (-967.067) [-968.070] * (-966.549) [-966.788] (-965.839) (-968.340) -- 0:00:28
      533000 -- (-968.282) (-974.528) (-966.722) [-969.152] * [-965.997] (-968.372) (-971.822) (-968.196) -- 0:00:28
      533500 -- (-967.974) (-969.182) (-966.845) [-966.375] * (-968.324) (-969.260) [-967.428] (-967.316) -- 0:00:28
      534000 -- (-971.497) (-969.827) [-969.177] (-971.023) * [-968.747] (-970.373) (-967.767) (-967.304) -- 0:00:28
      534500 -- [-968.385] (-968.789) (-969.985) (-968.298) * (-968.805) [-970.212] (-970.409) (-967.982) -- 0:00:28
      535000 -- (-973.000) [-968.503] (-968.402) (-969.949) * (-967.082) (-971.094) [-971.121] (-967.053) -- 0:00:28

      Average standard deviation of split frequencies: 0.009070

      535500 -- (-966.639) [-966.772] (-968.245) (-970.019) * (-970.602) (-971.693) [-968.396] (-967.408) -- 0:00:28
      536000 -- (-966.879) [-967.500] (-968.170) (-969.206) * (-970.568) (-971.447) (-966.354) [-970.707] -- 0:00:28
      536500 -- (-967.016) (-966.899) [-967.514] (-967.663) * [-967.140] (-967.888) (-968.375) (-966.475) -- 0:00:28
      537000 -- (-967.032) [-969.788] (-967.314) (-968.754) * (-968.715) (-968.053) (-968.234) [-966.601] -- 0:00:28
      537500 -- (-969.452) [-969.440] (-967.867) (-968.159) * (-966.313) (-969.454) [-971.202] (-966.047) -- 0:00:28
      538000 -- (-967.285) (-967.919) (-966.997) [-970.234] * [-966.049] (-968.078) (-971.337) (-967.622) -- 0:00:28
      538500 -- (-967.617) (-967.394) [-966.896] (-968.044) * (-966.292) (-967.714) [-969.664] (-967.290) -- 0:00:28
      539000 -- (-967.288) (-966.721) (-967.402) [-968.505] * (-966.861) (-967.123) [-967.343] (-966.468) -- 0:00:28
      539500 -- [-966.176] (-965.996) (-968.123) (-967.698) * (-970.058) (-969.222) (-966.535) [-968.523] -- 0:00:28
      540000 -- (-966.344) (-966.011) (-970.613) [-968.090] * (-968.954) (-966.663) (-971.499) [-971.703] -- 0:00:28

      Average standard deviation of split frequencies: 0.008773

      540500 -- (-972.893) (-966.389) (-966.825) [-967.006] * (-969.223) [-969.609] (-967.559) (-969.327) -- 0:00:28
      541000 -- (-966.006) (-965.591) (-966.684) [-966.053] * (-966.332) (-966.667) (-967.572) [-968.764] -- 0:00:28
      541500 -- (-970.812) (-966.992) (-967.523) [-965.558] * (-966.742) (-966.609) [-967.951] (-970.278) -- 0:00:28
      542000 -- (-967.562) (-973.869) [-966.429] (-965.851) * (-966.602) [-968.431] (-968.843) (-968.275) -- 0:00:28
      542500 -- (-967.939) (-969.287) (-970.110) [-965.715] * (-967.765) (-969.436) [-968.136] (-973.371) -- 0:00:28
      543000 -- [-968.569] (-969.909) (-966.912) (-968.273) * (-967.176) (-967.667) [-967.271] (-967.167) -- 0:00:28
      543500 -- (-969.677) (-972.394) [-968.567] (-970.522) * (-966.072) (-967.733) [-967.265] (-969.433) -- 0:00:28
      544000 -- [-968.902] (-971.191) (-966.996) (-969.163) * [-967.679] (-966.781) (-967.220) (-970.432) -- 0:00:28
      544500 -- (-968.625) (-972.197) (-966.177) [-968.516] * [-966.986] (-967.629) (-967.343) (-970.088) -- 0:00:28
      545000 -- [-969.975] (-966.665) (-965.770) (-967.741) * (-967.378) [-966.457] (-968.948) (-967.798) -- 0:00:28

      Average standard deviation of split frequencies: 0.008904

      545500 -- (-971.680) (-972.732) (-968.098) [-969.202] * (-967.921) (-967.206) (-968.585) [-966.494] -- 0:00:28
      546000 -- [-968.496] (-976.899) (-975.622) (-969.091) * (-969.935) (-970.617) [-967.714] (-967.716) -- 0:00:28
      546500 -- (-970.860) (-966.908) [-969.744] (-969.660) * [-967.051] (-971.081) (-965.744) (-969.161) -- 0:00:28
      547000 -- (-969.064) (-967.864) (-971.438) [-967.282] * (-968.398) (-973.035) [-965.985] (-969.549) -- 0:00:28
      547500 -- (-966.780) [-966.983] (-966.512) (-967.338) * [-966.444] (-966.710) (-967.590) (-968.623) -- 0:00:28
      548000 -- (-969.975) [-972.017] (-966.216) (-967.807) * (-968.931) (-969.423) (-971.413) [-968.829] -- 0:00:28
      548500 -- (-968.308) (-968.509) [-968.928] (-966.236) * (-974.291) [-968.204] (-968.654) (-967.490) -- 0:00:27
      549000 -- (-970.206) (-969.184) [-967.103] (-969.446) * (-973.914) (-966.236) [-969.383] (-967.473) -- 0:00:27
      549500 -- (-970.271) (-968.933) [-967.632] (-969.500) * [-970.018] (-968.651) (-967.790) (-968.009) -- 0:00:27
      550000 -- (-966.090) [-966.189] (-966.700) (-967.252) * (-967.491) (-967.761) [-966.627] (-969.782) -- 0:00:27

