--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:37:01 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0069/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -541.87          -545.02
2       -541.84          -545.38
--------------------------------------
TOTAL     -541.85          -545.22
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896810    0.088020    0.379227    1.507977    0.863928   1388.14   1444.57    1.000
r(A<->C){all}   0.156734    0.017875    0.000032    0.430068    0.120072    292.04    292.41    1.003
r(A<->G){all}   0.180185    0.021600    0.000029    0.468870    0.144488    169.86    193.77    1.004
r(A<->T){all}   0.161807    0.019422    0.000417    0.442837    0.125010    298.52    318.07    1.004
r(C<->G){all}   0.163843    0.019492    0.000199    0.436465    0.127563    260.95    316.31    1.003
r(C<->T){all}   0.177576    0.020995    0.000094    0.470954    0.143543    130.39    251.48    1.001
r(G<->T){all}   0.159856    0.018422    0.000084    0.427011    0.124374    202.11    232.24    1.000
pi(A){all}      0.214807    0.000409    0.175602    0.255607    0.214393   1311.83   1406.42    1.000
pi(C){all}      0.327974    0.000538    0.283598    0.373742    0.327590   1406.60   1447.10    1.001
pi(G){all}      0.267121    0.000494    0.224425    0.308248    0.267482   1403.87   1406.95    1.001
pi(T){all}      0.190099    0.000370    0.153863    0.227602    0.189364   1315.41   1356.35    1.000
alpha{1,2}      0.424273    0.246133    0.000146    1.416917    0.242261   1048.46   1106.82    1.000
alpha{3}        0.461024    0.242524    0.000289    1.456086    0.299727   1388.55   1444.78    1.000
pinvar{all}     0.995782    0.000030    0.986773    0.999997    0.997441   1258.77   1337.00    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-525.304808
Model 2: PositiveSelection	-525.304808
Model 0: one-ratio	-525.304916
Model 7: beta	-525.304808
Model 8: beta&w>1	-525.304808


Model 0 vs 1	2.1600000013677345E-4

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C2
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C3
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C4
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C5
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C6
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132 

C1              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C2              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C3              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C4              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C5              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C6              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
                **************************************************

C1              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C2              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C3              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C4              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C5              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C6              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
                **************************************************

C1              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C2              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C3              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C4              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C5              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C6              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
                ********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3960]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3960]--->[3960]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.452 Mb, Max= 30.652 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C2              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C3              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C4              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C5              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C6              MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
                **************************************************

C1              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C2              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C3              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C4              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C5              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C6              GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
                **************************************************

C1              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C2              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C3              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C4              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C5              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C6              RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
                ********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C2              ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C3              ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C4              ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C5              ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C6              ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
                **************************************************

C1              TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C2              TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C3              TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C4              TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C5              TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C6              TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
                **************************************************

C1              AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C2              AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C3              AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C4              AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C5              AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C6              AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
                **************************************************

C1              GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C2              GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C3              GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C4              GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C5              GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C6              GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
                **************************************************

C1              CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C2              CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C3              CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C4              CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C5              CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C6              CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
                **************************************************

C1              TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C2              TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C3              TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C4              TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C5              TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C6              TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
                **************************************************

C1              CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C2              CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C3              CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C4              CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C5              CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C6              CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
                **************************************************

C1              CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C2              CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C3              CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C4              CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C5              CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C6              CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
                **********************************************



>C1
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C2
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C3
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C4
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C5
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C6
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C1
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C2
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C3
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C4
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C5
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C6
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 396 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790150
      Setting output file names to "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1227373927
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0027983882
      Seed = 1596822155
      Swapseed = 1579790150
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -886.266852 -- -24.965149
         Chain 2 -- -886.266937 -- -24.965149
         Chain 3 -- -886.266987 -- -24.965149
         Chain 4 -- -886.266937 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -886.266987 -- -24.965149
         Chain 2 -- -886.266937 -- -24.965149
         Chain 3 -- -886.266937 -- -24.965149
         Chain 4 -- -886.266937 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-886.267] (-886.267) (-886.267) (-886.267) * [-886.267] (-886.267) (-886.267) (-886.267) 
        500 -- [-552.293] (-549.194) (-558.586) (-556.939) * [-544.985] (-556.749) (-554.503) (-555.594) -- 0:00:00
       1000 -- [-546.704] (-549.347) (-555.604) (-561.580) * (-551.806) (-547.913) (-551.494) [-548.925] -- 0:00:00
       1500 -- (-555.035) (-556.005) (-560.577) [-553.970] * (-551.785) (-557.917) [-547.594] (-551.187) -- 0:00:00
       2000 -- (-549.500) (-550.381) [-548.226] (-549.254) * [-546.557] (-554.940) (-552.772) (-548.351) -- 0:00:00
       2500 -- [-550.129] (-547.893) (-554.032) (-549.123) * (-559.286) [-551.690] (-550.268) (-555.676) -- 0:00:00
       3000 -- (-549.578) [-548.453] (-547.677) (-552.884) * (-550.005) (-552.760) (-548.055) [-562.646] -- 0:00:00
       3500 -- (-558.972) (-547.952) [-551.835] (-557.592) * (-548.074) [-545.685] (-551.062) (-554.078) -- 0:00:00
       4000 -- (-558.212) (-551.762) [-548.810] (-553.238) * (-552.117) (-561.386) (-550.453) [-547.572] -- 0:00:00
       4500 -- [-550.430] (-557.669) (-549.278) (-549.755) * (-557.258) (-551.793) [-549.093] (-550.416) -- 0:00:00
       5000 -- (-547.514) (-558.186) (-551.698) [-552.002] * (-541.485) (-555.366) (-551.834) [-546.496] -- 0:00:00

      Average standard deviation of split frequencies: 0.092852

       5500 -- (-550.744) (-552.814) [-548.647] (-545.258) * (-542.410) (-550.794) (-551.019) [-547.337] -- 0:00:00
       6000 -- (-546.951) (-552.845) (-550.154) [-550.080] * [-540.723] (-549.154) (-559.503) (-567.809) -- 0:00:00
       6500 -- (-564.029) (-559.023) (-557.052) [-550.006] * [-542.120] (-548.905) (-551.009) (-559.903) -- 0:00:00
       7000 -- (-563.275) (-550.072) (-547.820) [-551.421] * (-542.359) [-547.337] (-558.816) (-550.895) -- 0:00:00
       7500 -- (-549.913) [-549.131] (-558.083) (-552.703) * (-541.464) [-550.489] (-552.290) (-545.580) -- 0:00:00
       8000 -- (-552.102) (-555.949) [-547.960] (-559.423) * (-542.715) [-555.425] (-558.707) (-542.271) -- 0:00:00
       8500 -- [-550.679] (-557.445) (-550.188) (-549.931) * (-542.616) [-552.376] (-550.514) (-543.429) -- 0:00:00
       9000 -- (-550.588) (-546.287) (-558.738) [-547.240] * (-541.644) (-567.161) (-553.997) [-541.805] -- 0:00:00
       9500 -- [-549.422] (-566.741) (-548.117) (-547.798) * [-542.505] (-558.006) (-558.934) (-542.352) -- 0:00:00
      10000 -- [-548.601] (-570.014) (-554.757) (-556.793) * (-541.895) (-556.757) (-558.278) [-543.347] -- 0:00:00

      Average standard deviation of split frequencies: 0.090714

      10500 -- (-554.992) (-557.531) [-557.137] (-556.947) * (-540.501) (-550.547) [-564.008] (-546.152) -- 0:00:00
      11000 -- (-547.709) (-542.783) (-565.503) [-547.805] * [-541.375] (-546.169) (-562.148) (-542.889) -- 0:00:00
      11500 -- (-550.665) (-543.031) [-544.224] (-552.467) * (-541.933) (-554.314) (-557.325) [-542.530] -- 0:00:00
      12000 -- (-551.121) [-541.450] (-541.813) (-558.302) * (-542.734) (-555.394) [-550.548] (-543.175) -- 0:00:00
      12500 -- (-554.087) (-541.349) (-542.863) [-553.596] * (-543.744) (-553.558) (-559.782) [-541.704] -- 0:00:00
      13000 -- (-567.736) (-545.009) [-542.229] (-551.693) * (-544.092) [-548.216] (-557.514) (-542.167) -- 0:00:00
      13500 -- (-552.814) (-541.910) [-542.826] (-553.783) * [-542.788] (-550.021) (-554.402) (-541.803) -- 0:00:00
      14000 -- (-552.584) [-541.564] (-542.482) (-572.851) * (-543.186) (-547.228) (-551.917) [-541.839] -- 0:00:00
      14500 -- (-540.470) (-541.123) [-541.323] (-558.771) * (-541.337) (-551.511) [-548.816] (-542.599) -- 0:00:00
      15000 -- [-542.241] (-541.330) (-545.602) (-563.485) * (-543.665) [-550.333] (-554.135) (-541.753) -- 0:00:00

      Average standard deviation of split frequencies: 0.068230

      15500 -- (-543.552) (-544.441) (-542.201) [-545.290] * (-542.122) (-552.800) (-556.530) [-544.020] -- 0:01:03
      16000 -- [-541.081] (-547.852) (-542.813) (-545.416) * [-544.883] (-551.597) (-543.870) (-547.154) -- 0:01:01
      16500 -- (-541.666) (-544.163) (-543.056) [-546.177] * (-541.280) [-549.103] (-542.060) (-542.721) -- 0:00:59
      17000 -- (-542.470) (-540.495) [-543.494] (-543.661) * (-544.083) (-569.389) [-540.936] (-541.039) -- 0:00:57
      17500 -- [-541.780] (-542.274) (-543.285) (-541.600) * (-543.465) [-552.357] (-542.153) (-542.794) -- 0:00:56
      18000 -- (-543.481) (-542.929) [-542.335] (-541.561) * (-544.260) (-554.428) [-542.221] (-541.241) -- 0:00:54
      18500 -- (-542.905) (-543.333) [-541.213] (-542.439) * [-541.905] (-541.060) (-542.143) (-542.247) -- 0:00:53
      19000 -- (-544.831) (-546.500) [-541.691] (-541.270) * (-541.673) [-544.498] (-543.232) (-540.485) -- 0:00:51
      19500 -- (-545.256) (-544.073) [-543.200] (-541.277) * (-541.683) (-546.688) (-543.744) [-544.661] -- 0:00:50
      20000 -- (-548.260) (-541.525) (-541.941) [-544.787] * (-541.567) (-542.222) (-544.645) [-546.438] -- 0:00:49

      Average standard deviation of split frequencies: 0.062727

      20500 -- (-541.973) (-547.029) [-540.799] (-544.311) * (-542.532) (-547.752) (-542.153) [-546.762] -- 0:00:47
      21000 -- (-543.474) (-553.695) (-543.555) [-543.689] * [-542.263] (-543.386) (-540.828) (-540.420) -- 0:00:46
      21500 -- (-540.755) [-542.132] (-549.711) (-543.863) * (-546.933) (-542.814) (-541.879) [-540.630] -- 0:00:45
      22000 -- (-543.835) [-547.067] (-542.407) (-540.577) * [-542.572] (-544.745) (-541.266) (-542.054) -- 0:00:44
      22500 -- [-544.569] (-544.422) (-543.567) (-542.345) * [-541.291] (-548.849) (-543.691) (-541.605) -- 0:00:43
      23000 -- (-545.059) (-541.379) [-541.285] (-541.442) * [-544.268] (-544.752) (-542.613) (-541.872) -- 0:00:42
      23500 -- (-545.891) (-543.748) (-541.767) [-540.840] * (-542.639) [-544.005] (-541.987) (-542.717) -- 0:00:41
      24000 -- (-541.829) (-542.266) (-541.733) [-541.142] * (-543.002) [-543.830] (-540.751) (-548.179) -- 0:00:40
      24500 -- [-543.837] (-544.177) (-542.656) (-542.599) * (-546.817) (-542.916) (-541.883) [-546.121] -- 0:00:39
      25000 -- (-544.183) (-550.218) (-542.103) [-547.238] * [-542.972] (-543.722) (-540.652) (-544.270) -- 0:00:39

      Average standard deviation of split frequencies: 0.043514

      25500 -- [-542.168] (-545.140) (-543.644) (-541.131) * (-541.158) [-544.690] (-542.232) (-545.905) -- 0:00:38
      26000 -- (-542.666) (-540.667) [-545.000] (-540.950) * (-541.519) (-541.670) [-541.969] (-540.765) -- 0:00:37
      26500 -- (-543.137) (-542.251) [-543.318] (-541.601) * [-542.891] (-541.874) (-543.959) (-540.692) -- 0:00:36
      27000 -- (-541.227) (-543.992) [-543.325] (-542.325) * (-542.104) [-543.833] (-545.791) (-540.886) -- 0:00:36
      27500 -- (-544.522) (-541.879) [-540.662] (-541.909) * (-541.460) (-540.916) [-547.665] (-541.098) -- 0:00:35
      28000 -- [-542.495] (-541.717) (-541.699) (-543.254) * (-540.685) (-542.934) (-543.871) [-541.162] -- 0:00:34
      28500 -- (-541.642) [-542.947] (-546.046) (-542.812) * (-543.832) [-542.498] (-542.052) (-543.610) -- 0:00:34
      29000 -- (-541.912) (-542.152) (-545.549) [-542.049] * (-542.962) (-542.422) [-542.371] (-544.106) -- 0:00:33
      29500 -- (-544.172) [-541.507] (-542.723) (-543.095) * (-543.662) (-544.994) (-544.619) [-542.197] -- 0:00:32
      30000 -- (-544.225) (-540.715) [-543.795] (-545.294) * (-543.255) [-543.310] (-546.556) (-543.025) -- 0:00:32

      Average standard deviation of split frequencies: 0.040992

      30500 -- (-541.851) (-541.087) (-544.850) [-542.762] * (-541.799) (-542.532) (-544.803) [-544.575] -- 0:00:31
      31000 -- [-542.779] (-542.378) (-542.683) (-541.557) * (-541.731) (-542.306) (-543.125) [-541.232] -- 0:00:31
      31500 -- (-542.861) [-542.576] (-544.956) (-541.526) * (-541.924) (-545.720) [-542.100] (-541.820) -- 0:00:30
      32000 -- [-541.769] (-544.393) (-544.564) (-541.279) * (-542.794) (-541.469) [-540.834] (-543.102) -- 0:01:00
      32500 -- (-541.709) [-544.117] (-543.392) (-542.502) * [-541.479] (-541.318) (-542.403) (-544.037) -- 0:00:59
      33000 -- (-541.027) (-541.729) [-545.101] (-541.175) * (-542.723) (-543.414) (-544.691) [-544.533] -- 0:00:58
      33500 -- (-542.007) (-540.799) [-544.848] (-548.990) * (-540.895) (-543.509) [-543.221] (-546.738) -- 0:00:57
      34000 -- (-545.959) (-540.747) [-545.439] (-540.928) * (-541.662) (-542.574) [-543.842] (-541.204) -- 0:00:56
      34500 -- (-541.790) (-540.335) [-541.867] (-541.401) * (-541.478) (-544.017) (-545.907) [-542.795] -- 0:00:55
      35000 -- (-541.250) (-540.823) (-542.028) [-541.972] * (-544.249) (-543.528) [-542.437] (-542.581) -- 0:00:55

      Average standard deviation of split frequencies: 0.039284

      35500 -- (-541.545) (-543.373) (-541.842) [-541.820] * (-543.944) (-542.016) (-541.092) [-543.821] -- 0:00:54
      36000 -- (-540.923) (-546.478) [-540.762] (-542.330) * (-544.153) (-541.954) [-542.240] (-545.069) -- 0:00:53
      36500 -- (-540.867) (-544.073) [-542.254] (-542.091) * (-543.139) (-541.954) (-543.567) [-541.734] -- 0:00:52
      37000 -- (-547.182) (-541.696) [-541.454] (-544.568) * (-541.999) (-546.376) [-541.291] (-540.418) -- 0:00:52
      37500 -- (-543.849) [-542.242] (-541.342) (-543.386) * (-544.349) (-544.129) (-541.252) [-541.305] -- 0:00:51
      38000 -- (-541.539) [-543.790] (-540.528) (-544.252) * (-540.983) [-545.852] (-542.017) (-544.344) -- 0:00:50
      38500 -- (-546.444) (-544.638) (-543.592) [-540.624] * (-543.852) [-543.699] (-541.773) (-541.710) -- 0:00:49
      39000 -- (-541.588) (-542.479) [-542.445] (-542.803) * [-542.066] (-544.685) (-546.196) (-543.204) -- 0:00:49
      39500 -- (-542.611) [-542.445] (-543.683) (-541.145) * (-543.317) (-546.049) (-544.604) [-541.085] -- 0:00:48
      40000 -- [-544.491] (-541.500) (-542.989) (-543.754) * [-540.755] (-541.975) (-542.489) (-541.917) -- 0:00:48

      Average standard deviation of split frequencies: 0.031298

      40500 -- (-542.617) (-541.982) [-543.972] (-542.640) * (-545.496) (-543.437) (-541.661) [-546.048] -- 0:00:47
      41000 -- [-542.087] (-541.061) (-544.850) (-544.856) * (-543.732) (-542.751) (-541.894) [-543.626] -- 0:00:46
      41500 -- [-541.239] (-541.459) (-545.228) (-545.161) * (-549.854) (-542.554) (-541.883) [-541.154] -- 0:00:46
      42000 -- (-543.346) (-543.017) (-543.413) [-542.802] * (-542.170) (-544.450) [-541.884] (-544.769) -- 0:00:45
      42500 -- (-546.947) (-543.914) [-541.987] (-545.873) * (-544.065) [-543.666] (-541.467) (-540.871) -- 0:00:45
      43000 -- (-545.255) (-541.815) [-541.758] (-540.911) * [-541.491] (-540.796) (-544.531) (-541.799) -- 0:00:44
      43500 -- (-544.037) (-541.332) (-541.751) [-541.181] * [-541.989] (-545.306) (-541.936) (-540.739) -- 0:00:43
      44000 -- (-548.492) (-540.305) [-544.264] (-541.205) * (-541.905) (-543.441) [-543.156] (-547.262) -- 0:00:43
      44500 -- (-543.249) [-541.588] (-541.583) (-541.413) * (-542.689) [-543.496] (-546.173) (-543.334) -- 0:00:42
      45000 -- [-541.924] (-541.153) (-541.650) (-544.548) * (-542.524) [-541.033] (-543.124) (-541.654) -- 0:00:42

      Average standard deviation of split frequencies: 0.026086

      45500 -- (-550.019) (-542.983) [-546.565] (-543.921) * (-545.386) (-542.303) (-541.049) [-540.496] -- 0:00:41
      46000 -- [-544.334] (-541.677) (-542.425) (-543.112) * (-541.116) [-541.151] (-542.693) (-541.752) -- 0:00:41
      46500 -- (-541.755) [-542.098] (-541.027) (-543.569) * [-541.443] (-541.890) (-544.453) (-540.716) -- 0:00:41
      47000 -- [-541.622] (-542.524) (-544.007) (-542.938) * (-540.688) [-542.631] (-541.203) (-542.348) -- 0:00:40
      47500 -- [-546.222] (-543.890) (-542.423) (-541.723) * (-540.604) (-542.574) [-541.966] (-546.966) -- 0:00:40
      48000 -- (-544.405) (-540.275) (-545.479) [-542.692] * [-540.648] (-541.513) (-548.082) (-546.053) -- 0:00:39
      48500 -- (-543.338) (-546.412) [-544.988] (-541.073) * (-543.457) (-541.548) (-546.554) [-543.614] -- 0:00:39
      49000 -- (-543.697) [-546.235] (-543.631) (-542.698) * (-542.132) [-544.158] (-542.646) (-543.425) -- 0:00:38
      49500 -- [-540.927] (-544.038) (-541.935) (-541.412) * [-541.202] (-546.036) (-541.925) (-541.959) -- 0:00:57
      50000 -- (-541.680) (-540.777) (-543.520) [-544.435] * (-541.399) (-544.439) (-542.093) [-542.861] -- 0:00:57

      Average standard deviation of split frequencies: 0.027912

      50500 -- (-544.611) (-543.289) (-541.658) [-544.186] * [-544.374] (-544.876) (-544.808) (-543.730) -- 0:00:56
      51000 -- (-542.180) (-543.215) (-541.629) [-544.063] * [-542.420] (-541.192) (-543.599) (-548.385) -- 0:00:55
      51500 -- (-542.631) [-540.528] (-543.381) (-541.952) * [-543.273] (-542.732) (-545.474) (-543.860) -- 0:00:55
      52000 -- (-541.743) [-540.979] (-543.419) (-541.052) * (-541.460) (-544.031) (-544.430) [-542.314] -- 0:00:54
      52500 -- (-543.407) (-542.781) (-544.713) [-540.744] * (-541.024) (-541.636) (-540.976) [-542.419] -- 0:00:54
      53000 -- (-543.540) [-543.457] (-541.219) (-541.041) * (-545.411) (-541.015) [-542.286] (-545.017) -- 0:00:53
      53500 -- [-541.154] (-543.235) (-546.597) (-543.567) * (-543.088) (-541.968) (-544.237) [-544.143] -- 0:00:53
      54000 -- (-542.353) (-540.735) (-545.831) [-544.108] * (-542.633) (-541.388) (-540.188) [-541.581] -- 0:00:52
      54500 -- [-543.365] (-545.244) (-541.324) (-542.532) * (-541.325) (-541.633) (-540.856) [-542.285] -- 0:00:52
      55000 -- (-542.602) (-544.005) (-542.026) [-540.749] * [-541.697] (-546.204) (-542.145) (-542.010) -- 0:00:51

      Average standard deviation of split frequencies: 0.031476

      55500 -- [-542.994] (-542.341) (-546.366) (-544.444) * (-544.728) [-542.102] (-543.464) (-542.083) -- 0:00:51
      56000 -- (-541.585) (-542.341) [-543.598] (-545.038) * (-543.505) (-544.835) (-543.059) [-540.616] -- 0:00:50
      56500 -- (-540.766) [-541.413] (-540.741) (-543.051) * (-540.882) [-540.613] (-541.906) (-546.113) -- 0:00:50
      57000 -- [-540.547] (-544.085) (-542.865) (-544.332) * (-541.578) (-543.032) [-541.341] (-543.163) -- 0:00:49
      57500 -- (-542.749) [-543.272] (-543.391) (-542.025) * (-541.432) [-543.396] (-542.268) (-542.308) -- 0:00:49
      58000 -- (-545.365) [-544.577] (-543.517) (-546.052) * [-541.795] (-543.718) (-541.464) (-541.500) -- 0:00:48
      58500 -- (-545.984) (-546.576) (-540.618) [-546.648] * (-542.238) (-541.745) [-541.012] (-542.954) -- 0:00:48
      59000 -- [-541.042] (-544.006) (-541.173) (-541.911) * (-542.968) [-541.704] (-541.332) (-541.674) -- 0:00:47
      59500 -- (-543.241) (-544.905) (-540.669) [-544.323] * (-541.265) (-543.320) (-543.457) [-543.986] -- 0:00:47
      60000 -- (-542.393) (-544.299) (-541.578) [-542.578] * (-541.223) [-542.472] (-542.103) (-542.843) -- 0:00:47

      Average standard deviation of split frequencies: 0.030342

      60500 -- (-548.284) (-543.666) (-542.085) [-543.008] * (-545.482) [-540.369] (-543.371) (-546.228) -- 0:00:46
      61000 -- (-540.956) (-547.059) [-542.424] (-541.528) * [-544.281] (-541.552) (-544.298) (-542.350) -- 0:00:46
      61500 -- [-544.573] (-544.464) (-541.196) (-541.725) * [-543.047] (-542.059) (-545.264) (-543.238) -- 0:00:45
      62000 -- (-547.259) (-541.750) (-544.386) [-540.256] * (-542.154) (-541.401) (-541.074) [-541.222] -- 0:00:45
      62500 -- (-542.128) [-545.887] (-543.338) (-541.696) * (-542.570) (-542.953) (-541.730) [-545.818] -- 0:00:45
      63000 -- [-544.830] (-545.930) (-540.965) (-545.863) * (-547.273) [-542.519] (-543.083) (-541.315) -- 0:00:44
      63500 -- (-543.419) (-540.955) [-543.249] (-542.201) * [-544.885] (-541.254) (-541.771) (-543.433) -- 0:00:44
      64000 -- [-543.914] (-541.148) (-542.926) (-541.258) * [-547.644] (-542.095) (-542.560) (-543.406) -- 0:00:43
      64500 -- [-542.562] (-540.708) (-543.764) (-540.903) * [-543.786] (-543.596) (-543.063) (-542.151) -- 0:00:43
      65000 -- [-540.635] (-543.142) (-543.208) (-541.059) * [-541.256] (-544.963) (-547.232) (-543.172) -- 0:00:43

      Average standard deviation of split frequencies: 0.028230

      65500 -- (-542.278) (-544.602) [-542.212] (-541.872) * [-541.270] (-543.269) (-541.607) (-540.955) -- 0:00:42
      66000 -- [-541.631] (-545.084) (-542.433) (-541.630) * [-541.553] (-545.086) (-542.092) (-542.885) -- 0:00:42
      66500 -- (-540.927) (-545.216) (-541.628) [-544.619] * (-542.572) [-545.466] (-541.149) (-541.411) -- 0:00:42
      67000 -- [-542.397] (-542.848) (-544.295) (-542.525) * (-543.731) (-544.760) (-541.253) [-540.709] -- 0:00:55
      67500 -- (-547.515) (-544.393) (-543.824) [-542.525] * [-547.776] (-544.300) (-542.713) (-542.448) -- 0:00:55
      68000 -- (-544.434) (-544.331) (-542.561) [-540.177] * (-547.176) [-541.145] (-542.799) (-543.173) -- 0:00:54
      68500 -- (-543.753) [-541.637] (-542.841) (-541.457) * [-541.036] (-545.273) (-544.084) (-542.619) -- 0:00:54
      69000 -- (-543.084) [-541.505] (-541.266) (-541.468) * (-541.389) [-542.534] (-545.978) (-541.689) -- 0:00:53
      69500 -- (-542.288) (-541.901) (-541.475) [-541.040] * (-545.193) (-542.105) (-543.988) [-542.265] -- 0:00:53
      70000 -- (-546.349) (-542.650) [-540.765] (-543.458) * [-541.866] (-541.313) (-542.614) (-543.368) -- 0:00:53

      Average standard deviation of split frequencies: 0.025095

      70500 -- [-542.120] (-541.544) (-542.765) (-541.323) * (-541.989) (-543.009) (-541.211) [-541.708] -- 0:00:52
      71000 -- (-541.429) [-540.789] (-547.617) (-542.740) * (-543.683) (-542.063) [-542.170] (-541.319) -- 0:00:52
      71500 -- [-540.912] (-541.371) (-546.549) (-540.605) * [-543.584] (-543.396) (-541.422) (-541.571) -- 0:00:51
      72000 -- (-544.286) (-542.677) [-541.624] (-542.511) * (-543.330) [-546.527] (-542.359) (-544.898) -- 0:00:51
      72500 -- (-541.198) [-542.882] (-542.709) (-541.298) * (-540.674) (-541.019) (-541.771) [-544.312] -- 0:00:51
      73000 -- (-541.352) (-541.360) [-542.675] (-544.700) * (-540.778) [-541.631] (-545.409) (-541.604) -- 0:00:50
      73500 -- (-543.336) (-542.549) (-544.529) [-542.499] * (-542.066) [-542.365] (-541.138) (-545.261) -- 0:00:50
      74000 -- [-542.282] (-541.979) (-543.777) (-543.271) * [-544.760] (-542.205) (-540.799) (-542.464) -- 0:00:50
      74500 -- (-548.901) (-543.407) (-540.867) [-541.165] * (-543.489) [-541.928] (-542.489) (-542.372) -- 0:00:49
      75000 -- (-544.243) [-540.771] (-541.378) (-542.876) * (-542.082) [-543.156] (-544.109) (-541.789) -- 0:00:49

      Average standard deviation of split frequencies: 0.025697

      75500 -- (-544.548) [-544.224] (-541.745) (-543.958) * (-542.689) [-543.331] (-546.685) (-540.333) -- 0:00:48
      76000 -- (-542.717) (-544.253) (-541.017) [-544.367] * (-544.025) (-541.547) [-547.884] (-543.836) -- 0:00:48
      76500 -- (-541.583) (-543.272) [-540.717] (-541.758) * (-542.205) (-545.084) (-544.576) [-540.983] -- 0:00:48
      77000 -- (-544.000) [-542.201] (-542.196) (-546.298) * (-540.917) [-542.390] (-542.167) (-542.294) -- 0:00:47
      77500 -- (-543.781) (-543.326) (-541.451) [-542.650] * (-541.034) (-543.601) [-542.263] (-541.548) -- 0:00:47
      78000 -- (-541.974) (-541.552) [-545.238] (-541.455) * (-540.515) (-540.809) (-541.541) [-540.791] -- 0:00:47
      78500 -- [-541.649] (-541.762) (-545.665) (-541.686) * (-541.341) (-544.063) [-542.482] (-545.598) -- 0:00:46
      79000 -- (-543.064) (-542.978) [-541.819] (-544.091) * [-543.733] (-541.638) (-541.864) (-543.460) -- 0:00:46
      79500 -- (-542.403) (-542.639) (-543.253) [-543.995] * (-543.735) (-541.001) (-542.941) [-541.689] -- 0:00:46
      80000 -- (-544.673) (-542.412) (-541.289) [-541.371] * [-541.786] (-540.375) (-541.666) (-541.469) -- 0:00:46

      Average standard deviation of split frequencies: 0.025713

      80500 -- (-541.466) [-540.737] (-543.654) (-543.294) * [-542.717] (-548.238) (-542.741) (-544.990) -- 0:00:45
      81000 -- [-543.644] (-540.961) (-541.298) (-544.485) * (-542.259) (-542.425) [-541.347] (-542.209) -- 0:00:45
      81500 -- (-542.727) (-540.538) (-542.216) [-542.932] * (-546.375) (-542.146) (-542.249) [-541.348] -- 0:00:45
      82000 -- [-540.862] (-542.892) (-543.734) (-541.079) * (-540.343) (-541.122) [-541.959] (-543.457) -- 0:00:44
      82500 -- (-541.183) (-547.543) [-541.761] (-544.030) * (-541.189) (-543.494) (-544.793) [-542.363] -- 0:00:44
      83000 -- (-542.474) (-540.955) (-543.561) [-548.555] * (-541.726) (-542.908) (-542.451) [-541.149] -- 0:00:44
      83500 -- (-543.510) [-541.975] (-541.121) (-546.001) * (-543.490) (-545.033) [-541.008] (-540.598) -- 0:00:43
      84000 -- (-543.091) (-540.468) [-543.968] (-543.186) * (-541.834) [-540.383] (-541.686) (-543.410) -- 0:00:43
      84500 -- (-547.538) [-540.619] (-541.789) (-544.398) * (-543.383) (-541.109) [-540.331] (-542.118) -- 0:00:54
      85000 -- (-546.187) (-542.594) (-543.013) [-544.967] * (-540.741) (-540.999) [-544.484] (-544.978) -- 0:00:53