      Average standard deviation of split frequencies: 0.008775

      550500 -- (-973.842) [-967.035] (-968.311) (-967.316) * (-968.235) [-966.888] (-966.324) (-968.751) -- 0:00:27
      551000 -- [-968.370] (-967.258) (-967.906) (-967.229) * [-967.080] (-966.583) (-968.146) (-967.205) -- 0:00:27
      551500 -- (-971.716) (-969.374) [-971.156] (-967.239) * (-967.801) (-966.584) [-966.507] (-974.001) -- 0:00:27
      552000 -- [-967.231] (-968.741) (-968.882) (-966.914) * [-966.814] (-974.824) (-972.057) (-966.195) -- 0:00:27
      552500 -- (-966.740) (-968.252) (-967.191) [-967.029] * (-969.877) (-969.417) (-966.718) [-967.668] -- 0:00:27
      553000 -- [-966.385] (-967.093) (-969.287) (-965.899) * [-966.614] (-968.446) (-968.320) (-967.643) -- 0:00:27
      553500 -- (-968.944) [-967.980] (-971.710) (-967.420) * [-967.092] (-973.172) (-968.953) (-971.014) -- 0:00:27
      554000 -- [-971.523] (-968.400) (-969.343) (-972.256) * [-965.854] (-969.737) (-971.535) (-966.295) -- 0:00:27
      554500 -- (-967.766) [-969.186] (-968.026) (-966.909) * [-966.044] (-967.069) (-968.370) (-966.706) -- 0:00:27
      555000 -- (-967.993) (-970.256) (-967.624) [-968.340] * (-971.052) [-976.185] (-966.719) (-969.579) -- 0:00:27

      Average standard deviation of split frequencies: 0.009061

      555500 -- (-970.792) (-972.220) [-967.141] (-968.006) * (-968.286) [-968.440] (-968.094) (-973.407) -- 0:00:27
      556000 -- (-971.766) [-965.783] (-969.635) (-967.774) * (-968.983) (-967.102) (-967.518) [-968.798] -- 0:00:27
      556500 -- (-968.113) [-966.314] (-966.443) (-967.964) * (-968.638) (-965.985) [-966.991] (-968.139) -- 0:00:27
      557000 -- (-966.374) (-966.755) (-968.705) [-973.802] * (-967.975) [-966.133] (-967.023) (-967.602) -- 0:00:27
      557500 -- (-970.330) (-967.553) [-966.685] (-970.276) * (-966.306) (-966.886) (-969.430) [-967.305] -- 0:00:27
      558000 -- [-966.751] (-966.709) (-967.458) (-971.249) * (-965.678) (-971.664) [-970.247] (-968.611) -- 0:00:27
      558500 -- (-967.398) [-967.529] (-967.913) (-970.766) * (-969.242) (-967.641) [-969.253] (-966.865) -- 0:00:27
      559000 -- (-968.542) [-966.362] (-972.900) (-968.226) * (-968.073) (-967.110) (-967.506) [-967.275] -- 0:00:27
      559500 -- (-969.953) (-966.496) [-966.498] (-971.484) * (-966.166) [-969.052] (-969.235) (-966.689) -- 0:00:27
      560000 -- (-966.667) (-965.848) [-968.176] (-975.330) * (-966.575) (-966.095) (-967.395) [-965.710] -- 0:00:27

      Average standard deviation of split frequencies: 0.009196

      560500 -- (-969.146) (-967.605) (-967.839) [-966.886] * (-967.312) (-968.277) [-969.203] (-967.421) -- 0:00:27
      561000 -- (-968.461) (-972.692) (-966.615) [-972.094] * (-966.454) (-967.883) [-967.581] (-968.673) -- 0:00:27
      561500 -- (-972.148) (-972.677) (-966.414) [-968.144] * (-966.878) [-967.831] (-967.752) (-967.848) -- 0:00:27
      562000 -- [-972.417] (-967.888) (-973.278) (-966.314) * (-966.790) (-968.232) (-967.555) [-967.812] -- 0:00:27
      562500 -- (-967.143) (-969.900) [-969.891] (-965.908) * (-970.692) (-967.506) (-968.527) [-968.500] -- 0:00:27
      563000 -- [-968.150] (-969.101) (-969.211) (-965.908) * (-969.701) (-967.689) [-969.005] (-966.749) -- 0:00:27
      563500 -- (-967.000) [-969.683] (-969.043) (-966.333) * (-970.267) [-967.407] (-968.604) (-972.835) -- 0:00:27
      564000 -- (-967.727) [-967.361] (-967.204) (-966.185) * (-967.878) (-966.064) (-968.758) [-967.430] -- 0:00:27
      564500 -- (-972.029) [-966.127] (-969.194) (-967.877) * (-967.985) (-966.873) (-969.824) [-967.669] -- 0:00:27
      565000 -- (-969.152) (-966.076) [-968.540] (-969.030) * (-966.144) (-968.006) [-972.485] (-968.669) -- 0:00:26

      Average standard deviation of split frequencies: 0.009162

      565500 -- [-966.709] (-965.657) (-966.034) (-968.801) * [-967.031] (-970.714) (-975.040) (-968.578) -- 0:00:26
      566000 -- (-965.596) (-967.638) (-967.425) [-969.323] * (-966.585) [-966.435] (-973.408) (-967.792) -- 0:00:26
      566500 -- (-966.902) (-970.481) (-967.679) [-968.696] * (-966.371) (-965.932) (-971.554) [-966.685] -- 0:00:26
      567000 -- (-967.786) (-968.487) (-968.162) [-969.746] * (-971.841) [-967.516] (-969.381) (-968.921) -- 0:00:26
      567500 -- [-967.708] (-972.692) (-971.534) (-969.264) * (-968.343) (-967.156) (-967.848) [-966.307] -- 0:00:26
      568000 -- [-966.859] (-967.315) (-970.377) (-968.829) * [-970.037] (-967.895) (-967.918) (-971.730) -- 0:00:26
      568500 -- (-968.111) (-968.416) [-969.123] (-969.094) * (-968.435) (-967.979) (-965.684) [-969.717] -- 0:00:26
      569000 -- (-968.085) (-966.523) (-967.189) [-965.798] * (-967.182) (-968.567) [-966.989] (-965.944) -- 0:00:26
      569500 -- (-966.013) (-966.390) (-967.328) [-968.491] * (-969.818) (-968.657) [-970.203] (-966.064) -- 0:00:26
      570000 -- [-966.013] (-966.139) (-969.430) (-966.742) * [-966.241] (-971.419) (-967.436) (-966.939) -- 0:00:26

      Average standard deviation of split frequencies: 0.009603

      570500 -- [-967.217] (-968.912) (-969.996) (-966.727) * (-965.712) (-970.619) [-968.652] (-967.418) -- 0:00:26
      571000 -- (-968.198) (-966.202) (-968.672) [-967.002] * (-966.468) [-967.971] (-969.467) (-971.064) -- 0:00:26
      571500 -- (-966.980) [-968.188] (-967.813) (-968.603) * (-966.231) [-966.606] (-970.987) (-966.187) -- 0:00:26
      572000 -- [-966.585] (-968.380) (-966.773) (-966.601) * (-966.724) [-966.815] (-969.486) (-967.772) -- 0:00:26
      572500 -- (-966.333) (-966.988) (-966.950) [-966.542] * [-966.515] (-966.091) (-966.629) (-967.513) -- 0:00:26
      573000 -- [-967.427] (-966.201) (-967.508) (-966.076) * (-970.718) [-968.362] (-965.955) (-967.968) -- 0:00:26
      573500 -- (-969.712) (-966.353) (-969.991) [-966.978] * [-967.018] (-969.646) (-966.809) (-968.599) -- 0:00:26
      574000 -- (-967.414) (-966.442) (-966.211) [-966.555] * (-970.062) (-967.758) [-966.683] (-968.157) -- 0:00:26
      574500 -- (-967.386) [-967.267] (-966.065) (-966.702) * [-965.885] (-968.506) (-968.803) (-967.106) -- 0:00:26
      575000 -- (-969.986) [-968.105] (-966.594) (-969.228) * [-965.651] (-970.047) (-969.516) (-967.285) -- 0:00:26