      Average standard deviation of split frequencies: 0.022673

      85500 -- [-541.457] (-542.401) (-543.006) (-544.316) * (-543.945) [-540.720] (-541.736) (-542.356) -- 0:00:53
      86000 -- [-541.753] (-545.347) (-542.216) (-542.893) * (-546.966) [-542.469] (-545.428) (-543.630) -- 0:00:53
      86500 -- [-541.873] (-546.082) (-545.562) (-541.781) * [-541.563] (-541.190) (-541.893) (-541.271) -- 0:00:52
      87000 -- (-544.623) (-548.034) [-544.427] (-543.507) * (-541.878) (-542.866) [-543.116] (-541.384) -- 0:00:52
      87500 -- [-542.168] (-543.211) (-545.843) (-541.229) * (-542.285) (-545.474) (-540.894) [-541.859] -- 0:00:52
      88000 -- (-543.319) [-544.080] (-545.708) (-543.826) * (-546.118) (-544.645) [-541.397] (-543.918) -- 0:00:51
      88500 -- (-544.304) [-541.417] (-547.221) (-545.006) * [-545.080] (-541.002) (-546.119) (-541.699) -- 0:00:51
      89000 -- [-544.354] (-542.049) (-542.118) (-542.909) * (-543.511) (-540.911) (-548.325) [-541.200] -- 0:00:51
      89500 -- [-541.716] (-541.325) (-540.934) (-541.631) * (-541.234) (-542.591) [-545.937] (-542.422) -- 0:00:50
      90000 -- (-544.630) (-547.497) (-543.979) [-542.203] * [-540.668] (-544.218) (-542.604) (-543.267) -- 0:00:50

      Average standard deviation of split frequencies: 0.025997

      90500 -- (-546.093) (-542.207) [-544.273] (-541.302) * [-543.704] (-543.515) (-541.458) (-542.350) -- 0:00:50
      91000 -- (-543.725) (-541.702) [-541.556] (-541.329) * (-546.410) (-544.170) (-541.640) [-543.073] -- 0:00:49
      91500 -- (-541.830) (-541.608) [-541.443] (-540.840) * (-550.527) (-542.066) (-541.268) [-540.726] -- 0:00:49
      92000 -- (-545.033) (-543.417) (-541.363) [-541.628] * (-549.657) [-541.207] (-541.581) (-542.956) -- 0:00:49
      92500 -- (-542.448) (-541.283) [-541.800] (-542.541) * [-542.301] (-544.402) (-540.872) (-543.429) -- 0:00:49
      93000 -- [-543.542] (-541.025) (-543.095) (-541.162) * (-542.685) (-541.823) (-541.040) [-543.741] -- 0:00:48
      93500 -- (-541.666) (-543.960) (-541.740) [-541.779] * (-544.711) [-541.284] (-542.908) (-542.429) -- 0:00:48
      94000 -- (-541.092) [-540.626] (-542.675) (-542.653) * [-544.309] (-543.056) (-541.315) (-541.023) -- 0:00:48
      94500 -- [-541.377] (-542.258) (-542.470) (-543.673) * [-540.872] (-543.540) (-542.417) (-544.354) -- 0:00:47
      95000 -- (-543.570) (-543.489) (-543.642) [-544.969] * [-543.934] (-546.100) (-543.848) (-542.735) -- 0:00:47

      Average standard deviation of split frequencies: 0.025955

      95500 -- (-540.950) [-542.432] (-542.470) (-544.463) * (-544.495) (-542.876) [-544.733] (-541.977) -- 0:00:47
      96000 -- (-546.479) (-541.790) (-544.083) [-542.469] * (-545.767) (-541.036) (-543.645) [-544.599] -- 0:00:47
      96500 -- (-545.130) [-541.649] (-543.436) (-542.683) * [-543.999] (-541.821) (-543.617) (-545.497) -- 0:00:46
      97000 -- (-544.484) (-542.796) (-541.521) [-547.979] * [-543.010] (-544.157) (-545.326) (-543.146) -- 0:00:46
      97500 -- [-541.705] (-544.561) (-542.387) (-544.856) * (-544.062) (-542.473) [-541.569] (-544.831) -- 0:00:46
      98000 -- (-542.632) (-541.755) (-544.402) [-544.394] * [-540.535] (-543.764) (-541.976) (-541.051) -- 0:00:46
      98500 -- (-542.164) (-542.115) [-542.633] (-543.177) * (-541.331) (-541.517) (-541.393) [-540.365] -- 0:00:45
      99000 -- [-545.504] (-543.525) (-541.839) (-543.459) * (-544.046) (-542.898) (-540.996) [-540.973] -- 0:00:45
      99500 -- (-541.484) (-541.967) [-544.735] (-543.454) * [-541.309] (-549.286) (-542.356) (-543.569) -- 0:00:45
      100000 -- (-543.172) (-543.875) [-543.343] (-547.020) * (-540.266) [-543.710] (-541.108) (-541.704) -- 0:00:45

      Average standard deviation of split frequencies: 0.025756

      100500 -- (-543.423) (-541.628) [-545.204] (-540.483) * (-542.023) [-540.368] (-541.572) (-542.742) -- 0:00:44
      101000 -- [-541.392] (-542.532) (-543.418) (-541.712) * (-542.557) [-540.855] (-542.408) (-542.328) -- 0:00:44
      101500 -- [-543.059] (-540.981) (-544.457) (-542.542) * [-541.551] (-543.534) (-543.193) (-541.498) -- 0:00:53
      102000 -- (-543.088) [-541.413] (-545.314) (-541.946) * (-542.204) [-541.049] (-542.551) (-540.885) -- 0:00:52
      102500 -- (-540.788) [-545.373] (-541.856) (-546.111) * (-543.384) (-541.065) [-540.668] (-542.430) -- 0:00:52
      103000 -- (-542.298) (-543.689) [-541.959] (-543.668) * (-541.923) (-545.274) (-545.232) [-542.444] -- 0:00:52
      103500 -- (-542.722) (-543.627) (-541.517) [-541.377] * (-541.675) (-543.372) (-545.610) [-541.004] -- 0:00:51
      104000 -- (-542.089) (-542.069) (-543.294) [-544.230] * (-544.356) (-542.747) (-545.526) [-544.819] -- 0:00:51
      104500 -- [-542.531] (-541.996) (-541.834) (-544.075) * (-543.679) (-541.808) (-543.342) [-541.074] -- 0:00:51
      105000 -- [-540.969] (-542.191) (-543.669) (-544.075) * (-542.651) (-542.239) [-542.027] (-542.831) -- 0:00:51

      Average standard deviation of split frequencies: 0.025470

      105500 -- (-542.257) [-541.291] (-546.963) (-543.135) * (-544.204) (-542.457) (-542.121) [-542.698] -- 0:00:50
      106000 -- [-544.251] (-541.209) (-543.940) (-541.628) * (-543.260) (-542.300) (-544.244) [-545.335] -- 0:00:50
      106500 -- (-541.529) (-541.591) [-544.637] (-541.649) * (-542.728) (-543.834) (-543.727) [-541.651] -- 0:00:50
      107000 -- (-542.502) (-541.945) (-542.677) [-541.611] * [-541.435] (-544.865) (-542.656) (-541.532) -- 0:00:50
      107500 -- (-542.499) [-545.539] (-541.299) (-542.003) * (-544.743) (-541.472) (-542.274) [-542.168] -- 0:00:49
      108000 -- [-541.089] (-546.584) (-542.724) (-541.634) * (-545.175) (-540.862) [-541.617] (-541.919) -- 0:00:49
      108500 -- (-540.854) (-544.342) (-541.842) [-542.674] * (-541.334) (-540.467) [-541.333] (-542.044) -- 0:00:49
      109000 -- (-545.806) [-542.394] (-541.576) (-544.485) * (-541.580) [-540.898] (-543.027) (-543.621) -- 0:00:49
      109500 -- (-542.146) (-541.379) [-541.504] (-542.593) * (-543.875) [-542.124] (-543.530) (-543.102) -- 0:00:48
      110000 -- [-541.285] (-541.147) (-545.299) (-541.787) * (-540.428) [-548.097] (-547.832) (-543.319) -- 0:00:48

      Average standard deviation of split frequencies: 0.025345

      110500 -- (-541.817) [-543.682] (-544.090) (-540.782) * (-545.044) (-543.953) [-545.460] (-542.467) -- 0:00:48
      111000 -- (-541.039) (-541.973) (-541.455) [-541.916] * (-541.694) [-541.711] (-544.014) (-541.953) -- 0:00:48
      111500 -- [-540.405] (-542.749) (-541.641) (-543.286) * (-541.574) (-545.453) (-543.350) [-540.436] -- 0:00:47
      112000 -- [-543.586] (-541.875) (-543.625) (-542.947) * (-545.837) [-543.813] (-544.859) (-541.898) -- 0:00:47
      112500 -- (-541.430) (-540.481) [-545.828] (-544.656) * (-543.475) (-541.967) [-544.729] (-542.283) -- 0:00:47
      113000 -- [-543.504] (-541.258) (-542.579) (-545.596) * (-541.774) (-544.257) [-541.660] (-551.023) -- 0:00:47
      113500 -- [-545.383] (-542.345) (-541.486) (-542.847) * (-541.068) (-542.773) (-541.151) [-543.750] -- 0:00:46
      114000 -- (-544.680) [-541.091] (-545.794) (-540.651) * [-541.292] (-541.177) (-540.655) (-541.696) -- 0:00:46
      114500 -- (-541.369) (-541.840) [-541.740] (-543.036) * (-544.446) (-544.250) [-542.998] (-543.043) -- 0:00:46
      115000 -- (-545.091) [-540.543] (-542.226) (-544.864) * (-541.167) [-541.926] (-543.166) (-542.710) -- 0:00:46

      Average standard deviation of split frequencies: 0.022458

      115500 -- (-543.140) (-541.512) [-543.882] (-545.116) * (-540.968) (-549.497) [-542.972] (-541.312) -- 0:00:45
      116000 -- [-543.125] (-544.326) (-542.404) (-542.157) * (-542.347) [-540.956] (-544.085) (-541.219) -- 0:00:45
      116500 -- (-544.968) [-541.801] (-541.540) (-544.762) * (-543.379) (-540.629) [-543.165] (-544.924) -- 0:00:45
      117000 -- (-543.228) (-547.525) (-542.148) [-544.014] * [-543.568] (-540.792) (-544.892) (-540.587) -- 0:00:45
      117500 -- (-543.253) (-542.528) (-541.240) [-543.252] * (-543.752) (-540.557) [-540.492] (-544.220) -- 0:00:45
      118000 -- (-545.487) (-542.989) (-541.401) [-543.266] * (-542.410) (-545.941) (-540.970) [-542.279] -- 0:00:44
      118500 -- (-541.015) (-543.155) (-541.323) [-545.189] * (-542.210) [-543.096] (-542.274) (-541.618) -- 0:00:44
      119000 -- [-543.558] (-543.815) (-542.520) (-541.119) * (-540.160) [-543.334] (-541.568) (-541.428) -- 0:00:51
      119500 -- [-541.805] (-541.988) (-543.974) (-545.337) * (-545.212) (-543.188) (-543.484) [-540.707] -- 0:00:51
      120000 -- [-544.150] (-542.198) (-543.982) (-543.458) * (-544.728) (-541.293) (-541.196) [-545.084] -- 0:00:51

      Average standard deviation of split frequencies: 0.023223

      120500 -- (-540.913) (-541.470) (-541.625) [-544.611] * (-543.981) [-541.844] (-541.297) (-541.861) -- 0:00:51
      121000 -- [-542.788] (-541.980) (-543.850) (-543.684) * (-545.440) (-545.401) (-540.946) [-540.517] -- 0:00:50
      121500 -- [-546.835] (-544.512) (-543.775) (-541.415) * [-543.154] (-544.004) (-544.236) (-543.364) -- 0:00:50
      122000 -- (-546.526) (-547.777) [-548.355] (-544.194) * [-541.731] (-545.569) (-544.004) (-544.485) -- 0:00:50
      122500 -- (-543.043) [-541.822] (-553.463) (-542.606) * (-546.212) (-545.777) (-544.260) [-541.655] -- 0:00:50
      123000 -- [-540.550] (-547.229) (-546.079) (-542.254) * [-544.050] (-542.585) (-542.170) (-543.445) -- 0:00:49
      123500 -- (-543.654) (-545.568) [-540.775] (-540.959) * (-545.406) [-543.684] (-540.747) (-542.348) -- 0:00:49
      124000 -- (-545.350) (-542.649) (-544.137) [-542.867] * (-542.733) (-541.494) (-541.597) [-543.544] -- 0:00:49
      124500 -- (-542.500) (-541.218) [-540.959] (-542.967) * (-544.012) (-541.709) (-543.828) [-540.773] -- 0:00:49
      125000 -- (-542.087) [-541.306] (-543.411) (-542.070) * (-542.140) (-543.276) (-546.058) [-540.569] -- 0:00:49

      Average standard deviation of split frequencies: 0.019297

      125500 -- [-541.140] (-541.841) (-543.047) (-542.664) * [-540.912] (-542.315) (-541.064) (-541.507) -- 0:00:48
      126000 -- [-541.882] (-544.048) (-543.525) (-541.979) * [-540.436] (-542.449) (-540.608) (-542.658) -- 0:00:48
      126500 -- [-540.403] (-542.331) (-543.350) (-543.704) * (-541.642) (-546.495) [-540.747] (-542.987) -- 0:00:48
      127000 -- [-541.542] (-541.911) (-542.686) (-541.892) * [-542.029] (-547.466) (-540.621) (-543.644) -- 0:00:48
      127500 -- (-543.760) [-540.847] (-545.678) (-542.654) * (-545.377) [-541.684] (-542.681) (-543.717) -- 0:00:47
      128000 -- (-542.632) [-541.501] (-551.269) (-542.458) * [-546.868] (-541.051) (-542.566) (-543.317) -- 0:00:47
      128500 -- (-547.634) (-540.928) (-541.783) [-540.747] * (-543.371) [-541.139] (-548.980) (-543.749) -- 0:00:47
      129000 -- (-541.863) (-541.847) (-545.134) [-541.848] * [-541.856] (-541.562) (-548.088) (-544.719) -- 0:00:47
      129500 -- (-542.916) (-542.161) (-541.042) [-543.981] * [-544.915] (-542.385) (-546.388) (-542.680) -- 0:00:47
      130000 -- (-541.205) (-543.860) [-542.349] (-545.356) * [-544.133] (-546.421) (-544.826) (-543.458) -- 0:00:46

      Average standard deviation of split frequencies: 0.020127

      130500 -- (-544.138) [-545.093] (-541.060) (-540.779) * (-541.838) [-543.152] (-545.855) (-544.779) -- 0:00:46
      131000 -- [-541.612] (-541.621) (-540.649) (-545.697) * (-542.920) [-542.832] (-550.553) (-549.472) -- 0:00:46
      131500 -- (-541.806) (-542.749) (-543.192) [-545.132] * (-545.031) (-544.155) (-546.164) [-543.015] -- 0:00:46
      132000 -- [-540.844] (-543.401) (-542.690) (-545.089) * (-543.574) (-541.880) (-543.156) [-541.690] -- 0:00:46
      132500 -- (-543.726) (-543.341) (-542.585) [-542.805] * [-542.646] (-543.409) (-544.510) (-547.813) -- 0:00:45
      133000 -- (-544.902) [-543.157] (-541.380) (-541.616) * (-542.823) (-542.582) (-544.146) [-544.195] -- 0:00:45
      133500 -- [-543.023] (-545.220) (-542.269) (-541.676) * [-540.492] (-544.451) (-543.100) (-542.509) -- 0:00:45
      134000 -- (-542.733) [-541.759] (-544.149) (-543.720) * [-541.322] (-541.252) (-541.674) (-544.799) -- 0:00:45
      134500 -- (-542.100) (-542.804) (-541.648) [-541.411] * (-541.354) [-541.071] (-541.722) (-544.859) -- 0:00:45
      135000 -- (-540.990) [-541.701] (-542.551) (-541.926) * [-540.803] (-542.245) (-542.902) (-545.743) -- 0:00:44

      Average standard deviation of split frequencies: 0.018973

      135500 -- (-541.946) (-542.450) [-542.932] (-545.503) * [-542.366] (-541.520) (-543.680) (-542.998) -- 0:00:51
      136000 -- [-542.732] (-541.265) (-542.127) (-541.501) * [-541.110] (-541.459) (-544.833) (-542.550) -- 0:00:50
      136500 -- [-544.129] (-542.118) (-541.816) (-545.763) * (-542.602) [-543.718] (-543.740) (-542.924) -- 0:00:50
      137000 -- (-540.950) (-540.544) (-543.614) [-542.507] * [-542.872] (-542.967) (-548.825) (-540.492) -- 0:00:50
      137500 -- (-542.896) (-542.174) (-544.609) [-542.618] * (-540.734) (-544.210) (-543.600) [-540.976] -- 0:00:50
      138000 -- (-541.980) (-542.222) [-544.297] (-541.319) * (-540.962) [-543.519] (-540.646) (-544.894) -- 0:00:49
      138500 -- (-544.645) (-543.379) (-543.628) [-541.141] * (-540.954) (-541.975) (-541.981) [-543.474] -- 0:00:49
      139000 -- (-548.906) (-543.812) [-543.404] (-545.204) * [-541.467] (-545.535) (-544.138) (-542.902) -- 0:00:49
      139500 -- [-545.787] (-541.178) (-542.183) (-545.546) * (-543.052) (-543.147) (-546.641) [-540.205] -- 0:00:49
      140000 -- [-543.160] (-542.630) (-541.505) (-544.266) * (-540.980) (-541.640) (-546.624) [-546.822] -- 0:00:49

      Average standard deviation of split frequencies: 0.018520

      140500 -- (-546.238) (-545.263) (-543.163) [-543.552] * (-543.618) [-540.528] (-543.529) (-545.099) -- 0:00:48
      141000 -- (-543.843) (-544.404) (-542.056) [-541.070] * (-546.370) (-542.092) [-542.527] (-540.868) -- 0:00:48
      141500 -- (-541.668) (-544.035) [-540.690] (-541.562) * (-540.593) [-541.452] (-545.009) (-541.947) -- 0:00:48
      142000 -- (-544.073) (-543.431) [-544.876] (-542.948) * (-541.889) (-545.265) [-543.438] (-543.872) -- 0:00:48
      142500 -- (-541.975) (-541.875) [-541.348] (-541.234) * (-541.698) (-541.559) (-542.372) [-541.992] -- 0:00:48
      143000 -- (-540.868) (-544.087) (-541.073) [-546.125] * (-544.560) (-540.776) (-541.764) [-542.358] -- 0:00:47
      143500 -- (-543.217) (-545.444) [-544.124] (-549.509) * (-542.701) [-541.681] (-543.880) (-543.934) -- 0:00:47
      144000 -- (-541.521) (-541.077) (-542.569) [-544.015] * (-542.940) (-545.177) [-542.135] (-544.534) -- 0:00:47
      144500 -- (-542.475) [-541.835] (-542.342) (-543.363) * (-543.060) (-541.508) [-542.170] (-542.730) -- 0:00:47
      145000 -- (-543.308) [-541.473] (-543.146) (-543.327) * (-541.802) [-545.238] (-542.508) (-542.582) -- 0:00:47

      Average standard deviation of split frequencies: 0.020503

      145500 -- (-541.208) (-543.296) (-541.647) [-542.129] * [-541.690] (-543.565) (-541.941) (-541.785) -- 0:00:46
      146000 -- (-541.527) [-543.379] (-543.086) (-544.137) * (-543.580) (-542.146) (-546.273) [-545.106] -- 0:00:46
      146500 -- [-541.849] (-543.016) (-542.863) (-544.155) * (-546.187) [-541.435] (-542.879) (-542.973) -- 0:00:46
      147000 -- (-540.378) (-544.975) (-542.420) [-543.881] * (-544.777) [-541.119] (-546.125) (-543.709) -- 0:00:46
      147500 -- [-540.807] (-541.181) (-543.454) (-541.357) * (-545.376) [-540.750] (-545.318) (-543.193) -- 0:00:46
      148000 -- (-545.293) [-540.941] (-544.713) (-544.918) * (-544.924) (-542.622) [-544.119] (-542.811) -- 0:00:46
      148500 -- [-542.100] (-542.627) (-547.570) (-541.728) * (-541.889) (-540.522) [-543.091] (-543.888) -- 0:00:45
      149000 -- (-541.461) (-542.944) (-541.427) [-543.747] * [-542.843] (-541.652) (-543.812) (-541.063) -- 0:00:45
      149500 -- (-543.389) [-542.757] (-542.811) (-542.638) * (-540.705) (-543.360) [-542.173] (-544.477) -- 0:00:45
      150000 -- (-541.693) (-542.965) (-540.377) [-543.487] * [-546.093] (-540.873) (-546.602) (-543.207) -- 0:00:45

      Average standard deviation of split frequencies: 0.016467

      150500 -- (-544.992) (-541.943) (-544.488) [-541.447] * (-542.433) (-543.503) [-543.610] (-540.824) -- 0:00:45
      151000 -- (-546.372) [-541.509] (-546.250) (-542.193) * (-542.139) (-544.806) (-544.501) [-543.371] -- 0:00:44
      151500 -- (-544.158) (-542.822) (-544.478) [-541.165] * (-544.207) (-545.619) [-544.343] (-541.021) -- 0:00:44
      152000 -- (-540.723) [-543.240] (-544.893) (-543.369) * [-541.688] (-542.430) (-542.763) (-544.234) -- 0:00:44
      152500 -- (-541.868) [-542.105] (-544.203) (-544.942) * (-542.762) [-540.995] (-540.634) (-541.777) -- 0:00:50
      153000 -- [-541.560] (-541.788) (-542.112) (-542.300) * (-540.937) [-544.716] (-542.466) (-540.640) -- 0:00:49
      153500 -- (-544.044) (-542.307) (-542.623) [-541.064] * (-541.854) [-542.704] (-541.788) (-543.179) -- 0:00:49
      154000 -- (-542.739) (-545.127) [-543.303] (-546.368) * (-542.429) (-541.697) [-543.178] (-542.412) -- 0:00:49
      154500 -- (-544.188) [-541.892] (-544.342) (-544.121) * (-540.920) [-540.309] (-544.318) (-541.445) -- 0:00:49
      155000 -- (-544.259) (-544.827) (-543.062) [-542.621] * (-541.506) (-541.190) (-544.563) [-543.081] -- 0:00:49

      Average standard deviation of split frequencies: 0.015904

      155500 -- (-542.040) (-543.523) (-542.142) [-543.343] * (-544.081) [-541.126] (-541.369) (-540.876) -- 0:00:48
      156000 -- (-542.774) [-543.926] (-542.887) (-545.215) * (-541.235) (-548.189) [-546.179] (-541.078) -- 0:00:48
      156500 -- (-544.534) (-542.732) [-542.502] (-543.322) * [-544.370] (-542.266) (-542.090) (-541.177) -- 0:00:48
      157000 -- (-547.531) [-543.806] (-545.019) (-541.542) * (-542.672) (-544.742) (-543.610) [-540.957] -- 0:00:48
      157500 -- (-545.501) (-541.626) [-549.845] (-541.952) * (-545.504) (-542.324) [-545.236] (-543.087) -- 0:00:48
      158000 -- (-542.189) [-542.954] (-543.231) (-541.196) * (-544.321) (-540.539) [-540.254] (-545.245) -- 0:00:47
      158500 -- (-541.165) (-544.551) [-543.333] (-541.700) * (-541.782) (-548.419) (-542.755) [-542.209] -- 0:00:47
      159000 -- (-540.550) (-543.175) [-541.091] (-541.792) * (-542.442) (-542.223) (-545.094) [-543.119] -- 0:00:47
      159500 -- [-540.408] (-544.127) (-542.994) (-541.740) * [-542.537] (-542.648) (-540.551) (-545.969) -- 0:00:47
      160000 -- (-544.275) (-541.895) (-543.857) [-541.765] * (-543.685) (-542.456) (-543.280) [-543.085] -- 0:00:47

      Average standard deviation of split frequencies: 0.016369

      160500 -- (-541.162) (-541.225) [-541.856] (-545.338) * (-542.891) (-542.665) (-543.850) [-544.950] -- 0:00:47
      161000 -- (-542.248) [-540.788] (-545.838) (-545.004) * [-541.714] (-546.258) (-545.193) (-541.182) -- 0:00:46
      161500 -- [-543.269] (-544.030) (-541.488) (-543.639) * (-541.068) (-544.675) (-542.114) [-542.353] -- 0:00:46
      162000 -- (-545.241) (-543.931) (-541.112) [-542.833] * [-542.361] (-547.241) (-542.709) (-542.103) -- 0:00:46
      162500 -- [-542.482] (-542.498) (-541.739) (-543.840) * (-543.360) (-541.369) [-542.939] (-541.929) -- 0:00:46
      163000 -- (-542.274) (-542.762) (-541.946) [-542.259] * (-542.171) [-542.416] (-543.445) (-541.689) -- 0:00:46
      163500 -- [-544.878] (-542.367) (-542.791) (-542.186) * (-541.588) (-544.282) [-542.152] (-542.229) -- 0:00:46
      164000 -- [-541.211] (-543.806) (-543.811) (-542.233) * (-543.945) (-546.513) (-543.745) [-540.839] -- 0:00:45
      164500 -- [-541.335] (-547.582) (-542.352) (-544.742) * (-541.537) (-542.737) (-542.130) [-541.803] -- 0:00:45
      165000 -- (-543.730) [-541.972] (-543.176) (-546.647) * (-546.028) (-542.867) (-543.730) [-542.629] -- 0:00:45

      Average standard deviation of split frequencies: 0.015843

      165500 -- (-541.907) (-542.298) [-541.210] (-546.405) * [-542.008] (-541.755) (-541.587) (-541.522) -- 0:00:45
      166000 -- (-541.902) [-545.895] (-541.557) (-544.028) * [-542.260] (-541.280) (-541.050) (-542.121) -- 0:00:45
      166500 -- (-543.234) [-547.029] (-540.671) (-544.271) * (-542.464) [-541.396] (-542.228) (-541.244) -- 0:00:45
      167000 -- [-544.362] (-542.819) (-542.162) (-544.741) * (-546.840) [-542.095] (-543.909) (-541.426) -- 0:00:44
      167500 -- (-541.223) (-547.147) (-542.443) [-544.814] * (-541.532) [-541.531] (-541.347) (-542.470) -- 0:00:44
      168000 -- (-543.249) (-544.082) [-542.360] (-543.701) * (-543.408) [-541.774] (-544.053) (-543.917) -- 0:00:44
      168500 -- (-545.690) [-543.590] (-540.630) (-544.914) * (-543.975) (-542.393) (-543.058) [-543.032] -- 0:00:44
      169000 -- [-541.816] (-541.036) (-542.641) (-544.382) * (-541.185) [-540.556] (-542.061) (-541.750) -- 0:00:44
      169500 -- [-544.042] (-543.039) (-546.568) (-544.500) * (-542.347) [-540.865] (-544.616) (-542.785) -- 0:00:44
      170000 -- (-545.024) [-543.152] (-546.417) (-543.835) * (-542.317) (-540.553) (-540.814) [-542.637] -- 0:00:48

      Average standard deviation of split frequencies: 0.015555

      170500 -- (-543.587) (-541.295) [-544.372] (-543.391) * (-542.007) [-542.759] (-541.870) (-541.080) -- 0:00:48
      171000 -- (-544.218) [-541.178] (-545.292) (-542.505) * (-542.845) (-542.535) [-541.321] (-541.890) -- 0:00:48
      171500 -- (-544.786) (-542.467) (-543.912) [-543.451] * (-541.812) (-545.920) [-540.351] (-547.468) -- 0:00:48
      172000 -- (-543.045) (-542.058) (-544.613) [-541.899] * (-542.986) (-541.702) (-542.233) [-545.355] -- 0:00:48
      172500 -- (-542.655) (-541.338) [-543.923] (-540.269) * (-543.886) (-541.890) [-541.124] (-540.967) -- 0:00:47
      173000 -- (-545.177) (-542.474) (-543.792) [-542.848] * (-546.067) (-541.539) (-541.341) [-542.115] -- 0:00:47
      173500 -- [-544.977] (-542.895) (-541.417) (-540.796) * (-545.544) (-541.910) [-543.949] (-543.781) -- 0:00:47
      174000 -- (-543.682) (-542.510) [-542.665] (-540.995) * [-543.118] (-541.872) (-543.611) (-540.355) -- 0:00:47
      174500 -- (-545.102) (-544.675) (-544.124) [-542.812] * (-541.384) (-550.608) [-540.655] (-540.778) -- 0:00:47
      175000 -- (-542.633) [-546.896] (-544.157) (-546.716) * (-540.923) (-545.075) (-540.747) [-542.290] -- 0:00:47

      Average standard deviation of split frequencies: 0.016071

      175500 -- (-541.762) [-545.025] (-545.620) (-546.739) * [-541.000] (-542.420) (-544.287) (-540.897) -- 0:00:46
      176000 -- [-541.053] (-543.613) (-543.463) (-542.092) * (-542.618) [-540.784] (-542.629) (-541.146) -- 0:00:46
      176500 -- (-544.026) (-543.541) [-541.534] (-541.115) * (-542.445) (-542.064) (-541.759) [-543.046] -- 0:00:46
      177000 -- (-544.448) [-551.704] (-543.129) (-542.620) * (-543.863) (-542.532) (-542.925) [-542.389] -- 0:00:46
      177500 -- (-545.393) (-542.954) (-543.815) [-544.649] * [-540.635] (-542.674) (-542.698) (-545.315) -- 0:00:46
      178000 -- (-543.097) [-540.860] (-547.541) (-544.444) * [-540.843] (-544.204) (-541.207) (-543.835) -- 0:00:46
      178500 -- (-541.919) (-540.919) (-549.600) [-541.830] * [-540.831] (-545.776) (-540.940) (-554.693) -- 0:00:46
      179000 -- (-541.310) (-541.197) (-547.727) [-546.103] * (-540.275) (-546.157) [-542.268] (-548.754) -- 0:00:45
      179500 -- (-545.220) [-542.262] (-546.559) (-541.759) * (-543.284) (-543.984) [-542.215] (-542.931) -- 0:00:45
      180000 -- (-542.357) [-545.440] (-543.104) (-541.954) * (-542.768) (-541.556) (-542.432) [-543.365] -- 0:00:45

      Average standard deviation of split frequencies: 0.016960

      180500 -- [-542.969] (-544.395) (-543.794) (-541.305) * (-544.360) (-543.807) [-541.990] (-542.511) -- 0:00:45
      181000 -- (-542.411) (-544.034) [-543.205] (-540.967) * (-541.303) [-540.960] (-541.080) (-543.037) -- 0:00:45
      181500 -- (-541.955) (-541.566) (-542.164) [-543.109] * (-542.851) (-544.560) [-540.831] (-540.930) -- 0:00:45
      182000 -- (-541.373) (-543.043) [-541.683] (-542.540) * (-544.989) (-545.830) [-541.268] (-544.061) -- 0:00:44
      182500 -- (-540.212) (-544.339) (-542.940) [-542.075] * (-543.591) [-542.023] (-545.704) (-540.810) -- 0:00:44
      183000 -- (-545.576) [-541.197] (-543.879) (-542.735) * (-540.382) (-541.863) (-541.411) [-540.756] -- 0:00:44
      183500 -- (-541.305) [-540.420] (-542.265) (-543.085) * (-542.123) [-543.557] (-544.108) (-542.361) -- 0:00:44
      184000 -- [-540.878] (-548.674) (-543.607) (-544.129) * [-541.257] (-542.510) (-541.651) (-541.471) -- 0:00:44
      184500 -- (-540.634) [-543.506] (-541.444) (-541.190) * (-541.902) [-542.326] (-544.316) (-544.102) -- 0:00:44
      185000 -- (-541.943) (-543.352) (-542.127) [-541.265] * (-542.947) (-540.685) [-541.567] (-544.091) -- 0:00:44

      Average standard deviation of split frequencies: 0.017207

      185500 -- (-542.980) [-542.131] (-545.548) (-541.178) * (-542.088) [-541.119] (-542.704) (-540.942) -- 0:00:43
      186000 -- [-541.328] (-542.663) (-542.780) (-542.650) * (-544.757) (-541.377) [-541.291] (-542.263) -- 0:00:43
      186500 -- [-541.690] (-542.204) (-543.725) (-542.267) * (-544.587) (-548.019) [-542.228] (-542.131) -- 0:00:43
      187000 -- [-541.453] (-542.468) (-542.548) (-544.156) * (-543.509) (-541.514) [-541.938] (-545.188) -- 0:00:47
      187500 -- (-540.949) [-541.736] (-543.432) (-541.924) * (-544.973) (-547.312) [-541.234] (-543.065) -- 0:00:47
      188000 -- (-543.468) [-540.762] (-543.348) (-543.861) * (-542.610) (-547.334) [-540.658] (-543.739) -- 0:00:47
      188500 -- [-541.112] (-541.414) (-542.025) (-541.940) * (-541.939) (-550.490) [-541.281] (-545.801) -- 0:00:47
      189000 -- (-540.258) [-541.625] (-543.374) (-543.937) * (-544.137) (-541.871) [-543.492] (-541.744) -- 0:00:47
      189500 -- (-541.650) [-541.324] (-541.975) (-541.351) * [-545.604] (-541.087) (-544.583) (-542.313) -- 0:00:47
      190000 -- [-541.430] (-541.407) (-542.952) (-540.713) * (-543.839) (-541.655) (-544.389) [-543.242] -- 0:00:46

      Average standard deviation of split frequencies: 0.018268

      190500 -- [-541.496] (-544.031) (-542.225) (-542.318) * [-549.294] (-543.362) (-545.777) (-541.068) -- 0:00:46
      191000 -- (-542.891) [-543.306] (-543.470) (-543.421) * (-549.181) (-543.656) [-544.358] (-540.733) -- 0:00:46
      191500 -- [-544.250] (-543.603) (-546.407) (-541.883) * (-543.158) [-542.895] (-544.260) (-540.689) -- 0:00:46
      192000 -- (-542.260) (-541.700) [-541.106] (-542.556) * (-540.517) (-542.855) [-542.211] (-542.865) -- 0:00:46
      192500 -- [-541.704] (-542.914) (-541.101) (-541.419) * [-541.160] (-544.234) (-541.531) (-541.366) -- 0:00:46
      193000 -- [-541.670] (-544.163) (-547.047) (-543.070) * (-542.764) (-546.233) [-544.403] (-541.114) -- 0:00:45
      193500 -- (-541.818) (-542.734) (-544.052) [-542.810] * (-541.874) (-545.522) [-544.258] (-541.830) -- 0:00:45
      194000 -- (-542.476) (-545.314) (-543.829) [-541.977] * [-540.871] (-542.847) (-542.933) (-544.776) -- 0:00:45
      194500 -- (-543.252) (-542.657) [-542.660] (-542.703) * [-540.869] (-542.087) (-546.459) (-542.721) -- 0:00:45
      195000 -- (-543.075) (-543.746) (-541.560) [-541.937] * [-541.309] (-540.734) (-543.138) (-541.351) -- 0:00:45

      Average standard deviation of split frequencies: 0.018840

      195500 -- (-541.495) (-546.016) [-541.002] (-541.846) * [-541.330] (-543.828) (-547.332) (-544.839) -- 0:00:45
      196000 -- (-543.682) (-544.080) [-542.923] (-545.652) * [-542.296] (-544.802) (-543.334) (-541.181) -- 0:00:45
      196500 -- (-547.731) (-542.752) [-541.576] (-540.577) * [-543.922] (-544.934) (-543.892) (-545.654) -- 0:00:44
      197000 -- (-542.681) [-541.205] (-541.205) (-542.148) * [-543.095] (-542.082) (-547.835) (-540.682) -- 0:00:44
      197500 -- (-541.775) (-545.705) [-541.064] (-543.142) * [-545.743] (-541.744) (-540.562) (-541.921) -- 0:00:44
      198000 -- (-546.074) (-541.581) (-543.950) [-543.800] * [-540.725] (-541.220) (-545.046) (-540.788) -- 0:00:44
      198500 -- [-542.482] (-542.754) (-541.581) (-544.571) * (-541.148) [-542.014] (-542.436) (-542.339) -- 0:00:44
      199000 -- [-542.070] (-542.601) (-544.285) (-544.303) * [-541.052] (-541.755) (-540.533) (-542.207) -- 0:00:44
      199500 -- (-547.394) [-543.209] (-546.871) (-541.123) * (-540.241) (-542.926) (-542.050) [-540.947] -- 0:00:44
      200000 -- (-544.909) (-540.498) (-541.721) [-541.234] * [-540.904] (-542.526) (-542.335) (-542.906) -- 0:00:44

      Average standard deviation of split frequencies: 0.017227

      200500 -- (-541.064) (-543.560) [-542.899] (-543.167) * [-541.426] (-544.632) (-544.294) (-544.432) -- 0:00:43
      201000 -- (-543.174) (-540.547) [-545.376] (-541.832) * (-545.177) (-541.214) (-548.365) [-541.220] -- 0:00:43
      201500 -- (-542.220) [-540.697] (-543.375) (-540.689) * (-545.372) (-545.481) [-543.823] (-541.760) -- 0:00:43
      202000 -- [-543.079] (-543.059) (-541.248) (-543.676) * (-542.849) [-545.873] (-540.560) (-542.274) -- 0:00:43
      202500 -- [-545.350] (-546.468) (-542.794) (-541.380) * [-542.031] (-547.968) (-549.559) (-540.898) -- 0:00:43
      203000 -- (-545.213) (-544.073) [-541.094] (-541.465) * [-541.845] (-544.274) (-545.985) (-543.614) -- 0:00:43
      203500 -- (-544.121) (-542.804) (-542.994) [-540.930] * (-542.915) (-541.543) [-542.574] (-544.731) -- 0:00:43
      204000 -- (-540.552) (-544.637) (-543.335) [-543.272] * (-543.064) (-547.025) (-541.816) [-540.527] -- 0:00:46
      204500 -- (-543.779) (-543.467) (-542.094) [-542.584] * (-545.681) (-543.404) [-546.654] (-544.742) -- 0:00:46
      205000 -- (-542.068) [-543.649] (-540.715) (-541.226) * (-541.264) (-542.625) (-541.090) [-540.244] -- 0:00:46

      Average standard deviation of split frequencies: 0.018576

      205500 -- (-541.302) [-541.416] (-545.944) (-541.910) * (-546.613) (-543.019) (-542.801) [-542.464] -- 0:00:46
      206000 -- [-540.794] (-544.597) (-546.010) (-540.972) * (-548.796) (-540.652) (-542.418) [-540.898] -- 0:00:46
      206500 -- [-541.193] (-543.407) (-544.272) (-541.432) * (-543.011) (-542.291) [-542.146] (-541.067) -- 0:00:46
      207000 -- (-543.975) (-540.850) (-543.160) [-542.504] * (-544.079) (-542.460) [-544.150] (-543.333) -- 0:00:45
      207500 -- [-543.004] (-541.319) (-541.557) (-543.266) * [-543.927] (-543.635) (-543.485) (-542.257) -- 0:00:45
      208000 -- (-544.065) (-542.530) (-542.658) [-542.414] * (-545.848) [-542.399] (-541.291) (-542.262) -- 0:00:45
      208500 -- (-541.406) (-544.709) [-542.354] (-543.530) * (-543.017) (-545.025) (-541.078) [-545.748] -- 0:00:45
      209000 -- [-541.228] (-542.254) (-541.835) (-545.670) * (-543.855) (-551.466) (-545.408) [-544.103] -- 0:00:45
      209500 -- (-542.328) (-542.582) (-540.290) [-543.089] * (-543.708) (-547.473) (-543.450) [-543.582] -- 0:00:45
      210000 -- (-542.127) (-545.204) (-547.230) [-543.079] * (-542.900) (-545.389) (-543.337) [-543.077] -- 0:00:45

      Average standard deviation of split frequencies: 0.017375

      210500 -- (-545.751) (-543.098) (-540.568) [-540.809] * (-541.394) (-542.441) (-546.679) [-542.865] -- 0:00:45
      211000 -- (-544.411) (-543.146) [-541.258] (-541.211) * [-541.251] (-542.308) (-542.257) (-541.603) -- 0:00:44
      211500 -- (-545.101) (-548.085) (-544.063) [-544.588] * (-540.743) (-542.636) (-543.268) [-541.875] -- 0:00:44
      212000 -- (-545.119) (-545.677) (-540.857) [-543.333] * (-542.473) (-543.299) [-541.833] (-541.238) -- 0:00:44
      212500 -- (-545.200) [-544.203] (-543.346) (-543.663) * (-543.641) [-545.439] (-545.263) (-541.336) -- 0:00:44
      213000 -- [-540.856] (-546.524) (-545.674) (-544.459) * [-541.030] (-542.530) (-544.108) (-541.488) -- 0:00:44
      213500 -- (-541.149) (-542.396) (-541.431) [-541.230] * (-541.291) [-544.468] (-542.748) (-541.475) -- 0:00:44
      214000 -- (-541.887) (-541.465) (-543.592) [-542.701] * [-542.187] (-541.047) (-541.781) (-543.439) -- 0:00:44
      214500 -- (-542.033) [-540.904] (-540.587) (-543.855) * (-542.638) (-541.491) [-543.724] (-542.945) -- 0:00:43
      215000 -- (-542.357) (-543.650) [-545.438] (-541.993) * [-541.664] (-540.985) (-544.057) (-546.814) -- 0:00:43

      Average standard deviation of split frequencies: 0.017074

      215500 -- (-540.369) [-541.837] (-543.552) (-542.460) * (-542.420) (-543.671) [-545.820] (-540.779) -- 0:00:43
      216000 -- (-540.833) (-541.703) (-542.071) [-545.715] * (-542.409) [-542.317] (-542.401) (-541.570) -- 0:00:43
      216500 -- [-540.613] (-541.671) (-541.923) (-542.843) * (-543.400) [-544.097] (-546.344) (-543.951) -- 0:00:43
      217000 -- (-545.251) (-541.047) [-541.712] (-540.700) * (-544.040) [-542.886] (-545.383) (-543.253) -- 0:00:43
      217500 -- (-543.177) (-541.398) (-544.306) [-545.615] * (-542.293) (-541.944) (-546.417) [-541.998] -- 0:00:43
      218000 -- (-543.151) [-543.757] (-542.265) (-542.866) * (-542.712) (-542.767) (-541.238) [-543.170] -- 0:00:43
      218500 -- (-546.224) [-543.138] (-542.709) (-544.861) * (-540.550) (-543.193) (-540.599) [-543.486] -- 0:00:42
      219000 -- (-544.136) (-544.024) [-541.667] (-543.288) * (-541.919) (-540.903) [-542.079] (-541.294) -- 0:00:42
      219500 -- [-543.241] (-543.099) (-544.053) (-543.404) * (-543.506) [-540.862] (-545.225) (-542.362) -- 0:00:42
      220000 -- [-543.254] (-541.042) (-542.085) (-544.524) * (-543.020) (-543.554) (-544.043) [-544.080] -- 0:00:42

      Average standard deviation of split frequencies: 0.017090

      220500 -- [-546.729] (-541.653) (-542.049) (-544.638) * (-541.507) (-544.450) (-542.482) [-543.781] -- 0:00:42
      221000 -- (-544.601) (-549.243) [-542.839] (-542.491) * [-541.034] (-541.170) (-542.235) (-546.129) -- 0:00:45
      221500 -- (-549.644) (-543.950) (-542.522) [-541.159] * (-542.757) [-540.857] (-541.118) (-543.176) -- 0:00:45
      222000 -- [-541.654] (-542.732) (-546.213) (-542.662) * [-542.529] (-541.196) (-543.294) (-543.072) -- 0:00:45
      222500 -- (-546.417) (-541.619) (-542.187) [-542.257] * [-543.884] (-543.420) (-543.235) (-543.966) -- 0:00:45
      223000 -- (-543.419) [-543.667] (-544.736) (-541.312) * (-547.658) (-543.774) (-542.822) [-542.757] -- 0:00:45
      223500 -- (-541.469) [-542.568] (-542.157) (-542.530) * (-542.709) (-543.709) [-540.710] (-541.219) -- 0:00:45
      224000 -- [-541.541] (-550.756) (-543.900) (-544.262) * (-542.412) (-544.824) [-543.764] (-542.076) -- 0:00:45
      224500 -- [-540.434] (-544.367) (-547.079) (-542.156) * (-545.074) (-540.463) [-542.509] (-543.798) -- 0:00:44
      225000 -- (-540.705) [-541.191] (-543.029) (-542.567) * (-543.204) (-542.525) (-542.010) [-544.448] -- 0:00:44

      Average standard deviation of split frequencies: 0.017208

      225500 -- [-540.633] (-542.665) (-543.361) (-542.184) * [-542.270] (-542.893) (-542.280) (-540.472) -- 0:00:44
      226000 -- (-540.505) (-542.615) [-543.757] (-542.904) * [-541.692] (-546.325) (-542.112) (-541.123) -- 0:00:44
      226500 -- (-541.263) [-541.242] (-543.393) (-541.776) * [-544.193] (-549.359) (-542.383) (-542.513) -- 0:00:44
      227000 -- (-544.592) [-543.049] (-543.071) (-543.212) * (-541.992) (-542.017) (-542.564) [-543.716] -- 0:00:44
      227500 -- [-541.475] (-552.147) (-542.625) (-543.893) * (-543.177) (-541.213) (-544.066) [-542.736] -- 0:00:44
      228000 -- (-542.320) (-544.631) (-542.173) [-544.319] * (-542.666) (-544.750) [-540.835] (-545.977) -- 0:00:44
      228500 -- (-540.720) (-540.489) (-541.702) [-543.390] * (-544.555) [-541.758] (-544.458) (-547.988) -- 0:00:43
      229000 -- [-543.568] (-540.337) (-545.377) (-548.678) * (-543.070) [-545.753] (-540.836) (-543.318) -- 0:00:43
      229500 -- (-542.431) [-546.793] (-542.927) (-548.687) * (-540.768) (-544.494) (-545.442) [-545.477] -- 0:00:43
      230000 -- (-541.693) (-544.934) [-544.089] (-541.882) * (-543.208) (-546.530) (-542.088) [-544.211] -- 0:00:43

      Average standard deviation of split frequencies: 0.016094

      230500 -- (-549.783) (-543.273) [-543.256] (-541.480) * (-541.320) (-544.561) [-542.280] (-549.195) -- 0:00:43
      231000 -- (-542.915) [-541.852] (-542.923) (-542.447) * (-541.786) (-542.768) (-541.749) [-541.532] -- 0:00:43
      231500 -- (-548.344) [-543.033] (-540.996) (-541.771) * (-541.837) (-544.330) [-542.139] (-547.174) -- 0:00:43
      232000 -- (-541.274) (-540.595) (-542.421) [-540.662] * (-541.466) (-541.628) [-542.604] (-543.259) -- 0:00:43
      232500 -- (-541.151) [-543.707] (-543.889) (-541.517) * (-540.877) (-543.270) (-542.688) [-542.594] -- 0:00:42
      233000 -- (-543.941) (-540.933) (-540.556) [-541.202] * (-542.831) [-544.041] (-545.275) (-542.645) -- 0:00:42
      233500 -- (-542.916) (-541.803) [-541.277] (-543.199) * (-543.148) (-546.083) [-540.599] (-544.805) -- 0:00:42
      234000 -- (-545.952) [-541.645] (-545.622) (-542.205) * (-547.952) (-541.954) (-541.489) [-548.567] -- 0:00:42
      234500 -- [-543.585] (-543.065) (-544.946) (-543.922) * [-542.225] (-541.711) (-542.514) (-541.725) -- 0:00:42
      235000 -- (-547.938) [-546.000] (-543.204) (-543.001) * (-546.104) (-543.170) (-540.841) [-545.631] -- 0:00:42

      Average standard deviation of split frequencies: 0.014648

      235500 -- [-542.060] (-541.711) (-544.135) (-545.403) * (-546.778) (-547.524) (-542.231) [-543.773] -- 0:00:42
      236000 -- (-541.246) [-541.564] (-546.943) (-542.688) * (-542.716) (-542.095) (-542.992) [-541.191] -- 0:00:42
      236500 -- (-542.479) (-542.471) [-542.022] (-540.452) * (-541.711) [-548.202] (-541.517) (-543.365) -- 0:00:41
      237000 -- (-542.220) (-545.509) (-546.075) [-542.553] * (-541.205) (-542.649) (-543.787) [-541.032] -- 0:00:41
      237500 -- (-542.665) (-543.130) [-544.615] (-542.724) * [-541.458] (-544.527) (-541.822) (-542.043) -- 0:00:41
      238000 -- [-540.778] (-541.395) (-541.418) (-544.841) * (-541.912) (-543.621) (-543.100) [-543.365] -- 0:00:44
      238500 -- [-542.181] (-541.325) (-543.960) (-545.223) * (-545.819) (-544.034) [-543.593] (-544.624) -- 0:00:44
      239000 -- [-543.102] (-540.959) (-543.989) (-546.675) * (-541.812) [-544.046] (-541.542) (-544.250) -- 0:00:44
      239500 -- (-543.062) [-541.648] (-541.055) (-540.428) * (-542.572) (-541.216) [-541.336] (-544.913) -- 0:00:44
      240000 -- [-545.694] (-543.290) (-540.840) (-540.811) * (-543.282) [-543.698] (-542.905) (-541.805) -- 0:00:44

      Average standard deviation of split frequencies: 0.012667

      240500 -- (-542.940) (-541.800) (-541.291) [-540.524] * (-542.990) (-544.570) (-541.988) [-540.963] -- 0:00:44
      241000 -- (-541.829) [-541.689] (-548.380) (-543.461) * (-547.253) (-540.609) [-542.164] (-542.966) -- 0:00:44
      241500 -- (-541.821) [-543.550] (-545.328) (-542.725) * (-544.782) (-542.528) (-541.008) [-546.886] -- 0:00:43
      242000 -- (-545.226) (-543.775) [-545.151] (-541.783) * (-540.682) [-541.768] (-542.503) (-545.946) -- 0:00:43
      242500 -- (-544.796) [-544.501] (-541.524) (-542.239) * [-541.133] (-542.749) (-541.793) (-549.752) -- 0:00:43
      243000 -- [-543.850] (-546.207) (-543.395) (-546.731) * (-541.427) (-544.267) (-540.750) [-542.609] -- 0:00:43
      243500 -- (-543.970) (-543.178) [-542.818] (-544.166) * [-543.983] (-543.338) (-541.425) (-544.011) -- 0:00:43
      244000 -- (-543.416) (-543.339) [-546.600] (-543.902) * [-545.071] (-544.855) (-544.674) (-544.212) -- 0:00:43
      244500 -- [-542.123] (-541.094) (-542.220) (-544.105) * (-545.464) [-543.492] (-543.602) (-545.320) -- 0:00:43
      245000 -- (-543.502) [-544.952] (-541.707) (-543.494) * (-543.150) (-542.994) (-541.744) [-542.094] -- 0:00:43

      Average standard deviation of split frequencies: 0.013414

      245500 -- (-544.599) (-541.428) [-540.674] (-540.559) * (-541.463) (-542.335) [-542.386] (-542.956) -- 0:00:43
      246000 -- [-543.597] (-540.699) (-543.475) (-544.378) * (-542.296) (-545.663) (-542.219) [-542.642] -- 0:00:42
      246500 -- (-544.858) [-543.492] (-540.629) (-544.984) * (-542.847) (-543.424) (-543.749) [-542.531] -- 0:00:42
      247000 -- [-541.171] (-547.701) (-543.157) (-545.054) * (-543.231) (-545.483) [-544.789] (-545.746) -- 0:00:42
      247500 -- (-541.037) [-543.228] (-541.509) (-541.548) * (-543.411) (-545.026) [-544.427] (-543.364) -- 0:00:42
      248000 -- (-545.994) [-541.864] (-542.209) (-543.305) * [-543.595] (-543.684) (-544.014) (-541.251) -- 0:00:42
      248500 -- (-542.326) [-541.310] (-542.902) (-541.864) * (-542.768) [-543.744] (-544.242) (-540.672) -- 0:00:42
      249000 -- (-547.169) (-542.183) (-545.208) [-542.943] * [-542.156] (-543.421) (-545.129) (-547.916) -- 0:00:42
      249500 -- [-543.785] (-544.718) (-542.276) (-544.474) * [-543.022] (-542.539) (-541.804) (-546.475) -- 0:00:42
      250000 -- (-550.935) [-543.192] (-542.600) (-545.395) * (-545.999) (-542.715) (-543.539) [-542.212] -- 0:00:42

      Average standard deviation of split frequencies: 0.012390

      250500 -- (-549.400) (-540.794) (-541.706) [-541.049] * (-542.127) (-542.546) (-542.721) [-542.957] -- 0:00:41
      251000 -- (-544.032) [-541.753] (-544.346) (-544.156) * (-544.650) (-543.306) (-541.514) [-541.965] -- 0:00:41
      251500 -- (-542.372) (-540.922) (-546.404) [-544.500] * [-541.613] (-540.860) (-544.109) (-540.654) -- 0:00:41
      252000 -- (-541.685) [-541.691] (-541.581) (-542.673) * (-544.577) (-542.967) (-545.409) [-542.939] -- 0:00:41
      252500 -- (-540.664) (-541.144) [-540.707] (-540.832) * (-541.930) (-541.549) (-543.501) [-545.149] -- 0:00:41
      253000 -- (-541.717) (-545.841) (-546.714) [-544.278] * (-540.557) (-541.496) [-544.517] (-548.246) -- 0:00:41
      253500 -- (-541.296) [-541.498] (-548.676) (-544.245) * (-541.025) [-541.714] (-546.221) (-543.330) -- 0:00:41
      254000 -- (-542.703) (-543.400) (-541.907) [-540.873] * (-545.735) [-542.496] (-541.901) (-542.345) -- 0:00:41
      254500 -- (-542.144) (-543.890) (-542.628) [-543.006] * (-548.122) [-541.085] (-541.768) (-544.391) -- 0:00:41
      255000 -- [-540.294] (-549.869) (-541.363) (-543.608) * (-545.588) (-541.183) [-541.369] (-540.712) -- 0:00:43

      Average standard deviation of split frequencies: 0.010933

      255500 -- (-540.338) (-543.258) (-541.532) [-542.115] * (-544.596) [-542.747] (-544.119) (-541.697) -- 0:00:43
      256000 -- [-541.553] (-543.285) (-540.675) (-544.121) * (-547.841) [-541.383] (-544.027) (-542.394) -- 0:00:43
      256500 -- (-541.502) (-543.424) (-541.184) [-541.806] * (-546.100) [-541.658] (-540.895) (-544.844) -- 0:00:43
      257000 -- (-544.525) (-540.220) (-541.076) [-540.997] * (-544.524) (-541.628) (-544.682) [-542.743] -- 0:00:43
      257500 -- (-543.236) (-542.611) (-541.730) [-541.060] * [-542.497] (-542.681) (-542.068) (-544.749) -- 0:00:43
      258000 -- (-543.083) [-540.579] (-541.715) (-542.249) * (-541.615) (-540.814) (-541.686) [-541.874] -- 0:00:43
      258500 -- [-541.934] (-540.463) (-541.804) (-543.624) * (-541.139) (-542.606) (-544.516) [-541.514] -- 0:00:43
      259000 -- (-542.506) [-546.023] (-543.586) (-543.139) * [-540.902] (-540.378) (-541.609) (-542.484) -- 0:00:42
      259500 -- (-541.155) (-540.909) (-541.597) [-542.491] * (-542.405) (-545.051) [-541.128] (-541.066) -- 0:00:42
      260000 -- (-544.506) (-546.099) (-541.113) [-541.406] * (-540.793) (-542.125) (-541.755) [-542.278] -- 0:00:42

      Average standard deviation of split frequencies: 0.011642

      260500 -- [-542.089] (-546.815) (-542.498) (-542.120) * (-540.695) (-547.529) [-541.807] (-546.785) -- 0:00:42
      261000 -- (-541.749) [-544.953] (-541.760) (-543.029) * (-542.203) [-545.632] (-543.268) (-542.039) -- 0:00:42
      261500 -- [-541.115] (-545.515) (-542.149) (-545.520) * (-544.408) (-542.325) [-541.135] (-540.966) -- 0:00:42
      262000 -- (-542.162) [-541.732] (-543.112) (-544.837) * (-542.197) (-541.918) [-545.565] (-542.452) -- 0:00:42
      262500 -- (-544.845) (-545.703) [-542.143] (-544.295) * (-545.326) (-541.056) (-542.178) [-541.914] -- 0:00:42
      263000 -- (-541.735) (-544.559) (-543.593) [-541.703] * [-541.408] (-542.591) (-541.063) (-540.830) -- 0:00:42
      263500 -- (-541.201) (-544.632) (-541.881) [-543.675] * (-541.116) [-543.367] (-540.593) (-540.593) -- 0:00:41
      264000 -- [-542.004] (-545.867) (-540.515) (-548.693) * [-545.720] (-541.933) (-542.135) (-545.236) -- 0:00:41
      264500 -- (-545.842) (-546.399) (-540.355) [-543.547] * (-543.214) [-540.995] (-546.354) (-542.063) -- 0:00:41
      265000 -- (-542.522) (-544.116) [-540.708] (-543.628) * (-543.365) (-541.122) (-541.874) [-544.032] -- 0:00:41

      Average standard deviation of split frequencies: 0.013344

      265500 -- (-545.464) [-542.340] (-544.717) (-544.449) * (-545.746) [-540.718] (-544.620) (-542.103) -- 0:00:41
      266000 -- (-554.136) [-542.910] (-547.173) (-541.833) * (-542.961) (-541.188) (-540.870) [-541.736] -- 0:00:41
      266500 -- (-550.018) [-542.922] (-545.579) (-544.109) * (-544.615) (-551.675) (-541.924) [-541.254] -- 0:00:41
      267000 -- [-544.007] (-541.907) (-544.624) (-541.301) * (-542.563) (-541.789) (-547.284) [-544.098] -- 0:00:41
      267500 -- (-540.796) (-541.403) (-542.360) [-541.665] * (-543.398) (-546.985) (-550.271) [-543.182] -- 0:00:41
      268000 -- (-546.222) (-541.077) [-544.492] (-541.590) * (-543.253) (-543.084) [-545.798] (-541.331) -- 0:00:40
      268500 -- (-550.583) (-541.416) (-541.967) [-543.142] * (-542.244) [-541.533] (-542.753) (-544.896) -- 0:00:40
      269000 -- [-543.494] (-545.604) (-548.340) (-542.234) * (-542.658) [-543.974] (-547.366) (-541.871) -- 0:00:40
      269500 -- (-545.531) (-542.529) [-541.074] (-541.964) * (-543.911) (-541.329) [-542.122] (-547.107) -- 0:00:40
      270000 -- [-540.797] (-541.162) (-541.185) (-545.225) * (-545.066) (-544.397) [-541.982] (-541.878) -- 0:00:40

      Average standard deviation of split frequencies: 0.013114

      270500 -- (-547.271) [-540.909] (-546.553) (-543.746) * (-540.872) [-541.844] (-543.106) (-544.748) -- 0:00:40
      271000 -- (-542.106) (-541.230) (-541.109) [-546.638] * (-543.893) [-541.219] (-541.312) (-545.090) -- 0:00:40
      271500 -- (-541.525) [-541.664] (-540.865) (-546.948) * (-546.112) [-542.062] (-540.650) (-541.149) -- 0:00:40
      272000 -- (-544.202) (-540.638) (-541.210) [-543.407] * [-543.308] (-544.868) (-543.995) (-542.408) -- 0:00:42
      272500 -- [-544.842] (-542.366) (-542.092) (-547.629) * (-548.101) (-543.724) [-542.465] (-542.488) -- 0:00:42
      273000 -- (-542.731) (-542.749) (-540.434) [-544.130] * (-540.674) [-541.363] (-543.602) (-544.839) -- 0:00:42
      273500 -- (-543.822) (-543.422) (-542.866) [-541.259] * (-541.142) [-542.642] (-544.052) (-544.124) -- 0:00:42
      274000 -- [-543.381] (-542.079) (-544.546) (-550.565) * (-541.500) (-540.947) (-543.851) [-544.873] -- 0:00:42
      274500 -- (-542.311) (-541.493) (-544.441) [-550.700] * (-543.825) [-540.840] (-543.252) (-546.931) -- 0:00:42
      275000 -- (-543.162) (-544.420) [-541.361] (-544.896) * (-541.489) [-543.346] (-541.591) (-541.395) -- 0:00:42

      Average standard deviation of split frequencies: 0.014267

      275500 -- [-546.690] (-543.413) (-542.542) (-549.245) * (-544.428) (-543.196) [-541.825] (-543.971) -- 0:00:42
      276000 -- (-544.043) (-542.038) [-542.915] (-541.665) * (-542.496) [-540.592] (-543.182) (-542.393) -- 0:00:41
      276500 -- [-542.501] (-543.530) (-541.763) (-542.770) * [-542.607] (-541.802) (-540.840) (-544.616) -- 0:00:41
      277000 -- (-543.550) [-543.742] (-542.201) (-541.295) * (-542.262) (-541.700) [-542.738] (-544.041) -- 0:00:41
      277500 -- [-540.794] (-541.641) (-543.133) (-542.996) * (-542.928) [-542.630] (-543.291) (-542.426) -- 0:00:41
      278000 -- (-544.068) (-542.425) (-541.793) [-541.109] * (-547.464) [-541.994] (-542.246) (-542.005) -- 0:00:41
      278500 -- [-541.986] (-542.849) (-544.571) (-543.634) * (-543.879) (-541.907) (-541.902) [-542.154] -- 0:00:41
      279000 -- (-544.095) (-542.006) [-543.361] (-544.801) * (-545.599) [-543.428] (-540.604) (-543.635) -- 0:00:41
      279500 -- (-542.024) (-544.155) [-541.606] (-544.472) * (-541.571) (-542.396) [-542.556] (-542.646) -- 0:00:41
      280000 -- [-544.030] (-542.415) (-540.218) (-543.872) * (-540.724) (-546.392) (-542.874) [-542.817] -- 0:00:41