      Average standard deviation of split frequencies: 0.010179

      575500 -- [-966.361] (-969.528) (-966.894) (-968.432) * (-968.923) (-965.900) (-969.714) [-968.359] -- 0:00:26
      576000 -- (-967.473) (-966.537) [-969.395] (-968.029) * (-965.740) [-968.394] (-971.600) (-972.219) -- 0:00:26
      576500 -- (-969.125) [-967.016] (-966.551) (-967.618) * (-965.992) (-967.110) [-972.187] (-968.591) -- 0:00:26
      577000 -- (-971.800) (-966.300) (-969.387) [-966.984] * (-973.801) (-967.123) [-968.948] (-971.471) -- 0:00:26
      577500 -- (-969.493) (-969.232) (-967.734) [-966.813] * (-971.796) (-967.883) [-967.375] (-970.277) -- 0:00:26
      578000 -- (-967.341) (-967.913) (-969.682) [-966.799] * (-969.092) (-967.421) (-966.835) [-967.666] -- 0:00:26
      578500 -- (-968.196) (-968.431) [-969.026] (-966.494) * [-972.288] (-967.833) (-969.115) (-969.514) -- 0:00:26
      579000 -- (-965.975) (-968.798) (-973.114) [-966.882] * (-966.082) [-967.452] (-971.304) (-966.260) -- 0:00:26
      579500 -- (-970.377) (-968.837) [-966.866] (-968.325) * (-970.664) (-968.753) [-970.557] (-970.759) -- 0:00:26
      580000 -- [-971.861] (-969.792) (-967.052) (-968.894) * [-967.450] (-967.338) (-971.702) (-965.741) -- 0:00:26

      Average standard deviation of split frequencies: 0.009793

      580500 -- (-968.415) [-971.950] (-966.506) (-971.768) * [-968.322] (-966.812) (-967.801) (-966.333) -- 0:00:26
      581000 -- [-969.452] (-967.666) (-969.030) (-967.774) * (-967.034) (-967.786) (-966.461) [-967.412] -- 0:00:25
      581500 -- [-967.581] (-969.307) (-966.599) (-968.982) * (-966.991) (-971.538) (-966.209) [-967.861] -- 0:00:25
      582000 -- (-967.969) [-968.276] (-971.400) (-970.432) * (-967.205) [-966.181] (-966.403) (-968.271) -- 0:00:25
      582500 -- (-967.817) (-966.039) [-967.602] (-968.649) * (-967.561) (-968.725) (-969.124) [-967.725] -- 0:00:25
      583000 -- (-968.585) (-966.426) [-968.026] (-969.733) * (-969.472) (-966.359) [-966.165] (-969.313) -- 0:00:25
      583500 -- (-969.896) (-967.065) (-968.319) [-966.744] * [-969.314] (-967.172) (-967.249) (-968.921) -- 0:00:25
      584000 -- (-967.823) (-966.639) (-969.283) [-968.818] * (-972.674) (-969.109) (-968.417) [-970.347] -- 0:00:25
      584500 -- (-966.339) (-966.639) (-970.123) [-968.854] * [-973.362] (-974.591) (-971.037) (-967.890) -- 0:00:25
      585000 -- (-967.371) [-969.748] (-970.945) (-967.594) * (-966.811) (-970.662) (-969.919) [-967.812] -- 0:00:25

      Average standard deviation of split frequencies: 0.009503

      585500 -- (-967.547) (-968.235) [-968.775] (-968.343) * (-966.808) (-968.265) [-966.061] (-969.656) -- 0:00:25
      586000 -- (-967.839) [-970.491] (-967.781) (-967.599) * (-969.043) [-967.864] (-969.034) (-970.512) -- 0:00:25
      586500 -- (-969.343) (-967.809) (-969.791) [-966.837] * (-966.832) [-968.030] (-970.835) (-969.847) -- 0:00:25
      587000 -- [-967.338] (-968.319) (-967.141) (-967.660) * (-966.607) [-966.875] (-969.950) (-967.763) -- 0:00:25
      587500 -- (-968.848) (-967.439) (-968.431) [-966.555] * (-966.617) (-966.352) [-968.788] (-968.249) -- 0:00:25
      588000 -- [-966.405] (-971.983) (-971.654) (-967.593) * [-970.984] (-974.957) (-969.662) (-968.033) -- 0:00:25
      588500 -- [-969.528] (-968.415) (-967.335) (-971.489) * [-966.254] (-970.638) (-970.868) (-966.214) -- 0:00:25
      589000 -- [-970.167] (-971.702) (-967.196) (-969.799) * (-967.780) (-966.228) [-969.474] (-966.678) -- 0:00:25
      589500 -- (-969.727) [-969.956] (-967.344) (-966.279) * (-968.936) (-969.326) (-969.615) [-967.152] -- 0:00:25
      590000 -- (-970.200) (-967.206) [-967.756] (-966.909) * [-967.060] (-969.171) (-968.700) (-969.431) -- 0:00:25

      Average standard deviation of split frequencies: 0.009028

      590500 -- (-968.921) [-966.935] (-965.967) (-969.036) * (-969.291) (-970.672) [-970.660] (-969.292) -- 0:00:25
      591000 -- [-968.260] (-967.735) (-967.230) (-972.435) * (-967.624) (-969.190) [-968.309] (-969.780) -- 0:00:25
      591500 -- (-967.058) [-970.032] (-971.710) (-967.343) * (-969.455) (-966.302) [-966.631] (-969.192) -- 0:00:25
      592000 -- (-969.363) (-967.333) [-972.299] (-966.821) * (-967.620) (-967.975) [-966.195] (-968.127) -- 0:00:25
      592500 -- (-967.896) (-967.871) [-966.897] (-968.318) * (-971.933) [-970.233] (-966.237) (-968.227) -- 0:00:25
      593000 -- (-968.013) (-967.758) [-966.047] (-967.516) * (-971.379) (-969.886) (-968.047) [-967.114] -- 0:00:25
      593500 -- (-966.811) (-967.633) (-966.911) [-966.952] * (-966.705) (-966.059) [-968.240] (-968.331) -- 0:00:25
      594000 -- (-967.272) (-966.107) (-967.471) [-967.305] * (-965.741) (-967.349) (-966.883) [-966.818] -- 0:00:25
      594500 -- (-967.828) (-969.315) [-969.053] (-967.826) * (-968.025) (-966.765) [-966.463] (-967.593) -- 0:00:25
      595000 -- (-967.721) (-969.793) (-968.855) [-966.906] * (-966.915) (-968.581) [-966.057] (-966.272) -- 0:00:25