      Average standard deviation of split frequencies: 0.013634

      280500 -- (-547.271) [-541.418] (-549.082) (-547.579) * (-544.362) (-543.881) [-542.645] (-542.953) -- 0:00:41
      281000 -- [-542.916] (-542.499) (-542.354) (-543.627) * (-540.447) (-541.218) (-541.529) [-542.187] -- 0:00:40
      281500 -- (-541.654) (-544.354) (-541.325) [-541.242] * (-541.046) (-544.019) [-541.796] (-542.996) -- 0:00:40
      282000 -- (-541.846) (-542.167) [-543.325] (-544.046) * (-542.690) (-540.731) [-542.269] (-543.756) -- 0:00:40
      282500 -- (-541.067) [-540.813] (-545.272) (-546.527) * (-545.458) (-541.416) [-542.475] (-544.154) -- 0:00:40
      283000 -- (-542.985) (-544.986) (-540.605) [-541.603] * [-543.281] (-541.314) (-541.293) (-549.025) -- 0:00:40
      283500 -- [-546.437] (-543.580) (-541.329) (-542.649) * [-542.640] (-544.237) (-543.085) (-546.134) -- 0:00:40
      284000 -- [-549.603] (-542.210) (-542.459) (-542.086) * [-543.019] (-542.872) (-542.331) (-541.831) -- 0:00:40
      284500 -- (-542.936) (-541.816) [-542.107] (-541.199) * (-542.799) (-541.485) [-542.469] (-540.583) -- 0:00:40
      285000 -- [-543.910] (-544.600) (-544.023) (-544.301) * (-546.818) [-541.766] (-541.687) (-545.355) -- 0:00:40

      Average standard deviation of split frequencies: 0.011229

      285500 -- (-543.944) (-543.696) (-543.441) [-541.278] * (-545.951) (-543.149) (-543.176) [-543.893] -- 0:00:40
      286000 -- (-541.617) (-544.473) (-544.883) [-541.418] * (-543.334) (-544.330) (-545.175) [-540.840] -- 0:00:39
      286500 -- [-544.470] (-546.043) (-543.519) (-541.296) * (-541.499) (-545.036) [-542.773] (-541.160) -- 0:00:39
      287000 -- (-545.591) (-544.583) (-541.492) [-541.525] * (-541.977) (-544.144) [-541.583] (-540.810) -- 0:00:39
      287500 -- (-545.858) (-541.565) (-542.665) [-544.016] * (-545.788) (-544.339) [-541.696] (-542.837) -- 0:00:39
      288000 -- (-542.808) (-541.861) (-541.505) [-544.820] * (-544.526) (-541.647) (-542.731) [-542.975] -- 0:00:39
      288500 -- (-541.232) [-540.858] (-542.668) (-543.065) * (-541.967) (-541.663) [-543.000] (-541.791) -- 0:00:39
      289000 -- [-540.808] (-541.284) (-546.040) (-542.144) * (-543.526) (-545.561) (-541.085) [-541.486] -- 0:00:41
      289500 -- (-542.434) (-541.314) [-541.911] (-541.178) * (-547.372) (-544.088) [-542.168] (-544.201) -- 0:00:41
      290000 -- [-541.651] (-543.995) (-541.774) (-543.456) * (-543.687) (-541.574) [-543.595] (-542.013) -- 0:00:41

      Average standard deviation of split frequencies: 0.010947

      290500 -- [-542.159] (-543.708) (-541.686) (-545.164) * (-541.071) (-541.299) (-542.690) [-540.789] -- 0:00:41
      291000 -- (-544.388) [-540.941] (-541.125) (-541.693) * (-545.726) (-544.636) (-543.833) [-542.117] -- 0:00:41
      291500 -- (-544.800) (-541.993) (-543.048) [-543.232] * (-545.494) (-543.243) [-543.428] (-541.711) -- 0:00:41
      292000 -- [-541.737] (-541.198) (-543.716) (-544.741) * (-543.245) (-542.558) (-541.733) [-541.741] -- 0:00:41
      292500 -- (-542.224) (-541.727) (-544.177) [-541.400] * [-542.779] (-540.789) (-540.747) (-547.883) -- 0:00:41
      293000 -- (-542.756) (-542.756) [-541.011] (-544.380) * [-542.182] (-547.266) (-542.733) (-540.713) -- 0:00:41
      293500 -- [-543.122] (-544.266) (-545.653) (-545.991) * (-544.324) [-540.312] (-543.821) (-543.073) -- 0:00:40
      294000 -- [-544.205] (-542.360) (-542.616) (-543.669) * [-543.423] (-545.643) (-543.120) (-547.414) -- 0:00:40
      294500 -- (-545.918) (-543.676) [-543.056] (-544.839) * [-541.769] (-547.497) (-543.639) (-544.649) -- 0:00:40
      295000 -- (-543.293) (-542.486) [-541.020] (-544.032) * (-544.634) (-548.450) [-544.154] (-542.507) -- 0:00:40

      Average standard deviation of split frequencies: 0.011248

      295500 -- (-543.328) (-541.179) (-544.863) [-544.204] * [-542.177] (-543.494) (-543.497) (-544.036) -- 0:00:40
      296000 -- (-543.841) (-541.471) [-542.946] (-543.358) * (-548.284) [-544.357] (-541.980) (-542.823) -- 0:00:40
      296500 -- [-542.471] (-541.684) (-546.874) (-541.862) * (-540.660) (-542.520) (-541.727) [-543.075] -- 0:00:40
      297000 -- (-542.393) (-543.692) (-541.798) [-542.095] * [-543.282] (-542.906) (-540.328) (-544.189) -- 0:00:40
      297500 -- (-543.088) (-542.235) (-550.707) [-541.467] * (-544.561) (-541.974) [-541.599] (-543.457) -- 0:00:40
      298000 -- [-542.733] (-542.741) (-545.846) (-542.220) * (-541.239) (-544.503) (-545.690) [-546.696] -- 0:00:40
      298500 -- (-542.309) (-546.470) (-544.569) [-544.965] * (-541.739) [-542.097] (-544.031) (-552.439) -- 0:00:39
      299000 -- [-542.431] (-542.533) (-543.185) (-543.880) * [-547.489] (-541.534) (-543.489) (-543.028) -- 0:00:39
      299500 -- (-543.087) (-544.046) [-541.907] (-544.465) * [-542.780] (-541.301) (-542.659) (-544.516) -- 0:00:39
      300000 -- (-547.065) (-548.052) [-545.406] (-542.519) * (-543.648) (-543.543) (-544.829) [-542.822] -- 0:00:39

      Average standard deviation of split frequencies: 0.011289

      300500 -- (-542.110) (-543.887) (-541.870) [-544.207] * (-540.897) [-541.777] (-541.893) (-543.670) -- 0:00:39
      301000 -- (-540.921) [-542.579] (-542.229) (-540.718) * (-541.519) (-543.628) [-541.379] (-542.057) -- 0:00:39
      301500 -- [-541.421] (-541.676) (-542.068) (-543.351) * [-542.514] (-542.117) (-541.558) (-544.267) -- 0:00:39
      302000 -- (-541.993) [-544.379] (-542.072) (-545.508) * (-544.391) (-541.934) [-541.890] (-541.366) -- 0:00:39
      302500 -- (-541.646) (-542.019) [-544.994] (-541.739) * (-545.542) [-542.588] (-543.049) (-546.874) -- 0:00:39
      303000 -- (-545.556) [-544.065] (-543.718) (-541.170) * [-544.103] (-541.362) (-547.842) (-541.866) -- 0:00:39
      303500 -- (-547.378) (-541.453) [-543.651] (-541.147) * (-543.733) [-543.193] (-543.348) (-543.193) -- 0:00:39
      304000 -- (-543.730) [-541.838] (-542.503) (-543.736) * [-546.100] (-543.569) (-542.873) (-541.456) -- 0:00:38
      304500 -- (-540.539) (-543.079) (-540.798) [-541.401] * (-542.715) (-542.376) [-543.398] (-546.038) -- 0:00:38
      305000 -- (-544.775) (-541.020) [-542.735] (-543.743) * (-542.636) [-543.987] (-543.522) (-547.788) -- 0:00:38

      Average standard deviation of split frequencies: 0.010784

      305500 -- (-542.491) (-542.729) [-541.674] (-542.856) * (-542.936) [-541.817] (-542.978) (-541.953) -- 0:00:38
      306000 -- (-542.684) (-541.801) [-542.288] (-543.575) * (-546.114) (-541.899) (-540.889) [-543.544] -- 0:00:38
      306500 -- (-543.392) [-540.947] (-543.990) (-541.493) * [-542.788] (-542.804) (-540.976) (-542.673) -- 0:00:40
      307000 -- (-542.044) [-542.319] (-542.320) (-544.357) * (-542.498) [-543.455] (-545.254) (-543.018) -- 0:00:40
      307500 -- (-545.669) (-544.405) [-543.277] (-542.925) * [-541.736] (-542.785) (-541.910) (-543.165) -- 0:00:40
      308000 -- (-543.046) (-543.382) [-541.529] (-542.695) * (-542.152) [-541.338] (-541.868) (-541.473) -- 0:00:40
      308500 -- [-542.881] (-541.217) (-544.277) (-543.494) * (-542.980) [-541.195] (-544.839) (-542.918) -- 0:00:40
      309000 -- (-543.867) [-542.212] (-545.453) (-540.216) * (-542.302) (-542.325) [-543.228] (-540.732) -- 0:00:40
      309500 -- (-541.203) (-541.320) [-542.514] (-541.426) * [-542.838] (-542.686) (-545.768) (-543.276) -- 0:00:40
      310000 -- (-541.671) (-542.324) [-541.971] (-544.020) * [-540.446] (-543.626) (-542.820) (-545.024) -- 0:00:40

      Average standard deviation of split frequencies: 0.011001

      310500 -- (-544.545) (-540.905) (-543.912) [-544.818] * (-540.468) (-545.729) (-548.071) [-546.515] -- 0:00:39
      311000 -- [-541.680] (-541.907) (-542.440) (-541.706) * (-540.553) (-543.618) [-540.410] (-541.840) -- 0:00:39
      311500 -- (-541.209) [-542.655] (-549.631) (-542.694) * (-542.909) (-544.917) (-541.068) [-544.589] -- 0:00:39
      312000 -- (-545.252) [-541.057] (-545.304) (-540.788) * (-542.913) [-542.279] (-541.987) (-542.614) -- 0:00:39
      312500 -- (-541.658) [-543.056] (-541.462) (-541.978) * [-542.997] (-543.044) (-542.023) (-545.205) -- 0:00:39
      313000 -- [-541.263] (-542.571) (-541.676) (-540.950) * (-541.351) [-543.596] (-541.000) (-541.509) -- 0:00:39
      313500 -- [-541.296] (-542.072) (-541.587) (-541.400) * (-541.114) (-545.035) (-543.244) [-541.851] -- 0:00:39
      314000 -- (-542.709) (-544.662) (-541.574) [-542.375] * (-547.208) (-541.952) [-541.788] (-542.042) -- 0:00:39
      314500 -- (-547.068) [-541.729] (-543.498) (-542.334) * (-547.781) (-541.964) (-542.598) [-542.687] -- 0:00:39
      315000 -- (-542.378) (-545.686) (-542.486) [-541.399] * [-545.321] (-544.970) (-541.753) (-549.129) -- 0:00:39

      Average standard deviation of split frequencies: 0.010349

      315500 -- (-541.338) (-544.255) [-547.596] (-541.680) * (-547.376) (-543.762) (-546.698) [-543.149] -- 0:00:39
      316000 -- (-540.614) [-544.727] (-544.391) (-543.192) * (-548.242) (-547.726) [-541.362] (-545.831) -- 0:00:38
      316500 -- (-545.330) (-545.031) [-545.129] (-540.581) * (-541.832) (-543.995) (-542.094) [-543.335] -- 0:00:38
      317000 -- (-541.637) (-541.603) (-541.443) [-541.178] * (-543.772) [-542.269] (-545.553) (-541.649) -- 0:00:38
      317500 -- (-542.870) (-541.270) [-544.244] (-540.967) * [-540.846] (-540.752) (-544.782) (-542.484) -- 0:00:38
      318000 -- (-542.135) (-541.106) [-542.123] (-540.533) * (-552.129) [-541.665] (-541.634) (-542.963) -- 0:00:38
      318500 -- (-547.819) [-541.150] (-545.597) (-541.431) * (-541.567) (-546.927) (-546.678) [-541.762] -- 0:00:38
      319000 -- (-545.415) [-541.872] (-544.329) (-542.485) * (-540.783) (-545.262) (-546.148) [-540.994] -- 0:00:38
      319500 -- (-540.982) [-541.767] (-540.862) (-544.489) * (-542.273) [-542.412] (-542.975) (-540.999) -- 0:00:38
      320000 -- [-540.998] (-544.135) (-545.123) (-543.566) * (-540.410) (-543.501) [-544.076] (-542.326) -- 0:00:38

      Average standard deviation of split frequencies: 0.010781

      320500 -- (-544.202) (-541.648) [-545.890] (-543.580) * (-543.053) (-543.737) (-542.157) [-541.985] -- 0:00:38
      321000 -- (-549.866) (-543.509) (-543.429) [-540.574] * [-544.812] (-544.212) (-544.113) (-542.773) -- 0:00:38
      321500 -- [-541.776] (-544.599) (-543.368) (-541.176) * (-542.224) [-541.883] (-550.581) (-543.895) -- 0:00:37
      322000 -- (-540.467) (-542.179) (-541.076) [-540.998] * (-544.207) [-541.718] (-548.224) (-542.937) -- 0:00:37
      322500 -- (-541.642) (-545.495) (-544.250) [-541.171] * [-543.604] (-543.099) (-544.371) (-544.067) -- 0:00:37
      323000 -- (-544.477) (-546.466) (-541.159) [-543.831] * [-542.074] (-545.042) (-542.553) (-543.358) -- 0:00:37
      323500 -- [-540.723] (-547.078) (-543.746) (-541.909) * (-541.224) (-542.878) [-543.161] (-542.438) -- 0:00:39
      324000 -- (-543.490) (-541.755) (-548.846) [-541.316] * [-543.344] (-546.214) (-544.078) (-542.336) -- 0:00:39
      324500 -- [-543.057] (-540.606) (-541.698) (-540.609) * (-544.525) (-541.763) (-541.599) [-542.276] -- 0:00:39
      325000 -- (-542.245) (-544.738) (-541.436) [-543.223] * (-543.427) (-541.219) [-541.801] (-541.279) -- 0:00:39

      Average standard deviation of split frequencies: 0.011116

      325500 -- (-543.784) (-545.820) (-541.643) [-542.730] * (-541.998) (-540.576) (-540.701) [-541.644] -- 0:00:39
      326000 -- (-542.269) (-545.972) [-541.072] (-544.467) * (-541.827) [-544.645] (-540.933) (-542.862) -- 0:00:39
      326500 -- [-547.500] (-545.217) (-542.456) (-542.843) * (-541.399) [-542.390] (-544.595) (-541.284) -- 0:00:39
      327000 -- (-542.466) (-542.821) (-543.077) [-541.938] * (-542.436) (-544.736) (-544.296) [-542.784] -- 0:00:39
      327500 -- (-546.166) [-540.323] (-541.961) (-542.089) * [-542.367] (-541.284) (-541.602) (-540.906) -- 0:00:39
      328000 -- (-544.484) [-540.334] (-544.328) (-540.915) * (-544.799) (-545.532) (-543.224) [-541.231] -- 0:00:38
      328500 -- [-544.572] (-544.048) (-544.989) (-543.433) * [-542.414] (-543.135) (-541.817) (-542.151) -- 0:00:38
      329000 -- (-544.955) [-545.690] (-542.515) (-544.496) * (-543.989) [-544.071] (-542.085) (-542.592) -- 0:00:38
      329500 -- (-541.821) (-543.007) (-541.459) [-547.398] * [-540.617] (-547.933) (-542.788) (-543.161) -- 0:00:38
      330000 -- (-541.645) [-541.372] (-541.361) (-542.626) * (-541.781) (-543.806) (-545.658) [-542.165] -- 0:00:38

      Average standard deviation of split frequencies: 0.010902

      330500 -- (-543.009) (-549.150) (-542.225) [-547.936] * (-543.588) (-542.139) [-543.026] (-544.824) -- 0:00:38
      331000 -- (-542.754) [-544.560] (-542.528) (-541.311) * (-544.982) (-542.462) [-542.376] (-543.246) -- 0:00:38
      331500 -- [-544.691] (-544.785) (-543.707) (-541.278) * (-545.395) (-541.400) [-541.336] (-543.189) -- 0:00:38
      332000 -- (-544.820) [-543.486] (-544.121) (-541.888) * (-543.738) (-542.003) (-542.084) [-540.827] -- 0:00:38
      332500 -- (-547.644) (-541.273) [-543.596] (-542.474) * (-543.941) [-541.305] (-543.316) (-546.197) -- 0:00:38
      333000 -- (-547.995) (-542.397) (-545.439) [-541.483] * [-541.849] (-541.829) (-543.191) (-542.937) -- 0:00:38
      333500 -- (-542.066) (-542.664) [-542.216] (-542.600) * (-541.799) (-542.675) (-544.375) [-544.186] -- 0:00:37
      334000 -- (-540.510) [-541.533] (-542.552) (-544.603) * (-541.882) [-545.443] (-543.754) (-542.668) -- 0:00:37
      334500 -- (-544.464) (-542.818) (-547.288) [-542.820] * (-542.369) [-544.464] (-542.699) (-543.773) -- 0:00:37
      335000 -- (-541.713) [-540.871] (-542.392) (-544.798) * (-541.740) (-541.661) (-542.009) [-542.392] -- 0:00:37

      Average standard deviation of split frequencies: 0.010698

      335500 -- [-540.677] (-543.176) (-542.140) (-545.149) * (-542.009) [-544.657] (-541.284) (-547.907) -- 0:00:37
      336000 -- (-541.773) [-547.709] (-542.548) (-542.035) * (-546.782) [-543.121] (-542.465) (-543.742) -- 0:00:37
      336500 -- (-541.374) (-545.129) [-542.918] (-547.672) * [-550.770] (-544.953) (-541.958) (-543.934) -- 0:00:37
      337000 -- [-541.868] (-540.891) (-542.313) (-540.968) * (-550.351) [-542.040] (-540.625) (-546.258) -- 0:00:37
      337500 -- (-540.953) (-542.203) [-543.806] (-542.804) * (-542.221) (-540.591) [-541.004] (-543.056) -- 0:00:37
      338000 -- (-541.004) (-542.684) [-540.768] (-544.394) * (-542.547) [-540.477] (-541.087) (-548.478) -- 0:00:37
      338500 -- (-544.870) (-542.198) [-540.301] (-542.547) * (-544.439) (-541.648) [-541.167] (-543.562) -- 0:00:37
      339000 -- (-547.609) (-543.182) [-540.326] (-544.036) * (-541.180) (-549.945) [-540.603] (-542.496) -- 0:00:37
      339500 -- (-543.880) (-541.218) (-541.599) [-541.270] * (-541.216) [-542.579] (-543.188) (-544.993) -- 0:00:36
      340000 -- (-543.123) (-541.356) [-541.533] (-540.914) * (-544.109) (-543.867) (-543.091) [-543.191] -- 0:00:36

      Average standard deviation of split frequencies: 0.010897

      340500 -- (-542.114) (-543.566) (-544.937) [-540.953] * (-543.050) (-545.980) [-541.264] (-542.387) -- 0:00:36
      341000 -- (-542.876) (-543.442) [-541.867] (-542.717) * (-541.777) [-544.472] (-541.246) (-543.834) -- 0:00:38
      341500 -- (-541.503) (-542.101) (-542.381) [-540.800] * [-542.808] (-541.835) (-541.221) (-543.075) -- 0:00:38
      342000 -- (-543.228) (-541.742) [-542.340] (-541.889) * (-544.828) (-541.158) [-540.867] (-546.627) -- 0:00:38
      342500 -- (-541.271) (-544.400) (-541.661) [-545.858] * (-541.851) (-541.083) [-540.780] (-540.832) -- 0:00:38
      343000 -- [-543.562] (-540.511) (-541.281) (-543.346) * (-541.724) (-540.910) [-540.658] (-543.501) -- 0:00:38
      343500 -- (-543.456) (-543.601) [-541.712] (-542.570) * (-542.125) (-543.518) [-543.443] (-541.648) -- 0:00:38
      344000 -- (-543.655) (-545.648) (-542.662) [-541.111] * [-548.721] (-545.053) (-543.118) (-544.835) -- 0:00:38
      344500 -- (-540.270) (-542.209) (-540.673) [-544.931] * (-540.301) (-544.622) [-541.675] (-543.171) -- 0:00:38
      345000 -- [-541.050] (-541.620) (-547.082) (-543.501) * (-543.097) (-543.868) (-541.883) [-543.147] -- 0:00:37

      Average standard deviation of split frequencies: 0.010133

      345500 -- (-544.531) (-542.713) [-540.941] (-543.590) * (-545.489) (-545.243) (-540.631) [-541.005] -- 0:00:37
      346000 -- (-541.585) [-544.588] (-543.555) (-540.616) * [-543.334] (-541.034) (-540.913) (-545.109) -- 0:00:37
      346500 -- [-543.262] (-541.848) (-543.895) (-541.534) * (-541.874) [-541.938] (-542.831) (-543.672) -- 0:00:37
      347000 -- [-543.604] (-545.846) (-545.666) (-544.730) * (-546.378) (-543.900) [-542.535] (-542.586) -- 0:00:37
      347500 -- (-540.339) [-541.404] (-548.297) (-542.992) * (-541.439) (-542.531) [-544.747] (-540.903) -- 0:00:37
      348000 -- (-540.335) (-543.825) (-545.339) [-545.084] * (-541.205) (-544.271) (-542.290) [-542.725] -- 0:00:37
      348500 -- (-541.968) (-546.124) [-548.963] (-541.097) * (-544.750) (-542.689) (-541.528) [-547.109] -- 0:00:37
      349000 -- (-545.673) (-544.056) (-545.189) [-540.527] * (-541.312) [-548.185] (-540.960) (-544.721) -- 0:00:37
      349500 -- (-551.628) (-544.298) (-541.681) [-544.821] * [-541.253] (-542.413) (-543.645) (-542.693) -- 0:00:37
      350000 -- (-541.232) (-543.512) [-540.875] (-540.399) * (-540.681) (-543.859) [-543.032] (-540.593) -- 0:00:37

      Average standard deviation of split frequencies: 0.010923

      350500 -- (-542.143) (-541.920) [-543.402] (-540.590) * (-541.997) [-542.925] (-542.449) (-540.984) -- 0:00:37
      351000 -- (-542.993) [-543.321] (-544.489) (-540.412) * (-540.977) [-542.120] (-543.212) (-542.752) -- 0:00:36
      351500 -- (-542.855) (-544.213) [-542.785] (-542.551) * (-540.458) [-540.562] (-543.001) (-541.584) -- 0:00:36
      352000 -- (-545.210) [-542.973] (-541.765) (-541.869) * [-544.196] (-543.803) (-542.254) (-541.732) -- 0:00:36
      352500 -- (-542.345) (-541.968) [-540.887] (-542.564) * [-541.183] (-540.813) (-542.715) (-543.947) -- 0:00:36
      353000 -- (-544.085) (-540.465) [-542.726] (-543.956) * (-544.264) (-542.788) (-542.186) [-542.614] -- 0:00:36
      353500 -- (-544.112) [-543.444] (-540.716) (-542.075) * [-543.213] (-540.352) (-542.351) (-541.616) -- 0:00:36
      354000 -- (-541.275) (-541.062) (-541.051) [-541.048] * [-542.419] (-541.321) (-541.666) (-545.151) -- 0:00:36
      354500 -- (-541.458) (-542.278) (-544.682) [-541.887] * (-542.653) [-542.327] (-540.601) (-543.801) -- 0:00:36
      355000 -- (-542.752) [-542.220] (-544.741) (-541.045) * [-541.655] (-541.225) (-540.507) (-544.151) -- 0:00:36

      Average standard deviation of split frequencies: 0.010180

      355500 -- [-547.842] (-542.061) (-543.709) (-542.937) * (-540.888) (-542.077) (-542.289) [-543.609] -- 0:00:36
      356000 -- (-540.879) [-542.340] (-542.338) (-542.379) * (-540.784) (-543.368) [-543.039] (-542.025) -- 0:00:36
      356500 -- (-541.807) (-546.241) (-544.833) [-541.449] * (-542.974) [-541.574] (-545.808) (-542.890) -- 0:00:36
      357000 -- (-541.036) [-547.708] (-541.648) (-541.738) * [-540.452] (-544.645) (-544.540) (-541.620) -- 0:00:36
      357500 -- (-540.368) (-542.803) [-541.723] (-540.197) * (-546.776) (-543.390) (-544.089) [-543.435] -- 0:00:35
      358000 -- (-541.978) (-541.378) (-541.263) [-541.606] * (-542.232) (-541.307) [-543.162] (-544.253) -- 0:00:35
      358500 -- (-546.080) (-541.193) [-540.873] (-541.576) * (-541.090) (-545.481) (-541.933) [-543.853] -- 0:00:37
      359000 -- [-540.313] (-543.339) (-541.003) (-541.446) * [-540.762] (-542.777) (-542.283) (-543.595) -- 0:00:37
      359500 -- (-542.105) (-543.253) [-541.244] (-543.780) * [-541.356] (-542.146) (-542.682) (-541.916) -- 0:00:37
      360000 -- (-542.479) [-542.613] (-542.412) (-543.924) * (-542.400) (-543.241) (-545.351) [-543.396] -- 0:00:37

      Average standard deviation of split frequencies: 0.010783

      360500 -- [-541.629] (-542.024) (-542.983) (-544.172) * (-544.367) [-543.619] (-542.437) (-545.211) -- 0:00:37
      361000 -- (-541.796) (-543.286) [-541.358] (-544.689) * [-543.546] (-542.341) (-541.058) (-541.315) -- 0:00:37
      361500 -- (-548.788) (-543.613) (-546.257) [-542.143] * [-543.167] (-543.577) (-540.798) (-543.045) -- 0:00:37
      362000 -- (-542.240) (-544.253) [-541.671] (-543.957) * (-542.260) [-544.302] (-540.552) (-541.018) -- 0:00:37
      362500 -- (-543.089) (-541.948) [-540.903] (-542.262) * (-541.681) (-543.199) (-540.400) [-544.992] -- 0:00:36
      363000 -- [-544.699] (-546.479) (-541.748) (-540.748) * (-543.343) (-540.741) [-541.545] (-544.062) -- 0:00:36
      363500 -- (-545.180) (-541.546) [-542.304] (-541.062) * (-543.604) [-541.238] (-543.869) (-544.984) -- 0:00:36
      364000 -- (-543.661) [-540.713] (-544.073) (-542.529) * (-543.400) (-541.397) [-542.715] (-543.592) -- 0:00:36
      364500 -- (-543.748) (-540.843) [-542.877] (-543.823) * (-542.642) [-543.854] (-542.007) (-542.779) -- 0:00:36
      365000 -- (-551.699) (-541.724) [-543.051] (-543.745) * (-541.015) [-546.175] (-542.098) (-542.857) -- 0:00:36

      Average standard deviation of split frequencies: 0.012808

      365500 -- (-541.871) [-543.273] (-543.695) (-542.560) * (-542.041) (-544.380) (-541.879) [-541.282] -- 0:00:36
      366000 -- (-540.968) [-540.620] (-541.866) (-541.181) * (-541.423) (-546.293) [-542.869] (-545.130) -- 0:00:36
      366500 -- (-543.489) [-541.777] (-542.536) (-542.437) * [-545.412] (-546.182) (-544.342) (-544.429) -- 0:00:36
      367000 -- (-542.295) (-545.017) [-544.593] (-544.039) * (-544.710) [-540.515] (-542.080) (-542.783) -- 0:00:36
      367500 -- (-544.955) (-542.818) (-542.716) [-541.962] * [-541.404] (-541.487) (-551.987) (-540.833) -- 0:00:36
      368000 -- (-545.154) (-542.549) (-543.335) [-542.828] * (-541.028) [-542.030] (-542.166) (-546.502) -- 0:00:36
      368500 -- (-541.510) (-542.869) (-543.246) [-543.008] * (-543.912) (-543.654) (-540.687) [-541.172] -- 0:00:35
      369000 -- (-542.442) (-542.394) (-540.992) [-541.986] * [-541.736] (-543.709) (-542.744) (-545.739) -- 0:00:35
      369500 -- (-541.186) [-542.326] (-544.264) (-542.435) * [-542.113] (-543.306) (-548.688) (-540.838) -- 0:00:35
      370000 -- (-543.381) (-544.234) [-541.138] (-542.496) * (-543.133) [-542.883] (-543.168) (-540.838) -- 0:00:35

      Average standard deviation of split frequencies: 0.013765

      370500 -- [-542.386] (-544.158) (-542.299) (-541.828) * (-541.676) (-541.360) (-548.602) [-541.005] -- 0:00:35
      371000 -- [-542.514] (-541.242) (-541.615) (-541.635) * (-543.093) [-540.540] (-549.873) (-542.529) -- 0:00:35
      371500 -- [-542.129] (-542.110) (-542.938) (-545.997) * [-540.676] (-541.884) (-548.101) (-543.701) -- 0:00:35
      372000 -- (-542.013) [-541.338] (-540.487) (-546.763) * (-542.687) (-544.369) (-542.935) [-541.106] -- 0:00:35
      372500 -- [-541.412] (-541.413) (-541.774) (-543.165) * [-543.291] (-540.401) (-541.611) (-545.958) -- 0:00:35
      373000 -- (-541.455) [-540.724] (-543.384) (-543.343) * [-543.446] (-540.781) (-549.441) (-544.535) -- 0:00:35
      373500 -- (-542.359) [-545.675] (-545.178) (-543.797) * (-541.108) (-540.309) (-548.051) [-541.659] -- 0:00:35
      374000 -- (-541.460) (-546.992) [-544.283] (-544.978) * (-541.572) (-541.598) (-542.314) [-540.978] -- 0:00:35
      374500 -- (-540.785) [-541.769] (-542.220) (-541.932) * [-540.641] (-542.346) (-543.407) (-543.916) -- 0:00:35
      375000 -- (-545.844) (-540.640) [-542.816] (-544.646) * (-545.357) (-545.294) (-542.724) [-541.705] -- 0:00:35

      Average standard deviation of split frequencies: 0.013290

      375500 -- (-544.682) (-545.601) (-541.409) [-542.834] * (-548.452) (-541.728) (-544.046) [-541.444] -- 0:00:36
      376000 -- (-540.867) [-542.762] (-543.878) (-542.637) * (-542.742) (-544.044) [-543.090] (-543.157) -- 0:00:36
      376500 -- [-542.451] (-542.843) (-542.085) (-542.702) * (-543.072) (-544.555) [-541.024] (-541.758) -- 0:00:36
      377000 -- (-543.698) (-545.909) (-541.336) [-542.120] * (-545.303) (-541.701) [-541.046] (-540.690) -- 0:00:36
      377500 -- [-543.899] (-543.421) (-541.687) (-544.587) * (-542.436) (-545.781) [-542.173] (-543.138) -- 0:00:36
      378000 -- (-545.354) (-540.759) (-541.547) [-541.875] * [-544.474] (-545.805) (-544.323) (-542.956) -- 0:00:36
      378500 -- (-546.127) [-544.940] (-543.133) (-543.361) * (-542.188) (-542.273) [-542.564] (-541.224) -- 0:00:36
      379000 -- [-543.866] (-544.065) (-545.479) (-542.164) * (-544.179) (-542.644) (-540.334) [-541.699] -- 0:00:36
      379500 -- (-542.695) [-542.637] (-544.047) (-546.172) * [-544.141] (-542.863) (-541.650) (-541.932) -- 0:00:35
      380000 -- (-541.853) [-542.023] (-543.173) (-542.820) * [-544.465] (-543.943) (-540.672) (-541.748) -- 0:00:35