      Average standard deviation of split frequencies: 0.008799

      595500 -- [-968.990] (-966.834) (-969.516) (-969.398) * (-968.213) [-968.212] (-966.639) (-965.995) -- 0:00:25
      596000 -- (-975.868) [-967.101] (-968.164) (-969.448) * (-968.228) (-966.844) [-966.377] (-970.582) -- 0:00:25
      596500 -- (-974.336) (-966.620) [-972.459] (-968.825) * (-968.720) [-966.882] (-967.261) (-966.784) -- 0:00:25
      597000 -- [-968.794] (-967.658) (-970.172) (-967.588) * (-968.657) (-968.759) [-965.972] (-966.193) -- 0:00:24
      597500 -- (-967.627) [-967.416] (-968.155) (-968.188) * [-967.888] (-966.751) (-966.251) (-969.619) -- 0:00:24
      598000 -- [-966.766] (-968.114) (-967.186) (-967.206) * (-969.153) (-966.534) [-967.226] (-966.401) -- 0:00:24
      598500 -- (-967.641) [-967.599] (-966.962) (-968.181) * (-968.107) [-966.773] (-971.431) (-967.539) -- 0:00:24
      599000 -- (-967.588) [-967.160] (-967.946) (-967.462) * (-967.659) [-967.149] (-969.887) (-971.246) -- 0:00:24
      599500 -- (-970.910) [-969.496] (-967.756) (-966.511) * [-966.429] (-969.704) (-971.077) (-966.898) -- 0:00:24
      600000 -- [-967.612] (-966.854) (-966.773) (-967.397) * [-967.073] (-966.554) (-968.729) (-966.532) -- 0:00:24

      Average standard deviation of split frequencies: 0.009025

      600500 -- (-967.404) (-968.562) [-966.672] (-967.688) * [-967.994] (-966.776) (-966.199) (-969.520) -- 0:00:24
      601000 -- [-971.953] (-969.057) (-968.071) (-968.986) * (-970.209) (-966.186) (-968.325) [-966.236] -- 0:00:24
      601500 -- (-967.890) [-972.006] (-969.097) (-968.387) * (-967.906) [-969.401] (-967.476) (-967.161) -- 0:00:24
      602000 -- [-969.489] (-969.906) (-968.837) (-966.348) * (-971.620) (-966.006) [-968.526] (-966.744) -- 0:00:24
      602500 -- (-968.594) [-968.111] (-967.126) (-966.573) * [-966.518] (-969.133) (-967.179) (-967.551) -- 0:00:24
      603000 -- (-968.133) [-965.817] (-967.100) (-969.417) * [-966.234] (-965.812) (-967.753) (-966.781) -- 0:00:24
      603500 -- (-969.402) [-968.870] (-968.705) (-967.777) * (-966.885) (-966.393) [-967.384] (-966.629) -- 0:00:24
      604000 -- [-966.757] (-969.190) (-966.705) (-967.160) * (-966.470) (-967.998) [-967.046] (-966.886) -- 0:00:24
      604500 -- (-967.019) [-970.988] (-966.727) (-967.981) * (-967.145) [-966.848] (-969.181) (-967.853) -- 0:00:24
      605000 -- (-967.017) [-966.743] (-967.360) (-968.983) * (-967.240) [-965.712] (-969.200) (-968.773) -- 0:00:24

      Average standard deviation of split frequencies: 0.009043

      605500 -- (-968.115) [-968.433] (-969.877) (-967.309) * [-968.730] (-970.537) (-971.064) (-966.187) -- 0:00:24
      606000 -- (-968.752) (-966.687) [-967.448] (-966.803) * (-971.020) [-966.943] (-971.353) (-968.036) -- 0:00:24
      606500 -- [-971.453] (-968.679) (-969.976) (-968.576) * (-968.728) (-969.567) (-966.703) [-965.729] -- 0:00:24
      607000 -- (-966.961) (-968.578) [-969.684] (-968.695) * (-967.559) (-966.631) (-969.788) [-967.767] -- 0:00:24
      607500 -- [-967.276] (-967.027) (-965.615) (-968.657) * (-970.742) [-970.154] (-968.955) (-966.189) -- 0:00:24
      608000 -- [-966.184] (-972.140) (-967.166) (-968.707) * [-970.584] (-968.581) (-968.869) (-973.055) -- 0:00:24
      608500 -- (-968.420) [-969.730] (-968.264) (-967.304) * (-969.729) (-968.948) [-967.177] (-968.414) -- 0:00:24
      609000 -- [-969.173] (-977.142) (-965.908) (-966.935) * (-967.805) [-968.745] (-967.903) (-968.805) -- 0:00:24
      609500 -- (-969.854) (-970.056) [-965.838] (-966.467) * (-967.805) (-967.214) [-966.264] (-967.400) -- 0:00:24
      610000 -- (-967.724) (-970.332) (-966.316) [-966.576] * (-969.934) [-967.624] (-966.645) (-967.476) -- 0:00:24

      Average standard deviation of split frequencies: 0.008974

      610500 -- [-967.888] (-967.246) (-967.624) (-968.158) * (-971.320) (-970.057) (-969.459) [-966.869] -- 0:00:24
      611000 -- [-968.291] (-968.292) (-970.717) (-967.725) * (-971.060) (-966.972) [-967.922] (-969.725) -- 0:00:24
      611500 -- (-972.024) (-968.212) (-973.055) [-967.664] * (-969.030) (-966.602) [-970.137] (-971.991) -- 0:00:24
      612000 -- (-969.593) [-968.503] (-970.286) (-968.929) * [-967.797] (-967.368) (-970.479) (-970.213) -- 0:00:24
      612500 -- (-967.471) [-970.943] (-968.012) (-965.779) * (-967.137) [-966.287] (-970.722) (-968.064) -- 0:00:24
      613000 -- (-969.039) (-970.042) (-968.010) [-968.340] * (-968.685) (-970.159) [-966.508] (-966.447) -- 0:00:23
      613500 -- (-967.360) [-966.811] (-967.645) (-970.243) * (-966.456) (-967.966) (-968.991) [-968.735] -- 0:00:23
      614000 -- (-965.709) [-968.131] (-969.250) (-971.092) * (-966.030) (-973.292) (-966.063) [-970.689] -- 0:00:23
      614500 -- (-965.639) (-965.609) [-968.269] (-968.635) * (-969.894) [-971.060] (-969.339) (-969.728) -- 0:00:23
      615000 -- (-966.195) (-967.430) (-968.081) [-967.725] * [-973.249] (-971.810) (-967.290) (-967.877) -- 0:00:23

      Average standard deviation of split frequencies: 0.009088

      615500 -- (-965.872) (-967.882) [-967.330] (-968.303) * (-967.161) (-969.164) (-966.234) [-968.697] -- 0:00:23
      616000 -- (-966.247) (-970.999) (-966.303) [-968.762] * (-966.436) (-968.944) (-974.819) [-966.829] -- 0:00:23
      616500 -- (-966.447) (-969.780) [-967.217] (-966.971) * (-967.764) (-965.842) [-966.581] (-967.284) -- 0:00:23
      617000 -- (-967.154) [-966.890] (-965.957) (-968.140) * (-967.304) (-968.315) [-966.052] (-966.237) -- 0:00:23
      617500 -- (-965.661) (-969.818) [-966.688] (-966.893) * (-966.411) [-966.679] (-966.380) (-972.249) -- 0:00:23
      618000 -- [-969.572] (-966.811) (-967.823) (-966.170) * (-967.017) (-970.247) [-966.871] (-970.247) -- 0:00:23
      618500 -- (-967.797) [-969.287] (-967.794) (-967.898) * (-968.280) [-968.246] (-967.084) (-972.327) -- 0:00:23
      619000 -- [-970.681] (-970.471) (-970.961) (-968.919) * (-971.083) (-968.467) (-967.293) [-966.055] -- 0:00:23
      619500 -- [-968.878] (-971.378) (-970.710) (-966.579) * [-968.581] (-965.864) (-969.865) (-968.280) -- 0:00:23
      620000 -- (-966.353) (-968.019) (-969.712) [-967.244] * (-968.054) [-965.894] (-969.538) (-969.756) -- 0:00:23

      Average standard deviation of split frequencies: 0.008497

      620500 -- (-968.914) (-970.019) [-969.404] (-968.206) * (-966.285) [-966.920] (-968.732) (-971.145) -- 0:00:23
      621000 -- [-967.691] (-969.397) (-966.439) (-967.043) * (-968.717) [-969.016] (-969.560) (-968.520) -- 0:00:23
      621500 -- [-968.915] (-968.310) (-968.543) (-970.111) * [-971.553] (-966.828) (-967.617) (-969.342) -- 0:00:23
      622000 -- (-967.429) (-967.723) [-966.417] (-969.144) * [-969.019] (-966.264) (-969.529) (-968.032) -- 0:00:23
      622500 -- (-968.895) [-970.297] (-969.369) (-970.610) * (-967.372) (-967.877) (-966.826) [-967.421] -- 0:00:23
      623000 -- (-967.272) (-969.311) [-967.911] (-969.288) * (-967.809) (-968.641) (-967.123) [-967.229] -- 0:00:22
      623500 -- (-967.468) (-969.905) (-968.390) [-968.288] * (-966.250) [-969.578] (-969.481) (-967.746) -- 0:00:23
      624000 -- (-966.734) [-972.954] (-968.773) (-967.172) * [-968.248] (-969.594) (-967.375) (-973.885) -- 0:00:23
      624500 -- (-967.787) (-969.931) [-968.930] (-968.816) * [-967.195] (-970.776) (-967.561) (-967.670) -- 0:00:23
      625000 -- (-973.097) (-966.252) (-969.294) [-970.894] * [-967.207] (-970.367) (-965.881) (-968.437) -- 0:00:23

      Average standard deviation of split frequencies: 0.008283

      625500 -- (-966.902) [-968.561] (-970.179) (-967.348) * (-968.094) [-968.225] (-967.493) (-967.599) -- 0:00:23
      626000 -- (-967.368) [-966.094] (-968.385) (-967.997) * [-966.386] (-966.639) (-967.163) (-966.830) -- 0:00:23
      626500 -- (-968.285) (-968.926) [-968.555] (-967.548) * [-967.000] (-967.106) (-968.877) (-967.883) -- 0:00:23
      627000 -- (-972.192) [-969.371] (-966.655) (-971.182) * [-967.361] (-969.632) (-969.460) (-967.036) -- 0:00:23
      627500 -- [-970.548] (-966.625) (-967.491) (-966.192) * (-967.665) [-969.833] (-968.285) (-967.702) -- 0:00:23
      628000 -- (-968.317) (-971.422) [-966.918] (-966.305) * (-969.010) (-971.862) (-971.499) [-965.724] -- 0:00:23
      628500 -- (-968.928) (-968.361) (-970.096) [-968.743] * [-971.998] (-969.291) (-965.892) (-968.329) -- 0:00:23
      629000 -- (-972.485) (-970.176) [-967.959] (-967.184) * (-968.955) [-970.420] (-966.525) (-966.985) -- 0:00:23
      629500 -- (-967.028) (-969.266) [-969.298] (-966.431) * [-970.541] (-969.291) (-965.825) (-966.938) -- 0:00:22
      630000 -- (-965.842) (-972.209) [-970.363] (-966.479) * (-967.265) (-967.235) [-966.301] (-967.515) -- 0:00:22

      Average standard deviation of split frequencies: 0.007662

      630500 -- (-966.109) (-968.295) (-970.668) [-966.822] * (-966.763) [-969.396] (-967.809) (-970.819) -- 0:00:22
      631000 -- [-970.733] (-966.408) (-969.629) (-966.650) * (-967.643) [-967.415] (-970.179) (-970.618) -- 0:00:22
      631500 -- [-968.821] (-969.472) (-969.473) (-969.774) * (-966.346) (-968.702) (-976.492) [-969.506] -- 0:00:22
      632000 -- (-967.168) (-970.998) [-967.930] (-967.638) * [-966.176] (-966.899) (-968.547) (-969.108) -- 0:00:22
      632500 -- (-967.163) [-967.544] (-966.897) (-966.712) * (-966.802) (-967.612) (-967.618) [-969.246] -- 0:00:22
      633000 -- (-969.982) [-968.360] (-967.210) (-967.237) * (-965.771) (-968.249) (-966.696) [-967.949] -- 0:00:22
      633500 -- (-971.828) (-967.113) (-972.421) [-968.732] * [-967.552] (-968.384) (-969.957) (-965.705) -- 0:00:22
      634000 -- (-969.844) [-966.993] (-967.310) (-971.715) * [-968.129] (-972.665) (-968.826) (-967.329) -- 0:00:22
      634500 -- (-965.841) (-968.558) [-967.491] (-968.593) * (-967.220) [-972.555] (-967.459) (-967.112) -- 0:00:22
      635000 -- [-967.039] (-966.624) (-968.847) (-968.124) * (-967.496) [-966.906] (-969.354) (-966.578) -- 0:00:22