      Average standard deviation of split frequencies: 0.012631

      380500 -- (-542.775) (-544.865) (-541.744) [-540.945] * (-542.006) [-542.870] (-542.020) (-541.660) -- 0:00:35
      381000 -- (-543.481) [-540.474] (-544.133) (-544.806) * (-540.839) [-542.175] (-543.214) (-544.677) -- 0:00:35
      381500 -- (-542.455) [-541.881] (-543.861) (-547.876) * (-545.537) (-546.660) [-545.063] (-542.612) -- 0:00:35
      382000 -- (-543.258) (-544.587) (-542.621) [-542.272] * [-544.849] (-542.694) (-545.049) (-542.797) -- 0:00:35
      382500 -- (-546.142) [-541.686] (-543.503) (-544.510) * (-542.619) (-542.325) (-542.197) [-541.188] -- 0:00:35
      383000 -- (-545.077) (-544.479) (-547.304) [-541.806] * [-542.562] (-542.251) (-546.462) (-542.000) -- 0:00:35
      383500 -- (-541.733) [-545.041] (-543.901) (-547.493) * (-543.487) (-544.771) (-541.734) [-542.769] -- 0:00:35
      384000 -- (-542.580) (-542.768) [-540.834] (-548.422) * (-541.667) [-541.858] (-543.388) (-542.313) -- 0:00:35
      384500 -- (-543.511) [-542.949] (-544.031) (-547.977) * [-541.060] (-544.949) (-542.622) (-541.097) -- 0:00:35
      385000 -- (-542.528) [-543.099] (-542.445) (-544.120) * (-540.817) (-541.302) (-543.381) [-540.202] -- 0:00:35

      Average standard deviation of split frequencies: 0.010848

      385500 -- (-542.817) (-543.119) [-542.213] (-542.071) * (-541.294) [-542.438] (-543.228) (-541.452) -- 0:00:35
      386000 -- (-542.304) (-542.041) (-543.858) [-541.650] * (-540.945) (-542.165) [-542.515] (-545.712) -- 0:00:34
      386500 -- (-545.369) (-542.927) (-543.468) [-541.020] * (-544.865) [-541.137] (-542.882) (-546.285) -- 0:00:34
      387000 -- [-542.983] (-549.126) (-541.040) (-542.050) * (-542.971) [-542.805] (-546.957) (-546.136) -- 0:00:34
      387500 -- [-541.638] (-541.595) (-544.933) (-544.305) * (-541.902) [-541.464] (-542.940) (-540.718) -- 0:00:34
      388000 -- (-541.524) (-541.221) (-547.481) [-542.049] * (-542.075) (-540.857) (-543.369) [-541.451] -- 0:00:34
      388500 -- [-546.564] (-542.894) (-546.525) (-543.623) * (-543.635) (-541.717) (-544.919) [-542.933] -- 0:00:34
      389000 -- (-545.300) (-542.600) (-545.750) [-541.890] * [-541.119] (-542.772) (-549.526) (-543.901) -- 0:00:34
      389500 -- [-543.884] (-542.364) (-541.961) (-542.647) * (-542.653) (-540.996) [-546.205] (-546.612) -- 0:00:34
      390000 -- [-544.828] (-542.344) (-541.569) (-543.492) * [-542.629] (-544.702) (-541.348) (-543.379) -- 0:00:34

      Average standard deviation of split frequencies: 0.011073

      390500 -- (-546.969) (-542.538) (-544.097) [-542.790] * (-541.056) [-543.893] (-542.936) (-546.192) -- 0:00:34
      391000 -- (-541.127) (-541.485) [-541.725] (-541.208) * (-541.089) (-544.169) (-541.147) [-541.986] -- 0:00:34
      391500 -- [-541.043] (-542.868) (-543.312) (-542.204) * (-542.558) (-542.753) [-542.108] (-542.480) -- 0:00:34
      392000 -- (-543.997) (-547.258) [-543.226] (-542.788) * (-544.163) (-546.258) [-541.293] (-542.113) -- 0:00:34
      392500 -- (-540.773) (-543.495) [-542.033] (-540.867) * (-545.826) (-543.116) [-541.652] (-541.676) -- 0:00:34
      393000 -- (-542.492) (-542.533) [-541.766] (-541.994) * [-542.159] (-542.993) (-544.004) (-541.947) -- 0:00:35
      393500 -- (-545.621) (-542.801) (-541.664) [-543.662] * (-542.430) [-547.224] (-542.885) (-543.703) -- 0:00:35
      394000 -- (-546.531) [-542.046] (-540.220) (-552.355) * (-542.925) [-541.033] (-541.462) (-541.381) -- 0:00:35
      394500 -- [-542.288] (-541.761) (-541.324) (-546.910) * (-542.761) (-541.596) (-540.946) [-541.382] -- 0:00:35
      395000 -- [-543.065] (-543.109) (-541.660) (-541.934) * (-546.771) [-540.585] (-541.438) (-541.838) -- 0:00:35

      Average standard deviation of split frequencies: 0.010854

      395500 -- (-541.956) (-542.286) [-543.872] (-542.799) * (-542.213) (-540.879) [-542.637] (-541.233) -- 0:00:35
      396000 -- (-547.719) (-546.538) (-541.453) [-540.755] * (-545.578) (-541.492) [-542.695] (-541.821) -- 0:00:35
      396500 -- (-544.732) (-543.966) [-543.734] (-546.591) * (-548.138) (-546.010) (-546.908) [-545.078] -- 0:00:35
      397000 -- (-543.076) (-543.536) [-542.470] (-544.905) * [-541.674] (-543.018) (-542.844) (-542.164) -- 0:00:34
      397500 -- (-542.460) [-543.267] (-541.959) (-542.261) * [-543.567] (-542.828) (-547.968) (-541.313) -- 0:00:34
      398000 -- (-543.453) (-541.945) (-541.015) [-541.270] * [-541.498] (-544.004) (-545.532) (-542.195) -- 0:00:34
      398500 -- (-544.387) [-541.332] (-543.268) (-543.432) * [-542.858] (-543.524) (-542.178) (-541.129) -- 0:00:34
      399000 -- (-544.700) [-541.316] (-543.742) (-541.210) * (-542.001) (-543.165) [-541.060] (-541.879) -- 0:00:34
      399500 -- (-544.528) (-541.080) (-545.096) [-545.877] * [-543.751] (-542.321) (-541.085) (-542.330) -- 0:00:34
      400000 -- (-541.395) (-542.312) (-541.178) [-543.891] * [-541.037] (-542.660) (-541.251) (-544.108) -- 0:00:34

      Average standard deviation of split frequencies: 0.010520

      400500 -- (-545.338) (-544.872) (-544.193) [-542.209] * (-541.575) [-543.195] (-542.917) (-543.908) -- 0:00:34
      401000 -- [-544.017] (-545.051) (-541.142) (-541.328) * [-541.613] (-544.209) (-540.700) (-543.071) -- 0:00:34
      401500 -- (-541.662) [-540.694] (-542.066) (-542.421) * (-541.650) (-541.373) (-544.875) [-541.422] -- 0:00:34
      402000 -- (-541.199) (-541.449) (-541.388) [-542.064] * (-543.129) [-542.491] (-542.559) (-543.253) -- 0:00:34
      402500 -- [-541.963] (-542.634) (-541.247) (-542.027) * (-544.220) [-540.994] (-541.168) (-543.101) -- 0:00:34
      403000 -- (-544.859) [-542.497] (-541.620) (-548.494) * [-541.373] (-542.759) (-544.228) (-544.443) -- 0:00:34
      403500 -- (-543.390) (-541.891) (-540.992) [-546.401] * (-541.766) (-543.807) [-540.889] (-545.995) -- 0:00:34
      404000 -- (-542.187) [-544.157] (-542.333) (-541.401) * (-541.165) (-544.684) (-541.171) [-544.542] -- 0:00:33
      404500 -- (-542.638) (-542.358) (-544.767) [-542.057] * (-542.181) [-540.771] (-541.240) (-544.073) -- 0:00:33
      405000 -- (-544.388) [-541.413] (-541.892) (-541.134) * [-541.903] (-541.451) (-542.455) (-541.569) -- 0:00:33

      Average standard deviation of split frequencies: 0.010450

      405500 -- [-547.772] (-542.106) (-548.903) (-544.497) * (-546.896) [-542.865] (-540.509) (-542.906) -- 0:00:33
      406000 -- (-541.839) (-541.592) (-544.867) [-541.041] * (-543.400) (-545.318) (-541.832) [-541.968] -- 0:00:33
      406500 -- [-541.661] (-540.990) (-545.713) (-542.226) * [-542.768] (-542.367) (-543.330) (-543.343) -- 0:00:33
      407000 -- (-541.234) [-541.029] (-541.425) (-542.087) * (-543.483) [-544.207] (-544.326) (-545.882) -- 0:00:33
      407500 -- (-543.012) (-544.248) (-541.903) [-541.634] * [-549.511] (-545.157) (-543.928) (-542.866) -- 0:00:33
      408000 -- (-541.043) [-544.036] (-544.020) (-545.599) * (-544.391) (-543.387) [-545.353] (-544.689) -- 0:00:33
      408500 -- (-549.225) (-541.533) (-541.682) [-541.640] * (-540.395) (-542.708) [-542.470] (-541.880) -- 0:00:33
      409000 -- [-543.957] (-543.001) (-541.261) (-542.579) * (-541.721) [-541.967] (-540.284) (-542.843) -- 0:00:33
      409500 -- (-540.990) (-543.207) [-540.530] (-542.083) * (-540.962) (-540.810) [-540.698] (-542.168) -- 0:00:33
      410000 -- [-541.959] (-541.657) (-540.730) (-541.719) * (-540.597) [-540.286] (-540.364) (-541.862) -- 0:00:34

      Average standard deviation of split frequencies: 0.010601

      410500 -- (-542.428) [-541.982] (-543.348) (-542.600) * [-544.549] (-544.417) (-540.702) (-544.779) -- 0:00:34
      411000 -- (-542.867) [-541.544] (-544.108) (-541.738) * (-543.043) (-544.646) (-542.171) [-543.952] -- 0:00:34
      411500 -- (-545.350) (-542.385) [-542.298] (-541.598) * [-542.804] (-542.891) (-543.207) (-543.615) -- 0:00:34
      412000 -- (-542.759) (-542.943) (-542.859) [-545.858] * (-542.303) (-541.687) [-544.191] (-543.844) -- 0:00:34
      412500 -- (-543.745) [-545.182] (-545.353) (-548.745) * (-541.163) [-541.263] (-543.574) (-541.189) -- 0:00:34
      413000 -- [-540.974] (-541.481) (-544.768) (-543.532) * (-544.216) [-540.651] (-542.202) (-544.690) -- 0:00:34
      413500 -- (-543.338) [-542.699] (-546.790) (-543.046) * [-542.883] (-540.484) (-541.548) (-544.713) -- 0:00:34
      414000 -- (-542.403) (-543.529) [-540.424] (-547.011) * [-543.291] (-543.250) (-544.108) (-544.649) -- 0:00:33
      414500 -- (-541.767) (-540.968) [-541.482] (-544.349) * (-543.730) (-543.197) (-541.181) [-543.591] -- 0:00:33
      415000 -- [-542.043] (-542.626) (-543.850) (-542.025) * (-541.552) (-543.590) (-541.696) [-541.506] -- 0:00:33

      Average standard deviation of split frequencies: 0.010865

      415500 -- (-541.881) [-542.073] (-542.440) (-543.074) * [-542.880] (-545.055) (-540.713) (-542.909) -- 0:00:33
      416000 -- (-545.036) [-546.373] (-541.858) (-540.905) * (-541.833) (-541.617) [-542.187] (-541.177) -- 0:00:33
      416500 -- (-546.692) [-543.843] (-541.835) (-541.374) * (-542.682) (-543.441) [-542.973] (-542.517) -- 0:00:33
      417000 -- (-543.376) (-542.213) [-541.438] (-543.554) * (-542.350) (-548.317) (-540.848) [-542.313] -- 0:00:33
      417500 -- (-542.359) [-542.375] (-542.288) (-547.501) * [-540.475] (-552.604) (-541.571) (-541.242) -- 0:00:33
      418000 -- [-543.277] (-542.920) (-542.278) (-546.296) * (-543.486) [-540.663] (-541.524) (-542.977) -- 0:00:33
      418500 -- (-544.442) (-543.184) [-542.399] (-542.392) * (-544.284) (-541.062) (-540.844) [-542.770] -- 0:00:33
      419000 -- (-546.287) (-544.099) [-544.045] (-542.310) * (-544.292) [-542.142] (-542.233) (-542.769) -- 0:00:33
      419500 -- (-548.186) (-542.633) [-541.305] (-541.393) * (-541.853) (-544.440) [-541.115] (-541.651) -- 0:00:33
      420000 -- (-544.050) [-544.230] (-540.622) (-548.372) * (-541.618) (-543.148) [-541.472] (-542.855) -- 0:00:33

      Average standard deviation of split frequencies: 0.010349

      420500 -- (-542.130) (-541.975) [-542.502] (-543.759) * (-541.878) (-544.690) [-542.356] (-543.093) -- 0:00:33
      421000 -- (-543.129) [-545.356] (-544.730) (-541.966) * (-541.373) (-543.513) (-540.599) [-541.260] -- 0:00:33
      421500 -- (-543.078) [-541.408] (-541.378) (-540.760) * (-541.973) (-546.813) (-541.930) [-547.765] -- 0:00:32
      422000 -- (-542.536) (-543.892) (-542.701) [-546.431] * [-544.168] (-542.705) (-541.420) (-546.569) -- 0:00:32
      422500 -- (-545.629) (-541.851) [-542.559] (-541.128) * (-546.228) (-546.649) [-541.144] (-541.989) -- 0:00:32
      423000 -- (-542.170) (-543.459) (-547.817) [-541.327] * (-542.479) [-544.715] (-541.341) (-543.487) -- 0:00:32
      423500 -- [-541.842] (-541.840) (-542.869) (-542.090) * (-544.434) (-545.481) [-542.234] (-541.882) -- 0:00:32
      424000 -- (-542.237) (-544.698) (-542.626) [-542.325] * (-541.687) [-543.300] (-542.278) (-545.680) -- 0:00:32
      424500 -- (-540.787) (-541.915) [-541.694] (-542.928) * (-542.495) (-542.922) [-541.342] (-545.639) -- 0:00:32
      425000 -- (-542.723) [-540.900] (-542.471) (-545.534) * (-540.287) (-541.267) [-542.889] (-541.972) -- 0:00:32

      Average standard deviation of split frequencies: 0.009504

      425500 -- (-541.005) (-541.129) [-543.202] (-541.701) * (-542.913) (-545.292) (-543.714) [-542.139] -- 0:00:32
      426000 -- [-541.442] (-541.528) (-541.777) (-541.763) * (-542.353) (-548.690) [-540.866] (-548.250) -- 0:00:32
      426500 -- (-541.903) [-544.934] (-540.893) (-542.894) * (-546.615) [-541.526] (-544.989) (-546.623) -- 0:00:32
      427000 -- [-542.499] (-542.114) (-541.883) (-542.265) * (-543.688) (-541.652) (-543.811) [-540.639] -- 0:00:33
      427500 -- (-542.231) (-540.696) [-541.920] (-542.942) * (-546.914) [-542.229] (-543.717) (-542.117) -- 0:00:33
      428000 -- (-541.220) [-544.519] (-541.812) (-543.291) * [-543.957] (-543.922) (-541.274) (-543.242) -- 0:00:33
      428500 -- (-542.510) [-542.441] (-544.294) (-544.623) * (-541.981) (-541.377) [-545.943] (-546.995) -- 0:00:33
      429000 -- (-541.504) (-542.558) (-540.714) [-543.467] * [-540.771] (-542.274) (-543.161) (-542.418) -- 0:00:33
      429500 -- (-542.647) (-540.811) (-546.995) [-543.897] * (-542.730) (-541.406) [-541.599] (-540.454) -- 0:00:33
      430000 -- (-543.282) (-542.469) [-543.727] (-542.086) * (-540.782) (-542.288) [-541.415] (-542.587) -- 0:00:33

      Average standard deviation of split frequencies: 0.010109

      430500 -- [-547.107] (-542.182) (-542.049) (-543.396) * (-540.837) [-540.527] (-543.054) (-541.483) -- 0:00:33
      431000 -- [-545.290] (-542.182) (-546.981) (-543.965) * (-549.335) (-540.345) (-544.778) [-545.449] -- 0:00:33
      431500 -- (-542.719) [-542.172] (-542.626) (-540.758) * (-546.576) [-540.388] (-543.186) (-541.465) -- 0:00:32
      432000 -- (-543.314) (-545.433) (-541.991) [-540.582] * (-542.352) (-540.504) [-544.937] (-544.237) -- 0:00:32
      432500 -- (-545.782) (-546.873) [-540.819] (-541.299) * (-541.910) (-545.014) (-547.236) [-541.395] -- 0:00:32
      433000 -- (-547.124) (-541.416) (-542.994) [-541.210] * (-543.337) (-548.056) (-542.959) [-543.025] -- 0:00:32
      433500 -- (-544.945) (-541.473) (-542.579) [-543.493] * (-543.515) (-541.319) (-542.386) [-548.782] -- 0:00:32
      434000 -- [-541.289] (-542.691) (-542.406) (-542.912) * (-542.017) (-541.362) [-543.632] (-545.204) -- 0:00:32
      434500 -- (-540.799) (-546.619) [-540.873] (-540.632) * (-541.609) (-541.187) (-541.386) [-543.316] -- 0:00:32
      435000 -- [-542.892] (-549.030) (-540.747) (-541.911) * [-541.792] (-540.916) (-547.883) (-546.057) -- 0:00:32

      Average standard deviation of split frequencies: 0.010474

      435500 -- (-544.810) (-542.237) [-540.462] (-544.002) * (-542.730) (-543.740) (-540.845) [-544.115] -- 0:00:32
      436000 -- (-541.224) (-543.557) [-542.599] (-542.777) * (-541.709) (-541.895) (-542.624) [-541.867] -- 0:00:32
      436500 -- [-541.996] (-543.733) (-541.730) (-542.463) * (-541.387) (-542.493) [-544.744] (-541.808) -- 0:00:32
      437000 -- (-540.361) [-542.799] (-542.972) (-541.132) * (-543.259) [-546.222] (-542.376) (-541.989) -- 0:00:32
      437500 -- [-542.514] (-541.783) (-541.774) (-543.047) * (-541.522) [-546.163] (-542.253) (-545.228) -- 0:00:32
      438000 -- [-540.659] (-541.264) (-541.741) (-546.514) * (-543.023) [-549.295] (-540.674) (-541.934) -- 0:00:32
      438500 -- (-542.769) (-543.665) [-540.829] (-547.401) * (-542.924) [-544.553] (-541.204) (-543.848) -- 0:00:32
      439000 -- (-545.741) (-543.172) (-543.221) [-541.808] * (-543.189) [-541.853] (-542.176) (-542.112) -- 0:00:31
      439500 -- [-546.253] (-544.407) (-544.796) (-545.616) * (-543.889) (-543.029) [-541.688] (-542.942) -- 0:00:31
      440000 -- (-547.624) [-541.234] (-542.433) (-542.685) * (-541.043) (-542.265) (-542.912) [-542.665] -- 0:00:31

      Average standard deviation of split frequencies: 0.010497

      440500 -- [-541.455] (-541.524) (-542.932) (-541.274) * (-544.462) (-541.243) [-542.807] (-544.379) -- 0:00:31
      441000 -- (-544.757) (-541.524) (-543.943) [-541.142] * (-543.951) (-543.822) [-543.873] (-540.713) -- 0:00:31
      441500 -- [-540.918] (-544.056) (-542.256) (-542.657) * (-543.423) (-541.078) [-542.569] (-544.019) -- 0:00:31
      442000 -- (-541.633) (-543.413) (-542.459) [-546.357] * [-542.045] (-543.904) (-544.213) (-543.878) -- 0:00:31
      442500 -- (-542.775) [-547.402] (-542.524) (-543.241) * (-541.171) (-542.297) [-540.712] (-544.594) -- 0:00:31
      443000 -- (-544.872) [-544.263] (-542.538) (-543.152) * (-543.532) (-542.991) (-544.540) [-541.061] -- 0:00:31
      443500 -- (-543.881) (-542.643) (-542.878) [-545.892] * [-544.286] (-542.603) (-541.988) (-540.986) -- 0:00:31
      444000 -- [-541.923] (-543.230) (-542.068) (-542.344) * (-542.637) [-540.542] (-542.360) (-548.920) -- 0:00:31
      444500 -- [-543.069] (-545.194) (-543.658) (-541.997) * (-540.810) [-541.215] (-546.149) (-540.612) -- 0:00:32
      445000 -- [-541.790] (-543.994) (-540.701) (-542.286) * (-543.129) [-542.428] (-542.499) (-548.183) -- 0:00:32

      Average standard deviation of split frequencies: 0.010834

      445500 -- (-543.118) (-543.530) [-542.619] (-542.532) * [-543.513] (-544.042) (-544.813) (-544.141) -- 0:00:32
      446000 -- (-545.366) (-545.961) [-540.759] (-543.062) * [-542.907] (-541.685) (-542.856) (-543.820) -- 0:00:32
      446500 -- (-544.016) (-542.647) (-542.180) [-540.893] * (-547.182) (-541.563) (-541.995) [-541.071] -- 0:00:32
      447000 -- (-540.429) (-543.982) [-542.882] (-542.147) * [-541.913] (-547.662) (-540.875) (-542.607) -- 0:00:32
      447500 -- [-542.753] (-541.231) (-541.987) (-543.281) * (-541.876) (-546.985) [-542.419] (-541.470) -- 0:00:32
      448000 -- (-544.253) (-542.899) [-543.802] (-542.386) * (-542.892) (-541.784) [-540.885] (-546.613) -- 0:00:32
      448500 -- (-542.837) (-542.489) [-542.945] (-547.373) * (-543.163) (-543.340) (-545.372) [-545.722] -- 0:00:31
      449000 -- [-542.625] (-544.251) (-543.236) (-542.246) * (-542.692) [-541.482] (-544.003) (-541.434) -- 0:00:31
      449500 -- (-543.616) [-547.605] (-541.366) (-544.265) * (-543.387) [-540.731] (-542.852) (-540.273) -- 0:00:31
      450000 -- (-540.786) (-546.939) (-544.421) [-542.711] * [-546.286] (-543.179) (-542.906) (-543.283) -- 0:00:31

      Average standard deviation of split frequencies: 0.010264

      450500 -- [-540.800] (-543.376) (-545.699) (-541.762) * (-544.453) [-541.626] (-544.017) (-544.691) -- 0:00:31
      451000 -- (-542.860) (-544.139) (-542.552) [-545.136] * (-540.800) [-543.594] (-543.801) (-546.720) -- 0:00:31
      451500 -- [-548.757] (-544.433) (-542.697) (-542.056) * (-541.368) (-540.987) [-543.283] (-542.161) -- 0:00:31
      452000 -- (-541.687) [-541.109] (-543.120) (-541.269) * (-540.868) (-540.505) (-543.220) [-540.938] -- 0:00:31
      452500 -- (-543.217) (-541.803) (-541.302) [-541.938] * (-541.762) (-541.996) (-542.859) [-542.278] -- 0:00:31
      453000 -- (-546.346) [-543.367] (-543.814) (-543.336) * [-542.405] (-541.955) (-541.899) (-542.831) -- 0:00:31
      453500 -- (-541.932) (-542.311) [-542.847] (-542.558) * [-542.068] (-543.292) (-543.109) (-541.769) -- 0:00:31
      454000 -- [-543.612] (-548.344) (-544.261) (-546.834) * (-541.576) (-541.536) (-546.476) [-544.179] -- 0:00:31
      454500 -- (-540.891) (-544.478) [-545.507] (-543.696) * [-545.171] (-541.737) (-543.056) (-542.814) -- 0:00:31
      455000 -- (-541.752) (-544.388) [-543.519] (-545.755) * (-542.884) [-544.216] (-542.530) (-542.341) -- 0:00:31

      Average standard deviation of split frequencies: 0.010338

      455500 -- (-541.388) [-547.058] (-540.885) (-542.225) * (-546.988) (-541.178) (-540.778) [-542.541] -- 0:00:31
      456000 -- [-541.699] (-543.569) (-541.397) (-543.561) * (-542.742) (-542.351) (-541.130) [-544.733] -- 0:00:31
      456500 -- (-543.314) (-543.426) [-543.344] (-543.881) * [-542.158] (-548.208) (-544.856) (-542.880) -- 0:00:30
      457000 -- [-542.505] (-542.438) (-543.374) (-543.259) * [-542.798] (-542.096) (-543.510) (-544.249) -- 0:00:30
      457500 -- (-541.564) (-540.752) (-544.134) [-542.584] * (-541.411) (-547.647) (-540.987) [-540.969] -- 0:00:30
      458000 -- (-542.538) (-544.879) (-541.599) [-542.901] * (-540.294) (-542.822) [-541.057] (-541.265) -- 0:00:30
      458500 -- (-543.073) (-541.802) [-542.133] (-545.193) * (-541.905) (-542.641) [-542.152] (-541.725) -- 0:00:30
      459000 -- (-542.364) (-542.306) [-542.087] (-550.436) * (-543.052) (-540.499) [-541.609] (-541.844) -- 0:00:30
      459500 -- (-541.032) (-543.209) [-541.193] (-542.318) * [-540.467] (-549.844) (-544.137) (-544.362) -- 0:00:30
      460000 -- (-545.834) (-542.598) (-542.760) [-543.073] * (-542.869) (-540.993) [-542.988] (-545.353) -- 0:00:30

      Average standard deviation of split frequencies: 0.010297

      460500 -- [-542.585] (-543.235) (-541.229) (-544.018) * (-545.025) (-542.645) [-540.888] (-552.454) -- 0:00:30
      461000 -- (-544.347) (-543.693) [-541.805] (-543.965) * (-543.873) [-540.808] (-542.232) (-548.245) -- 0:00:30
      461500 -- [-541.894] (-545.106) (-543.728) (-547.787) * (-544.097) (-543.677) (-540.984) [-542.738] -- 0:00:30
      462000 -- (-544.192) (-543.623) [-544.358] (-546.580) * (-542.222) (-540.526) [-543.140] (-542.990) -- 0:00:31
      462500 -- (-547.362) [-542.482] (-543.630) (-544.136) * (-542.215) (-541.842) (-541.987) [-541.039] -- 0:00:31
      463000 -- (-540.780) [-542.594] (-543.101) (-540.626) * (-542.272) [-545.695] (-546.566) (-542.584) -- 0:00:31
      463500 -- (-543.452) (-543.280) (-543.249) [-542.416] * [-541.914] (-541.478) (-542.629) (-542.096) -- 0:00:31
      464000 -- (-542.131) (-541.102) (-543.434) [-541.653] * (-542.075) (-544.317) [-542.899] (-543.659) -- 0:00:31
      464500 -- (-547.082) (-540.742) [-543.338] (-541.751) * (-543.191) [-544.814] (-543.668) (-546.807) -- 0:00:31
      465000 -- (-544.752) [-540.799] (-544.827) (-544.026) * (-543.862) [-542.033] (-544.068) (-545.038) -- 0:00:31

      Average standard deviation of split frequencies: 0.009926

      465500 -- (-542.557) (-545.155) [-541.295] (-543.126) * [-544.624] (-544.636) (-542.665) (-546.870) -- 0:00:31
      466000 -- [-542.995] (-543.050) (-542.323) (-547.000) * [-542.366] (-541.299) (-542.364) (-547.634) -- 0:00:30
      466500 -- [-543.314] (-543.089) (-541.918) (-542.000) * (-545.639) (-542.773) [-543.730] (-542.931) -- 0:00:30
      467000 -- (-541.683) [-542.315] (-546.494) (-540.892) * [-542.691] (-541.591) (-543.310) (-546.065) -- 0:00:30
      467500 -- (-542.170) (-542.789) (-541.499) [-544.725] * (-542.726) (-542.777) (-542.021) [-543.045] -- 0:00:30
      468000 -- (-541.396) [-542.766] (-541.111) (-546.858) * (-544.657) [-543.034] (-540.849) (-542.645) -- 0:00:30
      468500 -- [-542.916] (-541.148) (-541.220) (-543.787) * (-542.516) [-540.998] (-545.329) (-540.659) -- 0:00:30
      469000 -- (-541.862) (-541.904) (-543.908) [-543.658] * (-542.842) [-540.579] (-544.589) (-545.431) -- 0:00:30
      469500 -- (-542.003) (-543.007) [-541.620] (-543.466) * (-542.808) [-540.309] (-543.978) (-543.688) -- 0:00:30
      470000 -- [-544.368] (-541.005) (-541.996) (-541.447) * (-542.115) [-541.207] (-540.620) (-543.991) -- 0:00:30

      Average standard deviation of split frequencies: 0.009577

      470500 -- [-540.613] (-541.760) (-543.524) (-542.580) * (-543.444) [-542.438] (-541.722) (-541.236) -- 0:00:30
      471000 -- (-542.979) [-543.380] (-546.172) (-547.137) * (-545.282) [-542.017] (-541.264) (-541.920) -- 0:00:30
      471500 -- (-543.413) (-542.571) (-542.084) [-541.710] * (-543.445) (-541.834) (-541.494) [-541.995] -- 0:00:30
      472000 -- (-545.827) (-545.095) [-542.030] (-541.462) * (-542.754) [-541.975] (-544.824) (-544.344) -- 0:00:30
      472500 -- [-543.516] (-543.975) (-540.528) (-541.014) * (-542.295) [-541.036] (-542.765) (-541.750) -- 0:00:30
      473000 -- (-544.020) (-548.763) [-540.336] (-541.915) * (-541.904) (-541.182) (-547.293) [-542.559] -- 0:00:30
      473500 -- (-541.953) (-542.854) (-541.677) [-544.960] * (-542.622) (-541.205) (-543.793) [-542.530] -- 0:00:30
      474000 -- (-541.739) [-542.481] (-542.030) (-542.064) * [-541.816] (-540.475) (-544.551) (-545.022) -- 0:00:29
      474500 -- (-542.397) (-542.221) [-543.401] (-544.866) * (-541.828) (-541.623) (-542.138) [-542.756] -- 0:00:29
      475000 -- (-544.080) (-541.050) (-540.358) [-540.749] * (-540.890) (-541.944) (-544.342) [-541.074] -- 0:00:29