      Average standard deviation of split frequencies: 0.007412

      635500 -- (-970.270) (-970.086) [-969.220] (-969.626) * [-968.569] (-966.839) (-969.453) (-967.867) -- 0:00:22
      636000 -- (-967.792) [-966.415] (-967.766) (-966.723) * (-970.453) [-967.398] (-966.284) (-968.182) -- 0:00:22
      636500 -- (-967.436) (-968.734) [-968.291] (-968.193) * (-967.166) (-967.433) [-967.032] (-972.874) -- 0:00:22
      637000 -- (-966.475) (-967.672) [-968.047] (-968.584) * [-969.348] (-967.557) (-967.207) (-971.444) -- 0:00:22
      637500 -- (-970.686) (-968.533) [-967.947] (-967.618) * (-967.245) [-967.242] (-968.650) (-967.383) -- 0:00:22
      638000 -- [-967.089] (-972.519) (-970.115) (-966.415) * (-967.903) (-966.963) [-966.375] (-967.127) -- 0:00:22
      638500 -- (-972.737) (-968.009) (-966.479) [-967.316] * (-968.446) [-982.097] (-969.362) (-969.929) -- 0:00:22
      639000 -- (-969.286) [-966.284] (-968.781) (-970.762) * (-968.398) (-970.929) [-967.047] (-968.001) -- 0:00:22
      639500 -- [-967.901] (-968.039) (-967.293) (-966.261) * (-967.649) (-967.857) (-970.863) [-967.884] -- 0:00:21
      640000 -- [-967.054] (-967.757) (-967.746) (-965.990) * (-967.450) [-967.591] (-967.234) (-972.448) -- 0:00:22

      Average standard deviation of split frequencies: 0.007505

      640500 -- (-966.118) (-965.784) [-966.453] (-968.147) * (-971.346) (-967.257) (-969.939) [-967.039] -- 0:00:22
      641000 -- (-967.269) (-969.616) (-967.573) [-967.354] * [-965.602] (-970.136) (-968.202) (-968.065) -- 0:00:22
      641500 -- [-968.395] (-966.811) (-966.868) (-969.564) * [-967.091] (-969.966) (-966.034) (-967.406) -- 0:00:22
      642000 -- (-970.435) (-971.134) (-968.015) [-966.590] * (-966.447) [-966.996] (-970.303) (-966.260) -- 0:00:22
      642500 -- [-969.931] (-967.465) (-970.221) (-966.591) * (-968.364) [-967.210] (-968.666) (-966.476) -- 0:00:22
      643000 -- (-969.207) (-968.051) (-968.456) [-966.032] * (-968.391) [-966.617] (-968.536) (-969.688) -- 0:00:22
      643500 -- (-967.210) [-967.492] (-967.859) (-967.603) * (-968.158) [-966.964] (-968.612) (-972.565) -- 0:00:22
      644000 -- (-967.061) (-966.780) (-967.964) [-967.870] * [-967.066] (-970.172) (-969.562) (-967.277) -- 0:00:22
      644500 -- (-966.181) (-966.523) (-965.898) [-966.375] * [-966.553] (-973.217) (-969.329) (-966.915) -- 0:00:22
      645000 -- [-966.896] (-966.524) (-968.953) (-969.017) * (-968.363) [-971.750] (-967.749) (-966.363) -- 0:00:22

      Average standard deviation of split frequencies: 0.007571

      645500 -- (-968.530) (-969.117) (-967.974) [-968.330] * (-967.087) (-977.000) [-968.169] (-967.740) -- 0:00:21
      646000 -- (-970.954) [-968.375] (-968.111) (-969.254) * (-969.979) (-968.131) (-975.677) [-966.449] -- 0:00:21
      646500 -- (-972.087) [-967.638] (-967.951) (-967.345) * (-967.239) (-967.035) (-972.058) [-971.572] -- 0:00:21
      647000 -- (-966.848) [-968.228] (-967.244) (-967.603) * (-966.799) (-966.518) (-969.715) [-968.021] -- 0:00:21
      647500 -- (-971.384) (-968.683) (-966.201) [-971.839] * (-969.621) (-967.034) (-969.307) [-968.290] -- 0:00:21
      648000 -- (-970.364) [-968.733] (-966.627) (-969.224) * (-967.353) [-970.456] (-967.868) (-968.014) -- 0:00:21
      648500 -- (-968.303) [-968.014] (-967.053) (-967.798) * (-967.236) (-966.914) [-968.978] (-967.237) -- 0:00:21
      649000 -- (-968.850) (-967.863) [-969.050] (-968.520) * (-970.297) (-970.510) [-968.747] (-966.387) -- 0:00:21
      649500 -- [-967.754] (-969.127) (-968.590) (-968.524) * (-969.167) (-970.493) [-968.452] (-968.245) -- 0:00:21
      650000 -- [-967.570] (-966.968) (-968.801) (-966.336) * (-971.255) (-973.009) (-966.255) [-965.990] -- 0:00:21

      Average standard deviation of split frequencies: 0.007698

      650500 -- (-966.380) [-967.640] (-970.227) (-966.271) * (-965.785) (-968.830) (-967.290) [-969.875] -- 0:00:21
      651000 -- [-966.269] (-969.717) (-967.922) (-967.709) * (-966.629) [-967.884] (-969.089) (-967.879) -- 0:00:21
      651500 -- (-965.989) (-966.240) [-967.627] (-968.467) * (-966.336) (-967.253) (-966.762) [-966.516] -- 0:00:21
      652000 -- (-966.243) (-968.472) (-967.616) [-967.878] * (-974.860) (-969.139) [-968.498] (-968.702) -- 0:00:21
      652500 -- (-968.158) (-971.445) [-966.486] (-967.152) * [-969.896] (-966.877) (-967.166) (-968.866) -- 0:00:21
      653000 -- [-969.605] (-967.846) (-966.265) (-966.488) * [-966.318] (-967.325) (-966.626) (-969.178) -- 0:00:21
      653500 -- (-966.510) (-967.069) (-967.217) [-967.471] * [-967.671] (-973.282) (-966.609) (-966.473) -- 0:00:21
      654000 -- (-968.060) [-966.968] (-966.899) (-968.407) * (-967.472) (-968.025) (-969.893) [-967.201] -- 0:00:21
      654500 -- [-967.509] (-968.314) (-967.633) (-968.657) * [-968.189] (-970.421) (-966.490) (-968.915) -- 0:00:21
      655000 -- (-967.896) (-968.085) [-966.805] (-969.206) * (-968.042) (-967.925) (-966.321) [-970.277] -- 0:00:21