      Average standard deviation of split frequencies: 0.009532

      475500 -- (-542.871) [-542.746] (-540.410) (-542.771) * (-542.136) (-544.959) [-542.417] (-542.610) -- 0:00:29
      476000 -- [-541.081] (-542.751) (-541.603) (-544.066) * (-544.916) (-543.184) [-545.076] (-543.992) -- 0:00:29
      476500 -- [-543.535] (-544.484) (-541.561) (-551.961) * (-543.899) (-540.771) [-546.008] (-543.431) -- 0:00:29
      477000 -- (-541.722) (-541.869) [-543.522] (-543.501) * (-542.225) (-541.780) (-543.384) [-543.620] -- 0:00:29
      477500 -- [-541.813] (-543.037) (-543.816) (-546.055) * [-541.548] (-542.661) (-540.898) (-542.116) -- 0:00:29
      478000 -- (-544.528) (-542.857) [-540.881] (-545.191) * [-541.358] (-543.167) (-541.420) (-543.014) -- 0:00:29
      478500 -- (-540.353) (-541.802) [-543.002] (-545.445) * [-542.370] (-542.885) (-541.433) (-544.851) -- 0:00:29
      479000 -- (-543.911) [-541.736] (-542.942) (-544.445) * (-540.514) (-541.451) [-543.430] (-543.907) -- 0:00:30
      479500 -- (-540.564) (-545.617) (-542.618) [-541.424] * (-541.010) (-541.265) [-542.479] (-540.688) -- 0:00:30
      480000 -- (-543.405) (-546.197) (-542.265) [-540.221] * (-543.273) [-540.851] (-543.415) (-541.574) -- 0:00:30

      Average standard deviation of split frequencies: 0.009256

      480500 -- (-544.334) (-544.735) [-542.068] (-546.501) * [-542.149] (-541.775) (-542.165) (-543.672) -- 0:00:30
      481000 -- [-542.344] (-543.782) (-542.016) (-544.403) * (-544.415) [-542.130] (-542.236) (-542.914) -- 0:00:30
      481500 -- (-544.880) (-542.690) (-543.639) [-542.707] * (-542.714) (-542.279) (-545.101) [-541.613] -- 0:00:30
      482000 -- (-542.914) (-542.170) (-545.058) [-542.656] * (-542.656) [-541.843] (-542.536) (-545.409) -- 0:00:30
      482500 -- (-542.912) [-541.276] (-543.240) (-544.558) * (-542.932) (-540.970) (-541.388) [-543.220] -- 0:00:30
      483000 -- (-542.048) [-544.131] (-542.305) (-543.724) * (-543.007) (-541.103) (-543.058) [-541.626] -- 0:00:29
      483500 -- (-540.911) (-543.957) [-544.343] (-543.805) * [-542.995] (-543.834) (-545.541) (-541.564) -- 0:00:29
      484000 -- (-540.668) [-543.494] (-548.906) (-541.005) * [-544.253] (-543.347) (-545.206) (-541.925) -- 0:00:29
      484500 -- (-543.445) (-541.762) [-542.520] (-541.415) * (-542.659) (-542.017) [-548.148] (-541.666) -- 0:00:29
      485000 -- (-543.411) (-543.042) (-544.680) [-544.518] * [-542.258] (-542.039) (-541.093) (-543.455) -- 0:00:29

      Average standard deviation of split frequencies: 0.009215

      485500 -- (-541.827) (-541.647) (-545.750) [-547.410] * (-542.769) (-544.053) [-542.705] (-547.324) -- 0:00:29
      486000 -- [-541.422] (-542.402) (-540.743) (-542.425) * (-545.039) [-545.078] (-541.546) (-540.771) -- 0:00:29
      486500 -- (-544.416) (-544.043) [-542.656] (-541.318) * (-543.398) (-546.273) [-541.519] (-541.141) -- 0:00:29
      487000 -- (-543.658) (-543.579) (-544.659) [-540.918] * (-543.413) (-543.945) [-543.599] (-541.659) -- 0:00:29
      487500 -- (-544.470) (-540.580) [-541.539] (-541.478) * (-543.717) [-544.296] (-543.925) (-540.644) -- 0:00:29
      488000 -- (-543.055) (-540.706) [-543.892] (-542.711) * (-542.452) [-544.629] (-541.684) (-543.356) -- 0:00:29
      488500 -- (-541.868) (-542.684) [-544.824] (-541.446) * (-546.639) (-541.339) (-541.779) [-541.602] -- 0:00:29
      489000 -- (-542.844) (-544.720) (-543.790) [-543.425] * (-544.386) (-543.751) (-542.645) [-541.100] -- 0:00:29
      489500 -- [-542.151] (-541.357) (-543.280) (-546.006) * [-544.034] (-543.010) (-544.762) (-541.151) -- 0:00:29
      490000 -- (-546.087) (-543.221) [-544.074] (-541.565) * (-543.428) [-543.276] (-540.650) (-542.563) -- 0:00:29

      Average standard deviation of split frequencies: 0.009667

      490500 -- (-541.858) (-541.926) [-544.034] (-543.821) * (-544.428) (-543.234) (-543.563) [-541.419] -- 0:00:29
      491000 -- (-540.605) (-546.944) [-541.446] (-541.983) * (-544.072) [-543.498] (-542.422) (-542.578) -- 0:00:29
      491500 -- [-542.595] (-543.378) (-541.494) (-545.859) * (-543.656) [-541.112] (-549.329) (-540.982) -- 0:00:28
      492000 -- (-542.711) (-542.390) [-544.268] (-542.717) * [-543.019] (-542.496) (-546.377) (-542.446) -- 0:00:28
      492500 -- (-541.032) (-540.954) [-541.428] (-541.605) * (-542.329) (-543.679) (-545.580) [-543.047] -- 0:00:28
      493000 -- (-541.707) (-541.212) [-541.341] (-544.364) * (-540.471) (-542.683) (-542.512) [-543.238] -- 0:00:28
      493500 -- (-542.612) [-542.705] (-546.070) (-545.161) * (-541.461) (-542.846) (-543.154) [-541.890] -- 0:00:28
      494000 -- (-541.219) (-543.594) (-546.913) [-542.821] * (-545.356) [-540.553] (-540.998) (-544.814) -- 0:00:28
      494500 -- (-541.009) (-541.579) [-541.225] (-542.692) * (-542.473) (-541.286) (-540.624) [-542.024] -- 0:00:28
      495000 -- (-542.317) (-541.578) [-540.858] (-542.437) * (-541.382) (-543.750) [-541.484] (-544.568) -- 0:00:28

      Average standard deviation of split frequencies: 0.010039

      495500 -- (-543.120) (-542.084) (-544.756) [-541.374] * (-540.595) (-542.383) (-541.283) [-542.340] -- 0:00:28
      496000 -- (-542.229) (-545.714) (-545.384) [-541.687] * (-541.085) (-542.406) [-540.681] (-543.858) -- 0:00:29
      496500 -- (-542.092) [-541.718] (-543.995) (-541.481) * (-540.951) [-542.621] (-540.786) (-541.732) -- 0:00:29
      497000 -- (-545.465) [-541.288] (-541.469) (-545.038) * (-542.083) [-542.527] (-541.447) (-541.393) -- 0:00:29
      497500 -- (-545.349) (-542.980) (-542.485) [-541.888] * (-540.938) (-542.109) (-540.615) [-540.722] -- 0:00:29
      498000 -- (-542.265) (-543.990) [-543.552] (-543.299) * (-547.810) (-543.046) (-543.850) [-541.399] -- 0:00:29
      498500 -- [-543.247] (-544.539) (-540.874) (-542.751) * [-543.140] (-544.930) (-542.599) (-543.642) -- 0:00:29
      499000 -- [-542.996] (-543.858) (-541.414) (-545.582) * (-544.555) (-541.935) (-542.675) [-542.336] -- 0:00:29
      499500 -- (-541.636) [-541.609] (-540.503) (-543.177) * (-544.301) [-544.552] (-543.599) (-543.255) -- 0:00:29
      500000 -- [-543.511] (-542.548) (-541.980) (-541.513) * [-542.008] (-542.710) (-541.920) (-544.106) -- 0:00:29

      Average standard deviation of split frequencies: 0.010063

      500500 -- (-542.176) [-541.746] (-542.956) (-541.001) * (-542.950) [-544.052] (-541.111) (-543.465) -- 0:00:28
      501000 -- (-542.320) (-541.375) [-544.613] (-540.505) * (-541.470) (-542.140) (-544.256) [-542.119] -- 0:00:28
      501500 -- [-543.930] (-540.558) (-541.546) (-543.319) * [-545.797] (-541.690) (-543.046) (-541.210) -- 0:00:28
      502000 -- (-543.817) (-545.609) [-542.815] (-542.554) * (-544.934) (-541.944) [-540.866] (-540.741) -- 0:00:28
      502500 -- (-542.869) (-542.133) [-543.030] (-549.315) * (-540.870) (-541.330) [-541.219] (-543.095) -- 0:00:28
      503000 -- (-541.615) (-544.383) [-543.494] (-545.648) * [-542.116] (-543.050) (-542.120) (-546.720) -- 0:00:28
      503500 -- [-542.291] (-543.091) (-542.048) (-544.986) * (-545.190) (-542.823) [-543.454] (-541.516) -- 0:00:28
      504000 -- (-542.171) [-546.879] (-545.678) (-542.980) * (-540.532) [-542.348] (-541.803) (-542.393) -- 0:00:28
      504500 -- (-541.488) [-541.806] (-541.068) (-540.953) * (-542.751) (-543.423) (-541.376) [-542.919] -- 0:00:28
      505000 -- (-542.085) (-541.854) [-542.469] (-542.573) * (-545.051) (-542.727) [-541.740] (-540.485) -- 0:00:28

      Average standard deviation of split frequencies: 0.010029

      505500 -- [-541.368] (-544.587) (-543.428) (-542.166) * (-542.801) (-540.679) [-542.205] (-540.929) -- 0:00:28
      506000 -- [-541.113] (-544.216) (-540.808) (-544.317) * (-541.023) (-541.018) (-542.985) [-543.735] -- 0:00:28
      506500 -- (-545.414) (-544.651) [-542.751] (-542.826) * (-544.821) (-542.057) (-543.701) [-541.696] -- 0:00:28
      507000 -- (-551.152) [-545.225] (-543.057) (-542.098) * (-541.871) (-540.916) (-546.734) [-541.060] -- 0:00:28
      507500 -- (-546.382) (-544.745) (-545.883) [-543.789] * (-542.483) [-542.281] (-546.472) (-542.680) -- 0:00:28
      508000 -- (-545.719) [-542.107] (-543.389) (-545.786) * (-541.394) [-541.331] (-541.187) (-542.804) -- 0:00:28
      508500 -- (-550.713) (-541.622) (-545.104) [-543.800] * (-543.023) [-543.724] (-541.947) (-543.161) -- 0:00:28
      509000 -- (-547.838) [-541.205] (-546.024) (-541.398) * (-542.100) (-541.768) (-542.163) [-541.901] -- 0:00:27
      509500 -- (-545.575) (-543.472) [-541.237] (-544.679) * [-544.574] (-542.509) (-541.649) (-542.265) -- 0:00:27
      510000 -- [-543.822] (-542.270) (-548.083) (-541.559) * (-541.401) [-545.460] (-541.711) (-543.654) -- 0:00:27

      Average standard deviation of split frequencies: 0.009611

      510500 -- (-545.773) [-542.563] (-540.676) (-543.121) * (-543.443) [-540.637] (-543.474) (-545.454) -- 0:00:27
      511000 -- [-550.180] (-544.360) (-540.639) (-542.977) * (-547.566) (-541.313) (-544.471) [-543.274] -- 0:00:27
      511500 -- (-545.139) [-542.740] (-545.978) (-547.914) * [-540.526] (-541.881) (-548.196) (-543.469) -- 0:00:27
      512000 -- (-541.908) [-543.545] (-541.796) (-542.740) * [-541.469] (-545.590) (-544.105) (-542.396) -- 0:00:27
      512500 -- [-543.832] (-551.056) (-541.690) (-541.425) * (-542.915) (-542.023) [-542.577] (-544.007) -- 0:00:27
      513000 -- (-542.458) [-544.500] (-543.419) (-542.526) * (-542.997) (-542.201) [-541.852] (-547.715) -- 0:00:28
      513500 -- (-540.775) (-542.925) (-542.880) [-542.296] * (-541.418) [-542.381] (-548.486) (-541.692) -- 0:00:28
      514000 -- (-541.648) [-541.582] (-542.766) (-544.587) * (-542.540) [-542.086] (-542.422) (-541.292) -- 0:00:28
      514500 -- [-541.467] (-543.555) (-544.986) (-543.418) * (-542.074) [-543.226] (-545.039) (-546.545) -- 0:00:28
      515000 -- [-542.726] (-541.799) (-546.365) (-546.357) * (-543.563) [-543.106] (-541.687) (-542.655) -- 0:00:28

      Average standard deviation of split frequencies: 0.009243

      515500 -- (-545.455) [-543.849] (-543.022) (-543.118) * (-541.157) [-542.763] (-540.891) (-541.667) -- 0:00:28
      516000 -- (-542.976) [-542.441] (-545.255) (-542.905) * (-540.682) (-543.015) (-542.910) [-541.212] -- 0:00:28
      516500 -- [-540.550] (-542.636) (-543.594) (-545.620) * (-541.054) [-541.454] (-542.695) (-542.038) -- 0:00:28
      517000 -- (-540.463) (-544.600) (-543.993) [-543.655] * [-544.224] (-542.786) (-546.271) (-540.860) -- 0:00:28
      517500 -- (-542.146) (-545.004) (-542.602) [-541.122] * (-549.983) (-545.300) (-541.086) [-541.976] -- 0:00:27
      518000 -- (-542.390) [-541.628] (-542.252) (-542.051) * [-544.882] (-543.797) (-543.364) (-545.980) -- 0:00:27
      518500 -- (-543.075) [-540.428] (-542.369) (-543.191) * (-544.303) [-541.933] (-547.363) (-545.392) -- 0:00:27
      519000 -- (-542.602) [-541.272] (-542.934) (-540.899) * (-542.839) [-542.602] (-541.682) (-545.763) -- 0:00:27
      519500 -- (-552.003) (-544.094) [-542.464] (-541.802) * [-540.826] (-542.439) (-541.267) (-544.378) -- 0:00:27
      520000 -- (-541.911) (-547.326) [-543.832] (-543.941) * (-545.335) [-542.079] (-543.012) (-546.701) -- 0:00:27

      Average standard deviation of split frequencies: 0.010013

      520500 -- [-542.952] (-540.344) (-543.131) (-543.266) * (-542.266) (-546.503) [-544.373] (-540.728) -- 0:00:27
      521000 -- (-542.134) (-542.426) [-542.397] (-542.847) * (-545.150) (-542.287) [-545.438] (-542.419) -- 0:00:27
      521500 -- (-543.227) [-542.073] (-542.895) (-543.898) * (-545.417) (-540.573) [-541.212] (-543.679) -- 0:00:27
      522000 -- [-541.544] (-541.458) (-543.111) (-546.821) * (-546.687) (-541.614) (-543.011) [-542.487] -- 0:00:27
      522500 -- (-542.275) (-541.828) (-542.729) [-544.345] * (-541.544) (-541.462) [-542.641] (-544.578) -- 0:00:27
      523000 -- (-540.699) [-543.014] (-540.247) (-548.287) * (-541.519) (-541.191) [-542.190] (-542.015) -- 0:00:27
      523500 -- (-540.557) (-541.912) (-540.988) [-543.059] * (-541.123) (-541.588) (-545.337) [-544.630] -- 0:00:27
      524000 -- (-542.122) (-541.372) (-542.109) [-540.833] * (-541.083) (-541.538) [-541.186] (-541.560) -- 0:00:27
      524500 -- (-542.404) (-544.961) (-541.878) [-544.120] * [-542.769] (-540.876) (-543.677) (-542.537) -- 0:00:27
      525000 -- [-542.507] (-543.581) (-543.746) (-546.591) * [-541.119] (-543.214) (-543.530) (-541.500) -- 0:00:27

      Average standard deviation of split frequencies: 0.009700

      525500 -- [-542.409] (-540.777) (-541.987) (-542.976) * (-545.100) (-540.332) (-540.761) [-542.664] -- 0:00:27
      526000 -- [-541.659] (-543.010) (-543.218) (-541.892) * (-540.755) (-540.428) [-541.260] (-545.093) -- 0:00:27
      526500 -- (-543.334) [-542.597] (-545.253) (-544.717) * [-541.121] (-544.193) (-541.277) (-543.034) -- 0:00:26
      527000 -- (-540.872) [-540.939] (-543.019) (-547.064) * (-542.243) (-541.344) (-543.272) [-546.312] -- 0:00:26
      527500 -- (-543.100) [-541.574] (-543.237) (-541.156) * [-543.729] (-544.493) (-543.243) (-542.384) -- 0:00:26
      528000 -- [-540.777] (-541.617) (-540.620) (-541.000) * (-540.761) (-541.670) (-541.297) [-542.993] -- 0:00:26
      528500 -- [-541.541] (-545.069) (-544.262) (-543.467) * (-542.176) (-541.626) (-542.899) [-548.620] -- 0:00:26
      529000 -- (-543.069) (-542.203) (-542.088) [-541.971] * (-543.080) [-541.990] (-544.643) (-551.444) -- 0:00:26
      529500 -- (-543.534) [-541.469] (-546.707) (-540.920) * (-543.433) [-543.364] (-541.447) (-542.970) -- 0:00:26
      530000 -- (-544.128) [-541.553] (-543.085) (-541.215) * (-542.513) (-541.916) [-540.703] (-543.088) -- 0:00:26

      Average standard deviation of split frequencies: 0.009928

      530500 -- (-543.418) (-543.581) (-546.454) [-545.359] * [-541.800] (-542.544) (-541.792) (-542.559) -- 0:00:27
      531000 -- (-543.726) [-542.414] (-542.640) (-552.463) * (-541.654) (-542.685) [-542.256] (-544.341) -- 0:00:27
      531500 -- [-542.798] (-544.370) (-548.853) (-543.294) * (-542.164) (-541.371) [-543.198] (-544.453) -- 0:00:27
      532000 -- (-544.443) (-541.434) [-542.020] (-542.778) * (-541.863) (-543.842) (-544.135) [-541.913] -- 0:00:27
      532500 -- (-545.579) [-541.011] (-547.316) (-543.252) * [-543.050] (-544.785) (-545.804) (-543.691) -- 0:00:27
      533000 -- (-546.612) (-542.905) [-545.490] (-549.625) * (-542.123) (-541.557) [-540.673] (-545.652) -- 0:00:27
      533500 -- (-542.759) (-540.819) [-541.206] (-547.755) * (-542.372) [-543.121] (-545.984) (-541.882) -- 0:00:27
      534000 -- [-541.011] (-543.147) (-541.259) (-545.642) * (-542.564) [-543.510] (-542.107) (-541.943) -- 0:00:27
      534500 -- (-543.110) (-543.039) [-544.536] (-544.495) * (-541.134) [-542.016] (-541.894) (-542.738) -- 0:00:26
      535000 -- (-541.675) (-542.591) [-541.836] (-543.883) * (-542.652) (-541.734) (-544.315) [-541.784] -- 0:00:26

      Average standard deviation of split frequencies: 0.009985

      535500 -- [-541.065] (-545.860) (-542.813) (-541.515) * (-541.609) (-542.478) (-545.863) [-542.221] -- 0:00:26
      536000 -- (-544.380) (-542.422) [-542.463] (-541.062) * [-540.796] (-541.006) (-545.531) (-545.264) -- 0:00:26
      536500 -- (-543.583) (-541.835) (-542.687) [-541.337] * (-543.138) [-541.731] (-544.775) (-543.443) -- 0:00:26
      537000 -- (-541.632) (-542.841) [-541.425] (-543.297) * (-540.932) (-540.744) (-543.026) [-542.392] -- 0:00:26
      537500 -- (-544.238) (-542.366) [-542.329] (-544.204) * (-541.864) [-543.935] (-542.736) (-543.402) -- 0:00:26
      538000 -- (-543.387) (-542.446) (-544.240) [-541.908] * (-541.636) (-542.552) (-540.329) [-541.289] -- 0:00:26
      538500 -- [-542.311] (-542.610) (-542.051) (-544.329) * (-541.361) (-542.160) (-540.881) [-541.216] -- 0:00:26
      539000 -- (-542.847) (-543.255) (-542.573) [-543.035] * (-545.593) [-543.846] (-544.233) (-543.676) -- 0:00:26
      539500 -- (-541.942) (-541.895) [-541.407] (-544.314) * (-542.140) (-541.472) (-542.743) [-540.816] -- 0:00:26
      540000 -- (-542.863) [-546.819] (-544.236) (-543.789) * (-543.123) (-542.646) [-541.672] (-541.292) -- 0:00:26

      Average standard deviation of split frequencies: 0.010206

      540500 -- (-542.708) (-542.322) [-541.931] (-541.624) * (-542.182) (-541.646) [-543.776] (-542.123) -- 0:00:26
      541000 -- [-543.174] (-543.383) (-543.146) (-541.879) * (-544.630) (-540.707) (-542.914) [-542.785] -- 0:00:26
      541500 -- (-542.577) (-542.312) (-542.002) [-541.691] * (-543.603) [-543.936] (-542.553) (-546.302) -- 0:00:26
      542000 -- (-544.428) (-546.373) (-541.531) [-541.364] * (-544.125) [-542.424] (-548.313) (-546.362) -- 0:00:26
      542500 -- (-541.718) (-546.986) (-540.951) [-540.779] * (-549.625) (-544.235) (-546.098) [-543.757] -- 0:00:26
      543000 -- (-541.064) (-541.155) [-546.364] (-543.623) * (-544.816) (-541.717) [-542.541] (-544.436) -- 0:00:26
      543500 -- (-541.751) (-542.191) [-544.466] (-542.426) * [-542.650] (-543.651) (-543.649) (-541.209) -- 0:00:26
      544000 -- (-541.638) (-541.975) [-543.227] (-543.424) * [-544.166] (-545.152) (-543.592) (-540.842) -- 0:00:25
      544500 -- (-544.193) (-543.320) [-543.247] (-548.538) * [-542.805] (-541.797) (-542.126) (-545.346) -- 0:00:25
      545000 -- (-547.855) (-544.543) [-544.662] (-542.183) * (-542.133) (-541.973) (-544.567) [-545.166] -- 0:00:25

      Average standard deviation of split frequencies: 0.009650

      545500 -- [-542.585] (-540.811) (-541.486) (-541.732) * (-546.803) [-544.609] (-545.774) (-542.986) -- 0:00:25
      546000 -- (-542.495) [-540.687] (-541.271) (-542.597) * (-544.075) (-542.642) (-549.674) [-546.202] -- 0:00:25
      546500 -- [-541.992] (-541.601) (-541.920) (-541.250) * [-542.890] (-542.232) (-542.438) (-549.294) -- 0:00:25
      547000 -- (-541.518) (-541.774) (-545.363) [-542.657] * (-546.984) (-541.819) (-545.997) [-542.704] -- 0:00:25
      547500 -- (-542.424) (-541.038) [-544.173] (-546.151) * (-541.538) [-541.317] (-541.561) (-540.351) -- 0:00:26
      548000 -- [-542.610] (-541.581) (-543.467) (-548.744) * (-542.600) [-541.754] (-543.345) (-545.074) -- 0:00:26
      548500 -- (-548.148) (-541.869) [-544.724] (-541.658) * (-543.915) (-542.439) [-545.418] (-544.616) -- 0:00:26
      549000 -- (-544.236) (-544.755) [-545.279] (-542.987) * [-544.722] (-542.922) (-542.639) (-547.569) -- 0:00:26
      549500 -- (-546.752) (-540.661) (-542.843) [-541.721] * [-542.473] (-544.077) (-541.626) (-540.373) -- 0:00:26
      550000 -- (-541.232) (-543.652) (-542.707) [-541.325] * (-544.316) (-544.406) [-542.364] (-542.435) -- 0:00:26

      Average standard deviation of split frequencies: 0.009165

      550500 -- (-544.885) (-543.729) (-541.938) [-542.014] * [-540.919] (-541.535) (-541.184) (-542.137) -- 0:00:26
      551000 -- (-544.967) (-541.846) [-543.201] (-545.131) * (-544.386) (-541.868) (-542.087) [-541.698] -- 0:00:26
      551500 -- [-542.515] (-541.816) (-541.179) (-542.240) * (-542.526) (-541.918) [-542.202] (-542.086) -- 0:00:26
      552000 -- (-540.630) [-541.211] (-543.800) (-541.517) * (-540.477) (-547.461) (-541.913) [-541.098] -- 0:00:25
      552500 -- (-540.431) [-541.167] (-545.612) (-546.755) * (-544.571) (-544.028) (-544.409) [-542.085] -- 0:00:25
      553000 -- (-541.356) [-540.846] (-543.000) (-543.258) * [-546.184] (-547.357) (-542.024) (-542.678) -- 0:00:25
      553500 -- (-542.196) (-544.896) [-543.551] (-541.417) * (-542.488) (-541.937) (-541.902) [-541.118] -- 0:00:25
      554000 -- (-543.065) (-545.857) (-541.845) [-542.397] * (-541.377) (-541.913) [-541.498] (-542.021) -- 0:00:25
      554500 -- (-541.572) (-546.011) [-543.818] (-542.561) * (-542.768) (-543.307) [-543.173] (-547.131) -- 0:00:25
      555000 -- (-542.864) (-543.564) (-541.216) [-541.968] * (-542.211) (-541.498) (-544.876) [-548.854] -- 0:00:25

      Average standard deviation of split frequencies: 0.008728

      555500 -- [-541.345] (-542.897) (-541.249) (-541.448) * (-541.315) (-542.872) [-543.215] (-541.386) -- 0:00:25
      556000 -- (-542.092) (-543.854) [-540.848] (-544.499) * (-541.169) (-543.971) [-548.609] (-542.996) -- 0:00:25
      556500 -- (-540.750) (-541.957) [-544.381] (-542.060) * [-541.137] (-542.454) (-543.931) (-543.574) -- 0:00:25
      557000 -- (-541.315) (-543.230) [-544.194] (-541.660) * [-543.435] (-542.654) (-541.578) (-544.037) -- 0:00:25
      557500 -- [-543.690] (-544.201) (-540.973) (-542.241) * (-541.500) (-541.124) [-541.747] (-541.868) -- 0:00:25
      558000 -- (-541.165) [-544.978] (-542.155) (-540.442) * (-544.250) (-541.119) (-546.265) [-542.606] -- 0:00:25
      558500 -- [-541.799] (-546.709) (-541.413) (-543.267) * (-541.960) (-543.243) [-541.436] (-542.539) -- 0:00:25
      559000 -- (-541.585) (-543.253) (-541.712) [-540.379] * [-542.873] (-541.726) (-543.655) (-541.726) -- 0:00:25
      559500 -- (-543.797) (-544.531) [-540.316] (-540.570) * [-540.891] (-540.237) (-544.350) (-551.631) -- 0:00:25
      560000 -- (-543.817) (-542.625) [-541.418] (-541.535) * (-540.872) (-541.365) [-543.746] (-546.742) -- 0:00:25

      Average standard deviation of split frequencies: 0.008705

      560500 -- (-541.730) (-541.731) (-544.473) [-543.041] * (-541.860) [-540.515] (-543.890) (-541.747) -- 0:00:25
      561000 -- [-541.431] (-542.147) (-543.998) (-544.412) * (-543.640) (-540.287) (-542.888) [-541.908] -- 0:00:25
      561500 -- [-542.490] (-548.607) (-544.022) (-542.704) * (-546.163) (-544.213) (-543.166) [-544.417] -- 0:00:24
      562000 -- [-540.874] (-547.226) (-542.355) (-540.261) * (-543.787) (-543.148) [-541.373] (-547.710) -- 0:00:24
      562500 -- (-541.847) (-545.351) [-545.876] (-541.483) * (-541.306) [-542.436] (-542.261) (-546.969) -- 0:00:24
      563000 -- [-548.650] (-544.312) (-542.240) (-543.171) * (-544.226) (-542.256) (-541.516) [-544.186] -- 0:00:24
      563500 -- (-543.723) (-542.411) [-540.524] (-541.003) * (-546.357) (-540.833) (-541.958) [-544.901] -- 0:00:24
      564000 -- (-543.998) [-542.644] (-540.522) (-542.197) * (-541.705) (-543.457) [-542.549] (-541.106) -- 0:00:24
      564500 -- (-545.837) (-542.887) (-541.265) [-541.990] * (-541.225) (-542.051) [-540.655] (-547.958) -- 0:00:24
      565000 -- (-543.336) [-541.967] (-542.413) (-541.486) * (-541.878) (-543.279) (-540.707) [-540.461] -- 0:00:25

      Average standard deviation of split frequencies: 0.008917

      565500 -- (-541.815) [-543.078] (-541.063) (-546.826) * (-542.184) [-542.214] (-540.389) (-541.173) -- 0:00:25
      566000 -- (-542.508) (-542.518) [-540.510] (-548.351) * (-540.868) (-543.725) (-542.129) [-540.429] -- 0:00:25
      566500 -- [-540.958] (-541.517) (-540.381) (-546.792) * (-542.970) (-542.762) [-545.385] (-540.746) -- 0:00:25
      567000 -- [-541.719] (-542.006) (-544.074) (-541.258) * [-542.268] (-541.402) (-541.106) (-544.873) -- 0:00:25
      567500 -- (-541.906) [-541.076] (-541.323) (-541.296) * (-542.037) [-542.567] (-544.337) (-542.447) -- 0:00:25
      568000 -- [-542.796] (-541.395) (-548.728) (-544.633) * (-541.574) (-545.717) [-543.670] (-541.275) -- 0:00:25
      568500 -- (-541.530) (-541.336) (-547.631) [-541.544] * (-541.942) [-544.555] (-546.922) (-545.206) -- 0:00:25
      569000 -- (-541.799) (-543.327) (-545.251) [-543.070] * (-543.391) [-542.886] (-548.029) (-545.355) -- 0:00:24
      569500 -- (-541.788) [-542.305] (-544.926) (-542.255) * [-541.112] (-542.012) (-545.230) (-543.739) -- 0:00:24
      570000 -- (-543.853) (-544.444) (-543.258) [-542.380] * [-540.910] (-541.297) (-542.645) (-543.283) -- 0:00:24

      Average standard deviation of split frequencies: 0.009184

      570500 -- (-545.307) (-544.054) [-542.066] (-540.873) * [-541.633] (-542.667) (-541.670) (-541.023) -- 0:00:24
      571000 -- (-541.055) [-542.328] (-541.291) (-544.312) * (-541.305) (-541.108) (-540.826) [-541.846] -- 0:00:24
      571500 -- [-540.932] (-543.888) (-542.687) (-555.075) * [-545.080] (-550.935) (-541.865) (-540.971) -- 0:00:24
      572000 -- [-541.278] (-543.474) (-544.190) (-542.370) * (-543.480) [-547.335] (-542.771) (-545.696) -- 0:00:24
      572500 -- (-541.786) (-542.806) (-543.073) [-542.915] * [-543.216] (-543.836) (-544.084) (-541.637) -- 0:00:24
      573000 -- [-541.521] (-541.667) (-542.502) (-543.169) * (-544.854) [-543.063] (-543.814) (-541.788) -- 0:00:24
      573500 -- (-541.745) (-540.793) (-544.773) [-547.553] * (-545.994) [-542.376] (-542.302) (-544.580) -- 0:00:24
      574000 -- (-541.321) (-544.244) [-541.176] (-541.967) * [-542.836] (-550.091) (-542.836) (-541.052) -- 0:00:24
      574500 -- (-542.189) (-543.606) (-541.288) [-541.460] * (-541.955) [-542.876] (-545.406) (-541.184) -- 0:00:24
      575000 -- (-542.166) [-545.071] (-541.145) (-549.608) * (-544.775) [-542.142] (-544.431) (-543.509) -- 0:00:24

      Average standard deviation of split frequencies: 0.009003

      575500 -- (-542.990) (-543.986) [-542.202] (-543.542) * (-542.126) [-540.836] (-541.715) (-542.150) -- 0:00:24
      576000 -- (-541.537) [-544.747] (-542.599) (-543.341) * (-543.552) [-541.023] (-541.577) (-540.875) -- 0:00:24
      576500 -- (-540.599) [-545.969] (-548.133) (-550.098) * (-542.026) [-540.901] (-543.551) (-548.626) -- 0:00:24
      577000 -- (-542.309) [-543.971] (-541.950) (-546.543) * (-547.631) [-541.182] (-540.906) (-546.765) -- 0:00:24
      577500 -- (-542.942) (-542.877) [-543.809] (-545.501) * [-543.883] (-544.173) (-546.081) (-542.780) -- 0:00:24
      578000 -- [-542.449] (-544.122) (-540.793) (-542.153) * (-540.843) [-544.235] (-547.062) (-543.340) -- 0:00:24
      578500 -- [-540.856] (-541.638) (-542.135) (-541.389) * (-542.916) (-544.767) [-541.306] (-543.853) -- 0:00:24
      579000 -- (-542.787) (-545.529) [-542.331] (-546.211) * (-543.501) (-542.721) (-543.228) [-540.711] -- 0:00:23
      579500 -- (-543.408) (-543.845) [-541.370] (-541.249) * (-544.910) (-545.706) (-545.326) [-543.754] -- 0:00:23
      580000 -- [-541.495] (-543.757) (-540.867) (-542.433) * (-545.366) (-543.088) (-542.148) [-544.957] -- 0:00:23

      Average standard deviation of split frequencies: 0.009121

      580500 -- (-543.299) (-541.430) [-540.877] (-541.852) * [-545.079] (-549.565) (-541.007) (-543.885) -- 0:00:23
      581000 -- (-542.587) (-542.807) [-540.515] (-542.516) * (-547.707) (-543.190) [-540.563] (-542.181) -- 0:00:23
      581500 -- (-541.400) [-542.346] (-549.810) (-543.799) * [-542.158] (-548.194) (-541.412) (-544.494) -- 0:00:23
      582000 -- [-541.502] (-541.395) (-545.121) (-544.442) * [-542.628] (-542.182) (-542.928) (-543.983) -- 0:00:24
      582500 -- (-540.885) (-542.561) [-543.658] (-542.286) * (-541.865) [-545.943] (-541.759) (-544.874) -- 0:00:24
      583000 -- (-542.196) [-541.439] (-542.340) (-541.919) * [-542.141] (-543.245) (-542.039) (-542.852) -- 0:00:24
      583500 -- (-545.101) (-542.957) [-543.087] (-543.151) * [-541.800] (-542.433) (-545.379) (-540.853) -- 0:00:24
      584000 -- (-542.619) (-546.284) (-544.138) [-542.361] * (-542.137) (-542.608) [-543.196] (-542.470) -- 0:00:24
      584500 -- (-540.437) (-542.234) [-543.829] (-544.481) * [-542.085] (-541.343) (-542.954) (-540.852) -- 0:00:24
      585000 -- (-543.194) (-541.796) [-541.387] (-544.171) * (-540.950) (-542.970) (-541.672) [-540.878] -- 0:00:24

      Average standard deviation of split frequencies: 0.008849

      585500 -- [-542.399] (-542.459) (-544.253) (-546.869) * [-544.157] (-542.981) (-542.158) (-541.338) -- 0:00:24
      586000 -- [-541.126] (-546.810) (-544.857) (-544.155) * (-543.126) (-544.762) (-541.530) [-541.520] -- 0:00:24
      586500 -- (-542.020) [-541.096] (-543.267) (-541.878) * [-542.340] (-543.797) (-541.592) (-542.234) -- 0:00:23
      587000 -- [-541.024] (-542.151) (-541.459) (-542.114) * [-541.411] (-540.869) (-544.280) (-542.096) -- 0:00:23
      587500 -- (-541.069) (-542.831) [-540.658] (-545.273) * (-544.375) (-542.138) [-541.372] (-542.861) -- 0:00:23
      588000 -- (-543.783) (-543.930) [-541.534] (-540.366) * [-542.844] (-542.103) (-543.905) (-540.521) -- 0:00:23
      588500 -- [-544.621] (-541.394) (-542.105) (-542.202) * (-542.263) (-542.179) [-541.963] (-540.834) -- 0:00:23
      589000 -- (-542.926) (-542.370) [-542.408] (-541.658) * [-542.363] (-543.397) (-543.246) (-540.745) -- 0:00:23
      589500 -- (-544.344) (-541.414) (-542.077) [-541.564] * (-543.427) [-543.099] (-543.213) (-541.792) -- 0:00:23
      590000 -- (-544.835) (-544.349) [-542.715] (-542.239) * (-543.822) [-542.472] (-543.228) (-543.049) -- 0:00:23

      Average standard deviation of split frequencies: 0.008823

      590500 -- (-541.058) [-542.641] (-542.807) (-542.204) * [-543.142] (-542.159) (-543.373) (-542.815) -- 0:00:23
      591000 -- (-542.910) [-543.253] (-546.255) (-545.361) * [-541.182] (-543.422) (-542.914) (-542.148) -- 0:00:23
      591500 -- (-543.397) (-543.228) [-541.206] (-540.775) * (-543.096) (-544.938) (-542.569) [-541.775] -- 0:00:23
      592000 -- (-542.295) [-541.474] (-545.024) (-543.246) * (-542.346) (-545.402) (-542.080) [-543.894] -- 0:00:23
      592500 -- [-542.696] (-541.174) (-540.680) (-545.072) * (-541.654) (-543.636) [-541.565] (-541.497) -- 0:00:23
      593000 -- (-541.246) (-541.597) [-542.890] (-543.677) * (-541.890) [-542.917] (-543.466) (-543.124) -- 0:00:23
      593500 -- (-544.951) (-542.607) (-546.527) [-544.133] * [-541.457] (-542.878) (-541.883) (-547.496) -- 0:00:23
      594000 -- (-541.327) (-543.675) [-541.209] (-543.430) * (-541.053) [-540.775] (-542.770) (-542.441) -- 0:00:23
      594500 -- (-544.095) (-545.441) (-542.162) [-543.581] * [-542.490] (-545.555) (-541.380) (-542.210) -- 0:00:23
      595000 -- (-541.900) (-544.585) [-544.609] (-544.381) * (-542.167) (-542.363) (-542.687) [-544.238] -- 0:00:23

      Average standard deviation of split frequencies: 0.008561

      595500 -- (-542.177) (-543.601) [-542.107] (-543.171) * (-542.114) (-547.187) [-540.710] (-540.326) -- 0:00:23
      596000 -- [-542.315] (-542.752) (-541.696) (-542.830) * (-545.344) (-544.425) (-541.909) [-543.650] -- 0:00:23
      596500 -- (-542.803) (-541.111) [-540.846] (-541.599) * (-543.251) [-541.277] (-541.931) (-543.053) -- 0:00:22
      597000 -- (-543.512) (-540.280) [-542.232] (-541.230) * (-545.453) (-542.694) [-543.538] (-542.244) -- 0:00:22
      597500 -- [-541.617] (-542.075) (-540.211) (-540.779) * (-544.017) [-544.820] (-544.427) (-546.896) -- 0:00:22
      598000 -- (-546.217) (-544.737) [-540.730] (-543.748) * [-543.058] (-543.332) (-543.517) (-543.783) -- 0:00:22
      598500 -- [-542.206] (-545.357) (-540.562) (-544.089) * (-543.757) (-543.802) [-541.435] (-542.585) -- 0:00:22
      599000 -- (-542.897) (-543.242) [-543.830] (-541.729) * (-541.178) (-542.763) (-540.985) [-542.052] -- 0:00:22
      599500 -- (-543.258) (-542.042) [-545.440] (-541.792) * [-541.749] (-543.292) (-542.945) (-543.384) -- 0:00:23
      600000 -- [-543.765] (-544.603) (-542.273) (-542.568) * (-540.931) (-541.010) (-544.724) [-543.984] -- 0:00:23

      Average standard deviation of split frequencies: 0.008910

      600500 -- (-547.144) [-543.462] (-540.928) (-540.688) * (-547.477) (-545.239) [-544.429] (-542.899) -- 0:00:23
      601000 -- (-544.189) (-542.092) [-540.744] (-540.504) * (-542.900) [-542.672] (-545.461) (-541.159) -- 0:00:23
      601500 -- [-543.492] (-540.949) (-541.089) (-540.726) * (-540.680) (-545.624) [-544.221] (-542.160) -- 0:00:23
      602000 -- (-545.617) (-544.348) [-541.240] (-541.236) * [-540.588] (-542.739) (-545.166) (-543.142) -- 0:00:23
      602500 -- (-544.450) [-543.964] (-540.906) (-540.992) * (-543.809) [-543.050] (-540.625) (-542.361) -- 0:00:23
      603000 -- (-543.436) (-541.518) [-541.168] (-547.980) * (-543.452) [-540.223] (-541.336) (-541.446) -- 0:00:23
      603500 -- [-544.236] (-545.065) (-544.075) (-546.375) * (-541.937) (-541.753) [-544.792] (-545.358) -- 0:00:22
      604000 -- (-543.070) (-541.297) [-540.907] (-542.450) * (-544.743) (-541.960) [-543.050] (-546.304) -- 0:00:22
      604500 -- (-542.477) [-542.135] (-542.138) (-541.164) * (-543.497) [-544.775] (-544.711) (-544.562) -- 0:00:22
      605000 -- (-542.190) [-544.062] (-543.647) (-540.579) * (-541.979) (-541.960) (-541.723) [-542.923] -- 0:00:22

      Average standard deviation of split frequencies: 0.008923

      605500 -- (-546.164) [-543.244] (-545.465) (-540.792) * [-542.722] (-540.901) (-542.185) (-546.281) -- 0:00:22
      606000 -- (-545.108) (-542.404) (-545.618) [-541.693] * (-545.909) [-540.759] (-542.720) (-542.830) -- 0:00:22
      606500 -- (-542.789) (-544.745) [-540.467] (-543.371) * (-542.509) (-542.625) [-540.814] (-546.745) -- 0:00:22
      607000 -- (-542.716) (-541.766) [-541.934] (-541.275) * (-544.203) (-541.474) [-540.486] (-544.759) -- 0:00:22
      607500 -- (-541.632) [-545.236] (-542.062) (-542.215) * (-545.021) [-541.150] (-541.957) (-544.385) -- 0:00:22
      608000 -- (-541.081) (-541.622) (-542.314) [-542.758] * [-543.243] (-544.352) (-540.933) (-542.347) -- 0:00:22
      608500 -- (-542.408) [-540.467] (-540.679) (-544.024) * (-542.212) (-541.758) [-541.977] (-540.982) -- 0:00:22
      609000 -- (-543.360) (-542.178) (-540.666) [-541.474] * (-543.754) (-542.066) (-541.063) [-543.652] -- 0:00:22
      609500 -- (-542.800) [-545.136] (-546.191) (-542.147) * (-542.621) (-541.159) (-541.840) [-543.893] -- 0:00:22
      610000 -- (-542.062) (-540.438) (-543.591) [-542.317] * (-540.927) (-547.042) [-542.233] (-541.113) -- 0:00:22

      Average standard deviation of split frequencies: 0.008900

      610500 -- (-540.272) [-540.924] (-546.148) (-540.480) * (-542.889) [-547.929] (-545.672) (-541.174) -- 0:00:22
      611000 -- [-540.428] (-542.967) (-545.515) (-540.718) * (-544.826) (-542.159) (-542.394) [-542.662] -- 0:00:22
      611500 -- (-548.469) (-540.868) [-543.373] (-544.156) * [-542.314] (-541.842) (-543.879) (-540.694) -- 0:00:22
      612000 -- (-541.225) [-543.433] (-542.399) (-542.514) * (-542.906) (-545.226) [-542.819] (-542.445) -- 0:00:22
      612500 -- (-543.075) (-541.460) [-541.069] (-542.388) * (-545.591) (-541.268) (-541.502) [-541.898] -- 0:00:22
      613000 -- (-544.962) (-542.957) (-541.872) [-541.306] * (-542.819) (-540.889) (-543.943) [-541.346] -- 0:00:22
      613500 -- (-544.129) (-541.812) (-542.777) [-541.836] * [-542.614] (-542.715) (-541.607) (-543.966) -- 0:00:22
      614000 -- [-541.291] (-543.694) (-542.944) (-540.981) * (-543.350) [-540.556] (-542.641) (-543.447) -- 0:00:22
      614500 -- (-541.078) (-543.625) [-541.709] (-543.368) * [-540.929] (-543.054) (-542.907) (-542.293) -- 0:00:21
      615000 -- (-548.729) (-540.724) (-541.887) [-541.974] * (-541.348) (-544.555) (-540.775) [-544.368] -- 0:00:21

      Average standard deviation of split frequencies: 0.008322

      615500 -- [-542.198] (-541.221) (-541.609) (-541.448) * (-543.305) (-544.313) (-541.487) [-541.799] -- 0:00:21
      616000 -- (-542.046) (-545.676) [-541.155] (-543.711) * (-543.167) [-542.600] (-543.461) (-544.683) -- 0:00:21
      616500 -- [-542.060] (-542.134) (-543.257) (-541.271) * (-544.063) [-541.324] (-543.565) (-540.779) -- 0:00:21
      617000 -- [-540.843] (-541.879) (-541.483) (-540.278) * (-544.049) (-541.804) (-545.855) [-545.321] -- 0:00:22
      617500 -- (-540.791) (-547.288) (-544.023) [-542.374] * (-540.852) [-543.749] (-540.957) (-545.717) -- 0:00:22
      618000 -- (-541.551) [-540.697] (-542.407) (-541.004) * (-541.524) [-542.402] (-542.474) (-544.907) -- 0:00:22
      618500 -- (-542.859) (-541.059) (-542.267) [-542.185] * [-541.786] (-543.142) (-541.552) (-540.927) -- 0:00:22
      619000 -- (-543.295) (-542.491) [-544.223] (-542.561) * (-542.790) [-541.268] (-541.257) (-542.335) -- 0:00:22
      619500 -- [-543.305] (-543.837) (-541.964) (-541.442) * (-541.408) (-541.323) [-541.161] (-545.534) -- 0:00:22
      620000 -- (-545.700) [-544.453] (-541.589) (-541.243) * (-543.408) (-542.730) [-541.807] (-543.138) -- 0:00:22

      Average standard deviation of split frequencies: 0.008924

      620500 -- [-542.332] (-541.048) (-542.047) (-543.986) * [-540.698] (-541.698) (-544.106) (-546.563) -- 0:00:22
      621000 -- (-541.899) [-541.850] (-541.017) (-544.570) * [-540.424] (-544.771) (-541.592) (-544.535) -- 0:00:21
      621500 -- (-541.926) (-547.788) [-541.685] (-540.774) * (-543.795) (-541.203) [-544.887] (-543.784) -- 0:00:21
      622000 -- (-542.015) [-544.019] (-542.453) (-541.747) * [-542.962] (-543.057) (-543.604) (-541.766) -- 0:00:21
      622500 -- (-541.767) [-542.520] (-542.440) (-542.443) * (-546.843) (-545.162) (-541.523) [-541.929] -- 0:00:21
      623000 -- (-545.254) [-542.052] (-546.295) (-540.455) * (-542.953) [-540.593] (-542.581) (-544.966) -- 0:00:21
      623500 -- [-542.372] (-541.391) (-543.147) (-540.455) * (-542.987) [-541.134] (-541.206) (-541.730) -- 0:00:21
      624000 -- (-542.656) [-545.886] (-541.415) (-543.986) * [-542.778] (-544.172) (-542.140) (-542.664) -- 0:00:21
      624500 -- (-542.305) (-542.371) (-542.814) [-543.571] * [-543.018] (-546.086) (-542.973) (-542.535) -- 0:00:21
      625000 -- (-550.697) (-541.009) [-540.856] (-542.189) * (-541.726) (-541.335) (-544.130) [-540.945] -- 0:00:21

      Average standard deviation of split frequencies: 0.008754

      625500 -- [-542.922] (-540.618) (-544.987) (-540.856) * (-541.684) (-541.856) (-541.653) [-543.967] -- 0:00:21
      626000 -- (-543.349) (-545.985) [-540.944] (-541.229) * (-544.172) (-546.380) [-540.769] (-544.237) -- 0:00:21
      626500 -- (-540.496) [-541.069] (-542.820) (-545.113) * [-541.427] (-544.395) (-542.718) (-542.000) -- 0:00:21
      627000 -- [-541.931] (-541.413) (-541.856) (-543.276) * (-542.351) (-541.039) [-541.852] (-542.211) -- 0:00:21
      627500 -- (-546.230) [-541.348] (-542.870) (-542.592) * (-545.742) (-543.579) [-541.830] (-543.389) -- 0:00:21
      628000 -- [-544.313] (-542.482) (-544.235) (-541.607) * [-543.035] (-541.909) (-541.510) (-540.997) -- 0:00:21
      628500 -- (-544.653) (-542.227) [-541.887] (-543.863) * (-542.678) [-542.707] (-541.924) (-543.732) -- 0:00:21
      629000 -- (-543.560) (-543.521) [-540.591] (-540.910) * (-542.185) [-542.504] (-542.355) (-543.216) -- 0:00:21
      629500 -- (-542.499) [-542.233] (-545.160) (-546.348) * (-542.235) (-543.218) (-541.150) [-542.290] -- 0:00:21
      630000 -- (-542.960) (-541.280) (-544.324) [-541.282] * (-541.860) (-548.657) (-542.302) [-546.071] -- 0:00:21

      Average standard deviation of split frequencies: 0.008970

      630500 -- (-545.310) (-541.318) [-541.494] (-542.488) * (-543.396) (-543.083) [-541.280] (-542.406) -- 0:00:21
      631000 -- (-545.424) (-542.176) (-543.052) [-543.848] * (-541.829) [-541.194] (-540.581) (-541.221) -- 0:00:21
      631500 -- (-548.682) [-544.577] (-541.083) (-541.275) * [-540.425] (-547.704) (-543.129) (-541.935) -- 0:00:21
      632000 -- (-546.047) (-543.364) (-542.425) [-540.929] * (-540.344) (-541.688) [-541.929] (-542.618) -- 0:00:20
      632500 -- (-542.154) (-543.033) (-544.502) [-544.605] * [-540.923] (-541.907) (-542.162) (-541.530) -- 0:00:20
      633000 -- (-542.928) (-543.424) (-543.393) [-541.914] * (-541.943) (-541.879) (-540.997) [-545.581] -- 0:00:20
      633500 -- (-542.830) (-542.837) [-541.628] (-541.569) * (-542.437) (-543.182) [-541.745] (-542.354) -- 0:00:20
      634000 -- [-543.560] (-542.608) (-541.539) (-540.229) * (-543.591) (-543.028) (-543.402) [-541.468] -- 0:00:21
      634500 -- [-544.171] (-542.325) (-540.938) (-540.359) * (-544.261) (-542.671) [-540.815] (-543.944) -- 0:00:21
      635000 -- (-548.601) (-543.337) [-540.511] (-541.725) * (-542.830) [-541.116] (-541.414) (-547.032) -- 0:00:21

      Average standard deviation of split frequencies: 0.009682

      635500 -- (-547.639) [-540.937] (-544.493) (-541.273) * (-541.374) (-541.378) [-541.689] (-542.395) -- 0:00:21
      636000 -- [-542.700] (-541.765) (-540.785) (-541.299) * (-542.400) (-543.308) (-544.302) [-541.764] -- 0:00:21
      636500 -- (-544.355) (-541.168) (-543.476) [-541.584] * (-541.152) (-542.203) [-541.908] (-544.873) -- 0:00:21
      637000 -- (-544.051) [-542.875] (-542.389) (-540.945) * (-542.110) (-546.061) (-543.633) [-545.392] -- 0:00:21
      637500 -- (-543.288) (-541.930) [-541.342] (-540.712) * (-542.838) (-542.026) [-545.069] (-545.090) -- 0:00:21
      638000 -- (-540.754) (-545.060) [-541.579] (-543.432) * [-542.812] (-544.669) (-544.536) (-541.229) -- 0:00:20
      638500 -- (-543.921) (-542.331) (-541.894) [-542.727] * (-542.292) [-544.323] (-541.428) (-544.302) -- 0:00:20
      639000 -- (-542.464) (-541.838) [-543.802] (-543.178) * [-541.677] (-543.150) (-542.549) (-546.428) -- 0:00:20
      639500 -- (-541.527) (-542.472) [-541.356] (-543.778) * (-541.402) (-542.483) [-541.494] (-541.414) -- 0:00:20
      640000 -- (-543.954) (-547.375) [-540.997] (-543.371) * (-541.924) (-546.521) (-542.088) [-541.044] -- 0:00:20

      Average standard deviation of split frequencies: 0.009244

      640500 -- (-545.929) [-544.903] (-542.689) (-544.187) * (-542.813) (-542.201) (-542.191) [-544.703] -- 0:00:20
      641000 -- [-545.565] (-543.479) (-542.296) (-542.262) * (-540.847) [-550.108] (-544.370) (-541.662) -- 0:00:20
      641500 -- (-546.675) (-542.986) [-541.393] (-542.613) * (-545.387) (-542.813) [-546.493] (-541.100) -- 0:00:20
      642000 -- (-544.166) (-545.666) [-540.521] (-540.964) * [-545.541] (-540.886) (-541.424) (-542.503) -- 0:00:20
      642500 -- (-542.747) (-545.925) (-544.201) [-542.256] * (-542.613) (-541.287) [-543.084] (-542.952) -- 0:00:20
      643000 -- (-543.554) (-541.558) (-545.579) [-543.145] * [-542.671] (-543.308) (-543.291) (-542.093) -- 0:00:20
      643500 -- (-542.742) (-544.197) [-542.528] (-541.406) * (-545.085) [-541.821] (-540.753) (-543.549) -- 0:00:20
      644000 -- [-544.788] (-540.706) (-544.483) (-541.193) * (-541.674) [-541.122] (-540.369) (-544.291) -- 0:00:20
      644500 -- (-543.862) (-543.210) (-544.412) [-547.176] * (-542.449) [-545.056] (-542.580) (-541.423) -- 0:00:20
      645000 -- [-541.152] (-542.519) (-543.897) (-545.108) * (-546.861) (-541.762) (-543.597) [-542.643] -- 0:00:20

      Average standard deviation of split frequencies: 0.009532

      645500 -- [-543.336] (-541.261) (-545.833) (-543.435) * (-543.517) [-541.658] (-540.377) (-541.093) -- 0:00:20
      646000 -- (-543.429) [-543.319] (-542.715) (-542.791) * [-541.193] (-541.190) (-542.768) (-543.811) -- 0:00:20
      646500 -- (-546.114) (-542.448) [-540.776] (-542.309) * (-540.450) (-544.651) (-541.998) [-547.373] -- 0:00:20
      647000 -- (-541.937) (-542.330) (-544.697) [-542.335] * [-540.910] (-547.286) (-546.280) (-544.578) -- 0:00:20
      647500 -- [-541.978] (-546.378) (-542.848) (-543.094) * [-544.792] (-545.988) (-541.561) (-542.059) -- 0:00:20
      648000 -- (-545.975) (-545.641) (-545.292) [-540.729] * (-542.874) (-544.438) [-542.700] (-542.858) -- 0:00:20
      648500 -- (-541.225) (-548.732) (-542.135) [-542.047] * (-541.237) [-542.674] (-548.063) (-544.459) -- 0:00:20
      649000 -- [-544.975] (-544.000) (-543.517) (-541.092) * (-542.565) [-545.918] (-543.664) (-541.742) -- 0:00:20
      649500 -- (-541.499) [-541.284] (-550.725) (-541.659) * [-543.478] (-543.752) (-542.331) (-546.644) -- 0:00:19
      650000 -- (-543.255) [-544.712] (-548.596) (-541.320) * (-544.401) (-542.022) (-543.086) [-540.597] -- 0:00:19

      Average standard deviation of split frequencies: 0.009917

      650500 -- (-540.836) (-543.452) [-544.955] (-541.870) * (-543.858) [-541.260] (-541.565) (-541.934) -- 0:00:19
      651000 -- (-540.459) [-541.212] (-542.815) (-541.998) * [-544.180] (-543.545) (-545.001) (-544.795) -- 0:00:19
      651500 -- (-541.682) [-544.925] (-543.808) (-541.771) * (-542.975) (-548.246) (-543.504) [-541.514] -- 0:00:20
      652000 -- (-540.942) (-544.683) [-541.387] (-544.211) * [-548.082] (-542.834) (-547.386) (-541.580) -- 0:00:20
      652500 -- (-544.971) [-541.591] (-546.460) (-542.605) * (-543.268) [-542.783] (-540.599) (-541.935) -- 0:00:20
      653000 -- (-542.394) (-540.916) (-543.024) [-540.985] * (-543.450) [-543.070] (-540.717) (-541.589) -- 0:00:20
      653500 -- [-542.278] (-540.647) (-542.658) (-542.838) * [-546.250] (-543.203) (-541.368) (-540.552) -- 0:00:20
      654000 -- (-541.060) (-540.377) [-543.314] (-541.124) * (-545.256) (-543.768) (-541.385) [-543.296] -- 0:00:20
      654500 -- (-547.260) (-541.190) [-541.622] (-543.774) * [-544.517] (-541.309) (-541.992) (-541.817) -- 0:00:20
      655000 -- (-543.159) [-542.577] (-541.638) (-542.597) * (-541.033) (-540.388) (-542.997) [-541.567] -- 0:00:20

      Average standard deviation of split frequencies: 0.009656

      655500 -- (-544.157) [-541.648] (-542.795) (-542.481) * (-541.219) (-542.815) [-543.201] (-542.557) -- 0:00:19
      656000 -- (-543.813) (-542.751) (-542.198) [-543.325] * [-543.307] (-542.236) (-543.386) (-544.004) -- 0:00:19
      656500 -- (-541.963) [-542.694] (-541.631) (-544.406) * (-541.614) [-540.628] (-544.622) (-541.781) -- 0:00:19
      657000 -- [-542.779] (-541.530) (-541.600) (-541.396) * (-542.467) [-540.906] (-543.666) (-542.546) -- 0:00:19
      657500 -- [-542.330] (-541.370) (-549.836) (-546.963) * (-545.270) [-542.886] (-545.533) (-542.547) -- 0:00:19
      658000 -- (-542.858) (-541.476) (-543.041) [-547.606] * (-548.707) (-540.833) [-543.933] (-542.263) -- 0:00:19
      658500 -- (-542.070) (-542.391) (-541.902) [-542.901] * (-542.972) [-541.138] (-544.967) (-542.289) -- 0:00:19
      659000 -- (-542.623) (-544.741) [-544.208] (-543.068) * (-542.724) [-540.996] (-543.014) (-541.592) -- 0:00:19
      659500 -- [-541.798] (-543.672) (-543.255) (-541.442) * (-542.757) (-541.309) [-543.828] (-540.633) -- 0:00:19
      660000 -- [-543.621] (-544.835) (-541.647) (-542.932) * (-541.368) (-545.049) (-545.686) [-542.547] -- 0:00:19

      Average standard deviation of split frequencies: 0.009677

      660500 -- (-542.263) (-541.640) [-542.201] (-545.434) * (-545.815) (-547.867) (-542.429) [-541.752] -- 0:00:19
      661000 -- (-541.644) (-543.053) (-543.571) [-542.907] * (-545.156) [-543.990] (-542.862) (-544.812) -- 0:00:19
      661500 -- (-546.580) [-541.457] (-542.318) (-546.254) * [-541.788] (-543.204) (-542.731) (-548.647) -- 0:00:19
      662000 -- (-545.039) (-544.229) (-542.084) [-541.412] * (-544.414) [-540.587] (-541.940) (-546.574) -- 0:00:19
      662500 -- (-543.896) [-543.391] (-541.211) (-541.488) * (-540.831) [-542.369] (-541.650) (-548.227) -- 0:00:19
      663000 -- [-542.008] (-543.154) (-548.393) (-542.147) * (-542.678) [-540.677] (-541.106) (-543.278) -- 0:00:19
      663500 -- [-541.801] (-544.774) (-544.046) (-545.937) * (-547.870) (-541.646) [-541.665] (-544.588) -- 0:00:19
      664000 -- (-544.499) [-541.280] (-544.528) (-544.701) * (-543.312) (-541.115) [-543.223] (-543.195) -- 0:00:19
      664500 -- [-543.734] (-546.053) (-543.336) (-543.735) * [-541.906] (-544.369) (-546.665) (-541.575) -- 0:00:19
      665000 -- (-540.679) [-544.998] (-543.245) (-545.886) * (-541.087) (-544.409) (-544.131) [-542.097] -- 0:00:19

      Average standard deviation of split frequencies: 0.010308

      665500 -- [-542.605] (-542.049) (-543.136) (-545.177) * (-542.386) (-540.898) [-545.276] (-543.682) -- 0:00:19
      666000 -- (-545.394) (-541.259) (-542.387) [-541.527] * [-543.929] (-541.856) (-546.021) (-542.621) -- 0:00:19
      666500 -- (-541.448) (-541.805) [-542.223] (-545.074) * (-541.686) (-543.049) (-543.853) [-542.802] -- 0:00:19
      667000 -- [-542.290] (-543.123) (-542.426) (-541.055) * [-541.152] (-542.454) (-540.927) (-544.445) -- 0:00:18
      667500 -- (-542.046) (-541.065) (-542.384) [-548.491] * (-542.877) (-543.776) [-541.027] (-542.742) -- 0:00:18
      668000 -- [-540.981] (-541.402) (-544.415) (-554.991) * (-541.407) (-545.910) (-542.621) [-541.710] -- 0:00:18
      668500 -- (-545.510) [-541.014] (-547.938) (-547.361) * (-541.662) (-543.242) (-541.488) [-546.082] -- 0:00:18
      669000 -- (-544.967) (-541.365) (-543.134) [-542.373] * [-545.415] (-540.425) (-541.363) (-545.913) -- 0:00:19
      669500 -- [-545.937] (-543.198) (-543.432) (-540.918) * (-542.376) (-544.011) [-541.631] (-541.634) -- 0:00:19
      670000 -- (-541.507) [-541.094] (-542.241) (-541.624) * (-543.781) [-541.065] (-543.136) (-540.334) -- 0:00:19

      Average standard deviation of split frequencies: 0.010148

      670500 -- (-542.906) (-545.583) (-541.485) [-541.658] * (-544.756) (-541.794) [-542.610] (-540.231) -- 0:00:19
      671000 -- (-543.866) [-540.900] (-542.442) (-543.920) * [-541.158] (-540.394) (-544.231) (-541.619) -- 0:00:19
      671500 -- (-542.934) (-541.384) [-544.857] (-547.062) * [-544.231] (-543.352) (-543.692) (-542.171) -- 0:00:19
      672000 -- (-543.670) (-541.625) (-543.825) [-543.239] * (-542.061) [-540.954] (-543.431) (-542.836) -- 0:00:19
      672500 -- (-542.273) (-541.230) [-541.631] (-543.539) * (-543.255) (-540.328) [-542.172] (-544.665) -- 0:00:18
      673000 -- (-542.620) [-542.462] (-542.534) (-540.229) * (-541.244) [-541.177] (-543.462) (-545.807) -- 0:00:18
      673500 -- (-543.257) [-542.326] (-541.660) (-544.303) * (-543.051) (-542.323) [-544.460] (-544.355) -- 0:00:18
      674000 -- (-542.821) [-540.722] (-540.777) (-541.680) * (-544.078) [-540.995] (-543.569) (-543.372) -- 0:00:18
      674500 -- [-542.687] (-542.917) (-542.987) (-542.524) * (-543.558) (-545.720) (-543.108) [-542.059] -- 0:00:18
      675000 -- (-545.313) (-543.697) [-543.792] (-541.781) * [-542.392] (-542.659) (-545.806) (-546.551) -- 0:00:18