      Average standard deviation of split frequencies: 0.007276

      655500 -- (-967.337) [-968.206] (-966.142) (-971.597) * [-966.948] (-969.972) (-965.743) (-968.069) -- 0:00:21
      656000 -- [-966.886] (-970.066) (-966.481) (-972.143) * (-968.348) [-968.410] (-970.156) (-968.048) -- 0:00:21
      656500 -- (-965.590) [-968.282] (-966.594) (-967.066) * (-967.741) [-965.943] (-968.180) (-969.494) -- 0:00:21
      657000 -- (-968.840) (-968.321) [-966.484] (-967.615) * [-967.902] (-968.631) (-967.932) (-969.316) -- 0:00:21
      657500 -- (-974.458) (-971.174) (-967.050) [-966.534] * (-968.948) [-970.163] (-969.163) (-970.091) -- 0:00:21
      658000 -- (-969.944) (-968.640) [-966.919] (-967.073) * (-971.308) [-968.342] (-966.546) (-967.035) -- 0:00:21
      658500 -- (-969.685) (-966.514) (-966.831) [-966.037] * [-967.281] (-972.093) (-967.282) (-966.546) -- 0:00:21
      659000 -- (-969.502) [-968.697] (-966.982) (-967.443) * (-966.473) (-969.210) (-966.137) [-967.731] -- 0:00:21
      659500 -- [-966.082] (-967.401) (-967.742) (-966.196) * (-968.043) (-966.619) [-970.823] (-967.831) -- 0:00:21
      660000 -- (-967.402) (-968.472) (-966.551) [-967.899] * [-966.622] (-966.291) (-972.834) (-969.071) -- 0:00:21

      Average standard deviation of split frequencies: 0.007314

      660500 -- (-967.113) [-967.615] (-967.053) (-967.279) * (-967.001) (-966.398) (-966.378) [-969.836] -- 0:00:21
      661000 -- (-966.109) (-967.183) [-966.401] (-967.498) * (-966.797) [-966.663] (-966.550) (-965.700) -- 0:00:21
      661500 -- (-967.598) [-967.694] (-965.978) (-966.865) * (-967.221) (-967.389) [-966.881] (-967.840) -- 0:00:20
      662000 -- (-966.561) [-967.467] (-968.838) (-968.326) * (-968.971) (-969.403) (-967.084) [-971.691] -- 0:00:20
      662500 -- (-969.752) (-966.918) (-969.889) [-966.657] * [-969.661] (-967.495) (-969.192) (-968.943) -- 0:00:20
      663000 -- (-968.683) (-966.982) [-966.862] (-967.810) * (-968.496) (-968.848) (-967.553) [-967.725] -- 0:00:20
      663500 -- (-972.165) [-966.763] (-968.603) (-965.710) * (-967.957) (-969.459) [-966.287] (-969.372) -- 0:00:20
      664000 -- (-966.567) (-970.589) (-969.139) [-965.667] * [-967.953] (-969.214) (-967.438) (-970.493) -- 0:00:20
      664500 -- (-967.522) (-969.769) [-968.191] (-969.419) * [-966.818] (-966.697) (-968.277) (-967.378) -- 0:00:20
      665000 -- (-966.472) (-970.414) [-969.681] (-967.110) * (-970.056) (-966.671) [-969.857] (-972.096) -- 0:00:20

      Average standard deviation of split frequencies: 0.007034

      665500 -- (-966.895) [-968.608] (-968.023) (-969.547) * (-968.105) (-968.472) [-968.828] (-968.144) -- 0:00:20
      666000 -- (-968.877) [-969.543] (-966.113) (-968.826) * [-967.326] (-968.686) (-969.229) (-968.147) -- 0:00:20
      666500 -- (-969.633) [-966.816] (-967.654) (-969.540) * (-965.722) (-966.770) (-970.588) [-966.959] -- 0:00:20
      667000 -- (-971.154) (-965.825) [-967.148] (-968.558) * (-965.721) (-968.150) [-967.234] (-968.135) -- 0:00:20
      667500 -- (-968.081) (-968.037) (-966.702) [-967.344] * (-966.741) (-968.810) (-966.521) [-968.402] -- 0:00:20
      668000 -- (-967.064) (-967.365) (-972.184) [-966.910] * (-966.760) [-970.907] (-968.230) (-966.800) -- 0:00:20
      668500 -- [-967.874] (-967.819) (-966.661) (-966.935) * [-968.354] (-967.324) (-966.080) (-966.162) -- 0:00:20
      669000 -- (-969.164) [-965.898] (-967.441) (-967.705) * (-970.458) [-970.613] (-968.090) (-968.840) -- 0:00:20
      669500 -- (-970.443) (-966.146) [-967.354] (-969.461) * (-969.201) (-969.257) [-968.654] (-967.401) -- 0:00:20
      670000 -- (-971.884) [-967.204] (-971.315) (-971.001) * [-966.705] (-967.924) (-970.562) (-968.177) -- 0:00:20

      Average standard deviation of split frequencies: 0.007161

      670500 -- (-969.768) [-968.682] (-972.211) (-968.060) * (-967.792) (-968.247) [-970.003] (-968.376) -- 0:00:20
      671000 -- (-969.728) (-967.719) [-968.612] (-967.820) * (-967.508) (-968.173) (-971.302) [-966.030] -- 0:00:20
      671500 -- (-966.327) (-968.113) (-968.169) [-966.067] * (-970.006) [-967.416] (-969.214) (-967.946) -- 0:00:20
      672000 -- [-966.199] (-972.053) (-969.713) (-970.225) * (-969.612) [-966.274] (-969.842) (-969.807) -- 0:00:20
      672500 -- [-969.060] (-967.390) (-969.957) (-969.900) * (-972.124) [-969.060] (-968.271) (-968.947) -- 0:00:20
      673000 -- (-967.955) (-969.870) (-967.333) [-966.447] * (-968.784) [-966.671] (-965.811) (-969.002) -- 0:00:20
      673500 -- [-967.395] (-968.632) (-970.875) (-969.975) * (-966.044) [-968.277] (-965.700) (-966.871) -- 0:00:20
      674000 -- (-966.227) (-967.770) [-967.258] (-967.706) * (-966.924) (-966.625) [-965.931] (-968.138) -- 0:00:20
      674500 -- (-966.760) (-968.789) (-968.674) [-966.213] * [-966.492] (-966.537) (-970.310) (-968.743) -- 0:00:20
      675000 -- [-968.370] (-968.628) (-970.510) (-968.748) * (-967.121) (-965.908) (-971.519) [-966.890] -- 0:00:20