      Average standard deviation of split frequencies: 0.009981

      675500 -- (-545.095) (-545.227) [-542.061] (-541.011) * [-543.334] (-545.412) (-544.387) (-541.142) -- 0:00:18
      676000 -- (-543.048) (-542.259) (-540.957) [-540.853] * [-540.691] (-542.459) (-549.344) (-544.145) -- 0:00:18
      676500 -- (-545.395) (-543.575) [-541.718] (-547.989) * [-541.941] (-542.236) (-541.736) (-546.309) -- 0:00:18
      677000 -- (-544.476) (-541.648) [-541.062] (-544.774) * (-541.819) (-542.396) (-542.372) [-551.128] -- 0:00:18
      677500 -- (-542.745) (-543.525) (-541.162) [-545.376] * (-543.623) [-540.890] (-542.662) (-542.375) -- 0:00:18
      678000 -- (-545.495) (-542.897) [-540.889] (-544.617) * [-543.174] (-541.144) (-545.698) (-542.358) -- 0:00:18
      678500 -- (-540.846) [-542.044] (-542.762) (-541.496) * (-541.521) [-541.297] (-542.350) (-542.740) -- 0:00:18
      679000 -- (-540.920) (-543.444) (-542.771) [-543.665] * (-540.950) (-551.347) [-545.998] (-541.116) -- 0:00:18
      679500 -- (-541.007) [-543.845] (-542.173) (-546.561) * (-542.057) (-542.237) (-544.215) [-546.717] -- 0:00:18
      680000 -- [-540.730] (-543.640) (-541.885) (-542.142) * (-544.045) (-543.277) [-542.278] (-547.565) -- 0:00:18

      Average standard deviation of split frequencies: 0.009523

      680500 -- (-542.275) (-545.750) [-543.075] (-540.769) * (-547.045) (-541.726) (-545.594) [-544.134] -- 0:00:18
      681000 -- (-545.427) (-544.326) (-546.756) [-542.076] * (-545.388) (-540.941) [-540.961] (-540.500) -- 0:00:18
      681500 -- (-542.421) (-541.563) (-544.505) [-540.870] * (-543.319) (-541.998) [-541.424] (-540.332) -- 0:00:18
      682000 -- (-543.592) (-543.786) (-546.317) [-544.271] * (-543.890) (-543.661) [-543.744] (-544.546) -- 0:00:18
      682500 -- (-543.108) (-544.976) (-543.782) [-542.245] * (-542.956) (-546.054) (-541.739) [-541.411] -- 0:00:18
      683000 -- (-543.145) [-540.743] (-542.494) (-544.521) * [-544.537] (-544.167) (-542.867) (-541.082) -- 0:00:18
      683500 -- (-544.545) (-543.700) [-542.541] (-551.102) * (-545.385) (-542.869) [-542.382] (-543.402) -- 0:00:18
      684000 -- [-542.024] (-542.508) (-544.837) (-543.350) * [-543.108] (-543.099) (-542.971) (-544.233) -- 0:00:18
      684500 -- (-543.897) (-541.317) (-542.559) [-544.424] * (-542.284) [-541.283] (-546.399) (-543.961) -- 0:00:17
      685000 -- (-541.693) (-548.693) (-541.283) [-543.693] * [-541.869] (-541.023) (-544.744) (-540.846) -- 0:00:17

      Average standard deviation of split frequencies: 0.009363

      685500 -- (-540.691) (-544.514) (-542.267) [-540.852] * (-543.192) (-541.080) (-540.474) [-543.743] -- 0:00:17
      686000 -- (-541.378) [-541.365] (-540.156) (-545.236) * (-544.505) (-541.313) (-541.693) [-542.876] -- 0:00:18
      686500 -- [-540.735] (-543.624) (-540.206) (-545.329) * (-542.992) (-540.831) [-541.544] (-540.934) -- 0:00:18
      687000 -- [-543.293] (-542.022) (-543.931) (-542.333) * [-542.193] (-540.341) (-542.542) (-541.510) -- 0:00:18
      687500 -- (-541.694) [-545.283] (-545.275) (-544.381) * (-541.918) [-541.112] (-543.454) (-544.959) -- 0:00:18
      688000 -- (-542.458) (-544.720) [-544.624] (-542.871) * (-542.715) [-543.802] (-542.896) (-542.065) -- 0:00:18
      688500 -- [-542.526] (-542.990) (-541.888) (-543.276) * (-541.164) [-542.907] (-542.624) (-542.583) -- 0:00:18
      689000 -- (-544.414) (-540.179) [-540.857] (-543.527) * [-543.790] (-542.146) (-544.193) (-545.803) -- 0:00:18
      689500 -- (-543.169) (-544.555) [-543.401] (-543.780) * [-542.512] (-540.772) (-542.268) (-545.561) -- 0:00:18
      690000 -- (-545.174) (-541.216) (-545.177) [-543.709] * (-557.817) [-541.518] (-543.314) (-545.575) -- 0:00:17

      Average standard deviation of split frequencies: 0.009214

      690500 -- (-545.585) (-542.871) [-543.197] (-543.340) * (-545.679) (-547.645) (-543.428) [-544.760] -- 0:00:17
      691000 -- (-547.314) [-541.323] (-542.734) (-543.214) * [-541.553] (-543.854) (-542.417) (-543.051) -- 0:00:17
      691500 -- (-542.388) (-543.256) [-542.086] (-543.782) * [-541.445] (-541.840) (-543.264) (-541.680) -- 0:00:17
      692000 -- (-542.099) [-542.322] (-544.317) (-542.882) * (-544.594) [-543.202] (-543.948) (-544.247) -- 0:00:17
      692500 -- [-540.321] (-542.953) (-542.238) (-543.880) * (-544.673) (-542.501) (-541.766) [-541.475] -- 0:00:17
      693000 -- [-540.889] (-541.116) (-541.398) (-544.712) * (-543.626) (-542.083) (-542.424) [-546.764] -- 0:00:17
      693500 -- [-542.890] (-546.218) (-545.513) (-544.501) * (-541.305) (-543.630) [-540.649] (-542.555) -- 0:00:17
      694000 -- (-541.538) (-543.869) [-541.284] (-545.989) * [-540.599] (-540.772) (-541.221) (-541.117) -- 0:00:17
      694500 -- (-543.351) (-542.040) [-542.745] (-542.841) * (-544.083) [-541.123] (-543.751) (-544.619) -- 0:00:17
      695000 -- (-542.435) [-542.213] (-542.943) (-543.028) * [-541.394] (-541.463) (-544.300) (-542.618) -- 0:00:17

      Average standard deviation of split frequencies: 0.009017

      695500 -- (-542.946) (-540.486) (-541.821) [-542.862] * [-541.450] (-541.740) (-542.940) (-541.798) -- 0:00:17
      696000 -- (-542.587) (-546.537) [-541.745] (-544.899) * [-542.258] (-543.985) (-542.484) (-541.339) -- 0:00:17
      696500 -- (-543.538) (-544.104) (-540.959) [-547.167] * [-542.146] (-542.247) (-546.218) (-542.912) -- 0:00:17
      697000 -- (-546.524) [-540.593] (-541.200) (-542.098) * [-542.352] (-540.577) (-544.013) (-541.829) -- 0:00:17
      697500 -- (-543.464) (-540.953) [-543.324] (-541.319) * (-543.061) (-545.347) (-541.563) [-542.448] -- 0:00:17
      698000 -- [-541.884] (-543.011) (-542.729) (-544.242) * (-542.989) [-540.992] (-543.807) (-544.663) -- 0:00:17
      698500 -- (-542.576) (-541.215) (-545.411) [-543.401] * (-542.349) (-545.714) [-544.676] (-541.373) -- 0:00:17
      699000 -- (-542.296) (-544.757) (-546.803) [-543.351] * (-541.016) (-541.724) (-542.093) [-542.058] -- 0:00:17
      699500 -- [-541.570] (-542.259) (-543.510) (-544.916) * (-541.961) [-543.997] (-544.090) (-541.894) -- 0:00:17
      700000 -- [-540.832] (-543.016) (-544.531) (-542.209) * (-541.266) (-541.201) [-543.595] (-542.647) -- 0:00:17

      Average standard deviation of split frequencies: 0.008999

      700500 -- (-542.496) (-546.581) (-542.352) [-542.085] * [-541.037] (-543.359) (-542.528) (-541.403) -- 0:00:17
      701000 -- (-542.287) (-540.953) (-543.715) [-542.188] * (-541.040) (-543.909) [-543.906] (-543.619) -- 0:00:17
      701500 -- (-542.007) [-544.545] (-544.084) (-544.666) * (-540.816) (-544.671) (-543.120) [-542.967] -- 0:00:17
      702000 -- (-541.412) [-542.275] (-542.119) (-543.548) * (-545.040) (-541.662) (-543.152) [-542.405] -- 0:00:16
      702500 -- (-543.085) (-542.626) (-544.635) [-540.954] * [-542.716] (-541.419) (-542.674) (-541.185) -- 0:00:17
      703000 -- (-543.582) (-549.012) (-541.238) [-542.401] * (-540.992) (-542.297) [-545.631] (-543.082) -- 0:00:17
      703500 -- [-542.922] (-544.914) (-542.502) (-542.037) * (-541.637) (-546.216) [-542.531] (-543.101) -- 0:00:17
      704000 -- (-540.681) [-542.062] (-545.705) (-544.317) * (-543.978) (-545.039) (-545.318) [-540.751] -- 0:00:17
      704500 -- (-544.064) (-541.370) [-545.062] (-544.727) * (-546.007) (-541.704) [-541.774] (-547.373) -- 0:00:17
      705000 -- [-542.769] (-547.558) (-542.196) (-541.834) * (-542.484) (-541.554) (-541.117) [-541.369] -- 0:00:17

      Average standard deviation of split frequencies: 0.008597

      705500 -- (-542.939) [-545.106] (-542.369) (-543.375) * (-541.938) (-541.496) (-544.266) [-544.209] -- 0:00:17
      706000 -- [-541.463] (-541.438) (-540.458) (-542.428) * [-544.080] (-543.540) (-543.942) (-544.203) -- 0:00:17
      706500 -- (-543.167) (-541.910) [-542.979] (-544.296) * (-545.543) [-541.180] (-541.981) (-544.061) -- 0:00:17
      707000 -- (-543.477) [-541.057] (-543.169) (-542.015) * (-542.601) (-540.496) [-542.496] (-541.299) -- 0:00:16
      707500 -- [-542.457] (-541.006) (-541.421) (-544.459) * (-544.282) (-540.821) (-543.090) [-542.751] -- 0:00:16
      708000 -- (-542.296) (-543.121) [-541.739] (-542.833) * (-542.411) (-541.415) (-543.835) [-541.155] -- 0:00:16
      708500 -- (-540.434) (-542.396) (-544.445) [-542.324] * (-541.257) (-543.402) (-542.080) [-541.171] -- 0:00:16
      709000 -- (-542.045) (-542.588) [-543.951] (-546.638) * (-543.020) (-541.830) [-542.895] (-548.232) -- 0:00:16
      709500 -- [-540.860] (-544.157) (-542.955) (-541.844) * (-541.184) (-542.105) (-540.882) [-543.475] -- 0:00:16
      710000 -- [-542.986] (-541.185) (-543.323) (-544.125) * (-545.173) [-545.203] (-541.796) (-547.007) -- 0:00:16

      Average standard deviation of split frequencies: 0.008499

      710500 -- (-545.357) [-541.658] (-541.252) (-541.101) * (-544.950) (-546.094) [-542.775] (-546.383) -- 0:00:16
      711000 -- [-543.824] (-541.065) (-542.881) (-542.584) * (-542.724) (-543.798) (-543.531) [-543.221] -- 0:00:16
      711500 -- (-542.031) [-543.981] (-541.183) (-542.810) * [-544.218] (-541.383) (-540.942) (-543.570) -- 0:00:16
      712000 -- (-543.359) (-542.093) [-541.380] (-547.806) * (-540.766) (-541.397) (-542.192) [-543.139] -- 0:00:16
      712500 -- (-542.018) [-541.122] (-541.965) (-545.867) * (-542.489) [-543.157] (-541.298) (-545.698) -- 0:00:16
      713000 -- (-542.636) [-542.615] (-542.713) (-543.124) * (-547.155) [-541.122] (-542.663) (-541.922) -- 0:00:16
      713500 -- (-541.227) (-541.822) [-540.554] (-540.624) * (-543.643) (-541.582) (-551.115) [-542.759] -- 0:00:16
      714000 -- (-543.639) [-544.599] (-543.958) (-540.529) * [-542.489] (-541.725) (-548.204) (-540.559) -- 0:00:16
      714500 -- (-542.438) (-546.623) (-541.186) [-544.522] * [-543.594] (-542.157) (-541.228) (-542.394) -- 0:00:16
      715000 -- (-543.106) [-543.614] (-542.488) (-542.856) * (-546.040) (-540.410) (-546.683) [-544.349] -- 0:00:16

      Average standard deviation of split frequencies: 0.008559

      715500 -- [-541.204] (-544.226) (-545.329) (-543.149) * (-542.357) (-541.594) (-546.740) [-542.264] -- 0:00:16
      716000 -- (-540.952) (-541.281) [-543.181] (-544.839) * (-541.999) [-542.977] (-544.522) (-540.776) -- 0:00:16
      716500 -- [-545.465] (-541.270) (-544.890) (-540.512) * (-541.898) [-542.851] (-542.457) (-541.936) -- 0:00:16
      717000 -- (-543.782) (-543.251) (-543.306) [-540.574] * [-542.223] (-544.170) (-543.411) (-545.633) -- 0:00:16
      717500 -- [-542.274] (-541.028) (-545.830) (-542.704) * (-542.813) (-542.276) (-544.279) [-540.631] -- 0:00:16
      718000 -- [-542.422] (-542.240) (-545.176) (-542.998) * [-540.352] (-542.978) (-544.663) (-540.482) -- 0:00:16
      718500 -- (-540.957) (-541.564) (-541.761) [-541.896] * (-541.006) (-541.390) (-544.200) [-541.525] -- 0:00:16
      719000 -- [-543.937] (-541.945) (-542.040) (-542.992) * [-543.539] (-544.212) (-546.534) (-541.112) -- 0:00:16
      719500 -- (-544.378) [-542.051] (-543.423) (-548.636) * (-542.230) (-543.139) [-546.810] (-542.271) -- 0:00:16
      720000 -- (-545.792) (-544.747) [-543.097] (-548.048) * (-543.204) (-543.612) (-546.481) [-541.058] -- 0:00:16

      Average standard deviation of split frequencies: 0.009280

      720500 -- (-543.216) (-546.317) (-543.256) [-544.645] * (-546.415) (-544.921) [-542.326] (-540.859) -- 0:00:16
      721000 -- (-543.782) [-541.537] (-546.027) (-543.268) * (-544.833) [-540.649] (-543.402) (-541.953) -- 0:00:16
      721500 -- (-542.505) [-542.152] (-541.502) (-542.133) * [-541.117] (-543.504) (-541.829) (-545.404) -- 0:00:16
      722000 -- [-546.324] (-543.570) (-542.069) (-541.265) * (-542.285) (-542.728) (-544.506) [-541.839] -- 0:00:16
      722500 -- [-546.924] (-544.582) (-541.695) (-542.228) * (-542.012) [-542.510] (-543.095) (-542.078) -- 0:00:16
      723000 -- [-546.276] (-546.955) (-542.468) (-543.334) * (-541.965) (-542.303) (-541.726) [-541.317] -- 0:00:16
      723500 -- [-541.508] (-542.494) (-542.273) (-543.987) * (-544.824) (-551.649) [-540.524] (-543.733) -- 0:00:16
      724000 -- [-543.566] (-541.381) (-544.311) (-543.708) * (-542.193) (-544.099) (-540.821) [-540.411] -- 0:00:16
      724500 -- [-541.959] (-544.145) (-543.178) (-541.979) * (-543.263) (-547.162) [-542.747] (-542.216) -- 0:00:15
      725000 -- (-547.575) [-541.980] (-543.420) (-546.983) * [-541.015] (-545.593) (-542.587) (-544.187) -- 0:00:15

      Average standard deviation of split frequencies: 0.009131

      725500 -- (-542.562) (-540.842) (-541.563) [-542.018] * [-541.577] (-543.353) (-540.876) (-542.819) -- 0:00:15
      726000 -- [-542.791] (-548.956) (-542.615) (-540.759) * (-546.621) (-542.728) (-544.605) [-544.548] -- 0:00:15
      726500 -- (-540.947) (-543.166) [-542.094] (-544.530) * (-546.037) [-543.590] (-544.104) (-541.786) -- 0:00:15
      727000 -- [-540.976] (-543.909) (-541.388) (-543.011) * [-542.793] (-542.688) (-541.031) (-542.417) -- 0:00:15
      727500 -- [-542.833] (-540.584) (-547.373) (-542.417) * (-542.662) [-544.713] (-541.153) (-541.201) -- 0:00:15
      728000 -- (-551.031) (-540.648) [-541.814] (-544.044) * [-542.699] (-547.136) (-542.781) (-542.889) -- 0:00:15
      728500 -- (-545.165) (-543.658) [-543.124] (-546.226) * (-541.160) (-543.220) (-543.891) [-540.956] -- 0:00:15
      729000 -- (-543.187) (-543.694) [-541.815] (-540.824) * (-545.893) (-543.376) [-543.307] (-541.340) -- 0:00:15
      729500 -- (-544.294) (-542.300) (-542.085) [-542.715] * [-542.941] (-546.714) (-545.178) (-541.117) -- 0:00:15
      730000 -- (-543.502) (-546.010) [-542.394] (-541.899) * (-542.792) [-546.039] (-545.124) (-540.569) -- 0:00:15

      Average standard deviation of split frequencies: 0.008669

      730500 -- (-542.539) [-542.246] (-543.468) (-541.987) * [-543.452] (-546.386) (-543.031) (-542.209) -- 0:00:15
      731000 -- (-545.383) (-540.741) (-542.429) [-541.953] * (-543.096) (-540.710) [-541.613] (-545.239) -- 0:00:15
      731500 -- [-541.309] (-543.452) (-540.670) (-543.132) * (-541.159) [-540.710] (-542.922) (-542.503) -- 0:00:15
      732000 -- (-541.286) [-541.975] (-550.079) (-541.994) * (-543.330) [-548.257] (-543.502) (-543.683) -- 0:00:15
      732500 -- (-542.870) [-545.224] (-542.604) (-543.031) * [-545.004] (-541.185) (-542.700) (-541.794) -- 0:00:15
      733000 -- [-542.833] (-545.335) (-543.005) (-543.371) * (-544.105) [-545.510] (-543.784) (-540.902) -- 0:00:15
      733500 -- [-541.487] (-541.084) (-543.715) (-542.226) * (-543.260) (-542.543) [-541.393] (-541.853) -- 0:00:15
      734000 -- (-542.639) [-541.225] (-543.180) (-543.099) * [-540.750] (-541.219) (-541.684) (-541.244) -- 0:00:15
      734500 -- (-541.600) [-545.692] (-545.238) (-540.742) * (-545.154) (-541.805) (-547.319) [-540.872] -- 0:00:15
      735000 -- (-541.771) (-547.385) [-544.801] (-544.224) * (-541.478) (-540.236) (-544.562) [-541.896] -- 0:00:15

      Average standard deviation of split frequencies: 0.008887

      735500 -- [-542.019] (-549.868) (-550.588) (-547.042) * (-542.442) (-540.631) (-543.521) [-547.212] -- 0:00:15
      736000 -- (-546.266) (-546.382) [-542.240] (-548.096) * (-543.114) (-545.029) (-543.540) [-542.366] -- 0:00:15
      736500 -- (-544.619) [-541.313] (-547.628) (-541.138) * (-543.631) (-543.897) [-541.544] (-545.370) -- 0:00:15
      737000 -- (-543.722) (-545.807) [-544.997] (-541.405) * (-554.068) (-541.094) [-541.197] (-543.025) -- 0:00:15
      737500 -- [-542.920] (-544.338) (-542.153) (-542.102) * (-547.677) (-543.015) (-543.255) [-541.219] -- 0:00:15
      738000 -- (-540.834) [-541.962] (-540.247) (-543.182) * (-541.112) [-543.461] (-545.071) (-546.488) -- 0:00:15
      738500 -- (-540.691) (-543.010) [-541.586] (-541.080) * [-541.450] (-541.199) (-547.774) (-542.628) -- 0:00:15
      739000 -- [-542.802] (-543.120) (-541.389) (-541.746) * (-542.138) (-543.508) (-544.895) [-541.660] -- 0:00:15
      739500 -- (-543.681) [-543.102] (-541.029) (-541.898) * (-540.944) [-543.070] (-544.239) (-541.083) -- 0:00:15
      740000 -- [-541.935] (-543.780) (-542.237) (-542.765) * [-543.678] (-543.186) (-543.889) (-543.515) -- 0:00:15

      Average standard deviation of split frequencies: 0.010071

      740500 -- (-543.460) (-542.812) (-543.377) [-542.196] * (-543.481) (-545.195) [-541.797] (-544.341) -- 0:00:15
      741000 -- (-542.736) (-541.696) (-543.896) [-542.733] * [-541.661] (-542.548) (-543.437) (-546.490) -- 0:00:15
      741500 -- [-541.533] (-541.409) (-542.333) (-541.803) * (-541.084) [-540.483] (-540.495) (-541.856) -- 0:00:14
      742000 -- (-546.956) (-540.389) [-544.279] (-541.622) * (-541.342) (-541.148) (-541.736) [-543.922] -- 0:00:14
      742500 -- (-553.571) (-541.218) [-541.808] (-541.904) * (-543.085) [-540.730] (-541.384) (-548.871) -- 0:00:14
      743000 -- [-543.077] (-541.204) (-541.581) (-542.144) * (-541.067) (-541.216) (-541.057) [-543.245] -- 0:00:14
      743500 -- [-542.783] (-542.229) (-540.879) (-542.142) * (-548.817) (-541.620) (-541.407) [-542.126] -- 0:00:14
      744000 -- (-542.613) (-541.693) (-541.134) [-543.000] * (-542.802) (-540.231) (-541.024) [-543.190] -- 0:00:14
      744500 -- [-542.545] (-542.107) (-541.673) (-542.694) * [-542.533] (-540.212) (-545.131) (-549.384) -- 0:00:14
      745000 -- [-544.390] (-541.961) (-540.860) (-547.093) * [-544.163] (-540.770) (-544.576) (-542.975) -- 0:00:14

      Average standard deviation of split frequencies: 0.010408

      745500 -- (-540.606) (-543.736) [-540.802] (-542.168) * (-546.955) [-543.018] (-543.128) (-546.295) -- 0:00:14
      746000 -- (-541.276) [-543.353] (-541.364) (-543.224) * (-547.912) (-542.404) [-543.741] (-542.760) -- 0:00:14
      746500 -- (-541.882) (-542.123) [-542.453] (-545.705) * (-545.687) [-542.718] (-541.687) (-542.385) -- 0:00:14
      747000 -- [-541.090] (-541.528) (-542.523) (-545.962) * [-541.399] (-543.161) (-540.765) (-541.403) -- 0:00:14
      747500 -- (-542.373) (-540.702) [-541.668] (-545.237) * (-542.631) (-540.931) [-542.402] (-540.497) -- 0:00:14
      748000 -- (-542.828) (-542.103) (-542.123) [-542.201] * (-542.792) (-541.871) (-543.698) [-544.805] -- 0:00:14
      748500 -- (-544.836) (-544.536) [-543.676] (-542.489) * (-543.554) (-545.733) (-540.354) [-544.923] -- 0:00:14
      749000 -- (-543.852) (-542.889) (-542.996) [-542.085] * (-542.508) (-543.789) (-542.957) [-540.899] -- 0:00:14
      749500 -- (-541.604) [-540.909] (-540.515) (-543.787) * (-542.384) (-545.399) [-541.283] (-545.834) -- 0:00:14
      750000 -- (-546.201) [-541.752] (-540.651) (-545.865) * (-543.782) (-545.091) (-544.367) [-542.848] -- 0:00:14

      Average standard deviation of split frequencies: 0.009851

      750500 -- (-545.768) (-544.203) (-540.871) [-540.785] * (-543.769) (-542.742) (-541.512) [-541.807] -- 0:00:14
      751000 -- (-544.296) (-542.458) [-544.860] (-542.212) * [-546.245] (-543.352) (-541.827) (-543.679) -- 0:00:14
      751500 -- (-547.215) [-542.542] (-544.410) (-541.707) * (-544.691) (-543.435) (-542.135) [-544.462] -- 0:00:14
      752000 -- (-544.700) (-542.538) (-544.693) [-541.652] * (-544.366) (-544.957) (-540.841) [-544.109] -- 0:00:14
      752500 -- (-544.098) (-541.600) (-540.649) [-543.200] * [-540.931] (-540.615) (-542.160) (-543.822) -- 0:00:14
      753000 -- (-542.823) [-541.236] (-544.004) (-540.796) * (-542.572) (-542.494) (-541.375) [-543.160] -- 0:00:14
      753500 -- (-547.816) [-542.340] (-543.350) (-543.227) * (-541.114) (-543.546) [-542.448] (-543.668) -- 0:00:14
      754000 -- (-542.300) [-541.913] (-541.110) (-542.354) * (-542.970) (-542.262) [-546.135] (-542.574) -- 0:00:14
      754500 -- [-541.686] (-542.383) (-540.688) (-542.497) * (-542.618) [-542.282] (-544.473) (-542.391) -- 0:00:14
      755000 -- (-543.852) [-542.160] (-541.278) (-541.502) * [-544.044] (-541.959) (-545.623) (-542.679) -- 0:00:14

      Average standard deviation of split frequencies: 0.009665

      755500 -- (-547.717) [-542.891] (-542.522) (-541.519) * [-541.209] (-540.288) (-545.437) (-541.046) -- 0:00:14
      756000 -- (-541.741) (-543.514) [-543.466] (-542.705) * [-546.812] (-541.494) (-545.021) (-542.058) -- 0:00:14
      756500 -- (-541.234) (-542.198) (-544.050) [-541.458] * (-540.500) [-540.602] (-542.336) (-543.467) -- 0:00:14
      757000 -- (-540.702) [-541.408] (-548.688) (-544.114) * (-543.666) (-543.367) [-542.826] (-540.425) -- 0:00:14
      757500 -- (-541.854) [-543.363] (-546.596) (-545.097) * (-542.225) (-543.440) [-540.360] (-543.230) -- 0:00:14
      758000 -- (-541.516) (-541.927) (-541.509) [-546.300] * (-540.996) (-544.252) (-546.568) [-541.185] -- 0:00:14
      758500 -- (-540.929) [-543.946] (-545.208) (-547.752) * (-543.266) (-547.407) (-541.445) [-542.466] -- 0:00:14
      759000 -- (-544.043) [-542.609] (-545.399) (-540.951) * (-541.076) (-543.308) [-542.726] (-543.203) -- 0:00:13
      759500 -- (-545.328) (-542.672) [-544.273] (-542.340) * [-541.971] (-541.948) (-545.761) (-546.543) -- 0:00:13
      760000 -- (-546.096) (-542.326) [-542.243] (-542.076) * (-543.615) [-540.635] (-543.558) (-545.308) -- 0:00:13

      Average standard deviation of split frequencies: 0.009838

      760500 -- [-544.695] (-541.634) (-542.211) (-541.158) * [-548.429] (-542.205) (-547.013) (-542.242) -- 0:00:13
      761000 -- [-543.131] (-544.146) (-542.595) (-548.127) * (-542.110) [-543.662] (-544.876) (-541.559) -- 0:00:13
      761500 -- [-542.269] (-543.128) (-542.369) (-543.524) * (-541.805) (-543.385) [-543.294] (-543.234) -- 0:00:13
      762000 -- (-541.045) (-543.740) (-543.000) [-540.969] * (-545.736) (-543.264) (-550.318) [-540.598] -- 0:00:13
      762500 -- (-540.660) (-541.793) (-543.921) [-542.785] * (-544.207) (-546.646) (-544.450) [-544.288] -- 0:00:13
      763000 -- (-542.300) [-542.117] (-542.509) (-542.688) * (-540.828) (-544.983) [-546.132] (-542.411) -- 0:00:13
      763500 -- (-544.602) [-542.253] (-541.378) (-541.956) * (-547.644) [-542.625] (-540.693) (-542.035) -- 0:00:13
      764000 -- (-543.041) [-543.837] (-541.400) (-540.922) * (-543.324) [-542.159] (-541.709) (-543.773) -- 0:00:13
      764500 -- [-543.727] (-543.581) (-544.080) (-541.092) * (-548.441) (-541.467) [-541.336] (-541.455) -- 0:00:13
      765000 -- (-540.543) (-546.786) (-542.897) [-543.924] * (-544.435) [-541.338] (-541.031) (-544.830) -- 0:00:13

      Average standard deviation of split frequencies: 0.009693

      765500 -- [-543.776] (-542.435) (-541.789) (-541.268) * (-541.859) [-544.201] (-541.080) (-547.954) -- 0:00:13
      766000 -- [-547.334] (-543.626) (-542.050) (-542.517) * [-540.674] (-543.197) (-541.653) (-544.482) -- 0:00:13
      766500 -- (-540.835) (-546.116) (-542.046) [-542.119] * (-542.450) [-541.367] (-540.989) (-542.346) -- 0:00:13
      767000 -- (-540.894) [-543.727] (-541.367) (-542.161) * (-542.565) (-541.681) (-545.857) [-542.623] -- 0:00:13
      767500 -- (-540.959) (-540.891) [-541.457] (-546.589) * [-541.087] (-542.648) (-546.454) (-545.775) -- 0:00:13
      768000 -- (-541.799) [-543.012] (-543.924) (-543.989) * (-548.511) [-541.192] (-544.100) (-541.108) -- 0:00:13
      768500 -- (-542.795) (-543.797) (-544.259) [-541.944] * (-543.940) (-540.379) [-543.525] (-540.658) -- 0:00:13
      769000 -- (-544.540) [-543.845] (-541.745) (-544.726) * (-543.531) (-540.734) (-546.068) [-544.634] -- 0:00:13
      769500 -- (-540.522) (-544.158) [-541.138] (-544.852) * [-543.448] (-541.046) (-543.958) (-544.477) -- 0:00:13
      770000 -- [-543.308] (-543.269) (-542.813) (-545.915) * [-541.735] (-542.818) (-546.638) (-544.479) -- 0:00:13

      Average standard deviation of split frequencies: 0.009443

      770500 -- (-541.357) [-545.739] (-543.202) (-540.927) * (-540.625) [-542.314] (-543.019) (-544.017) -- 0:00:13
      771000 -- [-542.126] (-545.456) (-542.983) (-545.089) * (-542.827) (-541.039) [-541.512] (-543.070) -- 0:00:13
      771500 -- [-542.820] (-543.024) (-5