      Average standard deviation of split frequencies: 0.007366

      675500 -- (-966.095) (-967.596) (-966.339) [-967.648] * (-972.333) (-966.131) [-968.505] (-969.234) -- 0:00:20
      676000 -- [-969.599] (-968.208) (-968.092) (-967.261) * (-971.225) (-967.986) [-967.249] (-973.602) -- 0:00:20
      676500 -- (-969.475) (-970.005) [-966.675] (-966.011) * (-972.158) (-967.267) [-967.379] (-966.472) -- 0:00:20
      677000 -- (-968.603) (-969.388) (-968.583) [-967.213] * (-971.359) (-966.931) [-967.091] (-967.233) -- 0:00:20
      677500 -- (-969.293) (-971.423) (-971.536) [-968.410] * (-968.513) [-966.313] (-969.873) (-967.112) -- 0:00:19
      678000 -- (-969.325) (-969.269) (-966.467) [-969.615] * (-969.926) (-968.728) (-966.773) [-968.609] -- 0:00:19
      678500 -- (-966.166) [-966.410] (-967.475) (-966.335) * [-969.027] (-966.500) (-969.745) (-971.176) -- 0:00:19
      679000 -- (-966.471) (-969.047) [-969.957] (-967.058) * (-966.624) (-969.421) (-970.859) [-966.738] -- 0:00:19
      679500 -- (-968.466) (-969.164) [-968.694] (-967.041) * (-965.915) (-967.498) [-967.068] (-967.123) -- 0:00:19
      680000 -- (-968.568) (-967.418) [-969.032] (-966.554) * (-969.192) [-967.491] (-967.341) (-969.327) -- 0:00:19

      Average standard deviation of split frequencies: 0.006796

      680500 -- (-973.507) [-966.735] (-966.683) (-966.191) * (-967.794) [-968.212] (-969.313) (-969.038) -- 0:00:19
      681000 -- [-969.703] (-967.839) (-966.635) (-966.679) * [-968.455] (-966.913) (-967.545) (-967.143) -- 0:00:19
      681500 -- [-965.818] (-968.388) (-969.753) (-971.955) * (-972.953) (-967.192) (-968.268) [-968.001] -- 0:00:19
      682000 -- [-966.434] (-970.285) (-967.868) (-970.287) * [-970.567] (-967.748) (-966.946) (-968.364) -- 0:00:19
      682500 -- (-970.066) [-970.430] (-967.540) (-967.944) * (-967.026) [-969.308] (-970.845) (-969.773) -- 0:00:19
      683000 -- (-967.845) (-971.226) (-966.923) [-967.331] * [-973.146] (-966.040) (-970.918) (-966.425) -- 0:00:19
      683500 -- (-966.358) [-966.842] (-967.933) (-968.312) * (-969.334) (-967.688) (-969.300) [-970.640] -- 0:00:19
      684000 -- [-967.370] (-968.768) (-967.439) (-969.837) * (-971.014) [-973.387] (-966.944) (-967.919) -- 0:00:19
      684500 -- [-968.747] (-968.061) (-965.997) (-968.255) * (-965.834) (-971.773) (-966.125) [-968.821] -- 0:00:19
      685000 -- (-969.814) (-968.721) (-972.385) [-970.508] * [-965.749] (-968.612) (-969.053) (-968.189) -- 0:00:19

      Average standard deviation of split frequencies: 0.006442

      685500 -- [-967.779] (-966.942) (-968.369) (-972.191) * (-967.558) [-967.098] (-969.643) (-972.151) -- 0:00:19
      686000 -- (-967.377) [-966.935] (-966.712) (-972.496) * (-968.696) [-967.229] (-967.381) (-966.086) -- 0:00:19
      686500 -- (-968.184) [-971.542] (-969.359) (-967.705) * [-969.790] (-972.617) (-969.276) (-967.266) -- 0:00:19
      687000 -- (-967.134) (-967.104) [-966.459] (-967.713) * [-970.109] (-969.577) (-969.299) (-966.594) -- 0:00:19
      687500 -- [-967.327] (-974.760) (-966.510) (-968.227) * (-968.204) [-967.114] (-970.621) (-968.616) -- 0:00:19
      688000 -- (-969.109) (-972.124) [-967.475] (-968.011) * (-966.832) [-967.922] (-968.023) (-966.933) -- 0:00:19
      688500 -- (-970.795) (-973.736) (-967.411) [-971.618] * (-969.769) [-966.510] (-966.247) (-966.309) -- 0:00:19
      689000 -- (-967.133) [-971.113] (-967.295) (-972.237) * (-966.682) (-967.327) (-970.168) [-966.223] -- 0:00:19
      689500 -- (-966.203) (-968.796) [-966.725] (-967.981) * (-966.142) [-970.171] (-970.937) (-968.815) -- 0:00:19
      690000 -- [-967.518] (-965.604) (-967.768) (-970.122) * (-968.660) (-969.238) (-969.166) [-971.976] -- 0:00:19

      Average standard deviation of split frequencies: 0.006825

      690500 -- [-967.021] (-968.088) (-965.984) (-967.441) * (-967.623) (-967.900) [-966.559] (-969.657) -- 0:00:19
      691000 -- (-970.145) (-969.093) [-968.264] (-967.229) * (-968.626) (-967.300) (-965.701) [-967.251] -- 0:00:19
      691500 -- (-969.001) (-971.756) [-968.181] (-966.626) * (-966.978) (-971.401) [-968.767] (-966.545) -- 0:00:19
      692000 -- [-966.065] (-967.341) (-969.012) (-969.529) * (-970.471) [-968.706] (-968.016) (-969.835) -- 0:00:19
      692500 -- (-969.786) (-972.897) (-968.013) [-966.374] * (-966.951) [-969.004] (-969.796) (-972.472) -- 0:00:19
      693000 -- (-966.209) [-966.033] (-967.350) (-968.716) * [-968.352] (-969.403) (-975.058) (-969.719) -- 0:00:19
      693500 -- (-969.174) [-969.124] (-966.864) (-968.743) * (-966.464) (-970.506) [-965.961] (-971.200) -- 0:00:19
      694000 -- (-967.667) [-968.830] (-966.848) (-966.493) * (-969.391) (-968.439) [-967.640] (-967.269) -- 0:00:18
      694500 -- [-966.358] (-971.592) (-969.725) (-970.038) * [-969.511]