--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:37:01 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0069/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -541.87 -545.02
2 -541.84 -545.38
--------------------------------------
TOTAL -541.85 -545.22
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896810 0.088020 0.379227 1.507977 0.863928 1388.14 1444.57 1.000
r(A<->C){all} 0.156734 0.017875 0.000032 0.430068 0.120072 292.04 292.41 1.003
r(A<->G){all} 0.180185 0.021600 0.000029 0.468870 0.144488 169.86 193.77 1.004
r(A<->T){all} 0.161807 0.019422 0.000417 0.442837 0.125010 298.52 318.07 1.004
r(C<->G){all} 0.163843 0.019492 0.000199 0.436465 0.127563 260.95 316.31 1.003
r(C<->T){all} 0.177576 0.020995 0.000094 0.470954 0.143543 130.39 251.48 1.001
r(G<->T){all} 0.159856 0.018422 0.000084 0.427011 0.124374 202.11 232.24 1.000
pi(A){all} 0.214807 0.000409 0.175602 0.255607 0.214393 1311.83 1406.42 1.000
pi(C){all} 0.327974 0.000538 0.283598 0.373742 0.327590 1406.60 1447.10 1.001
pi(G){all} 0.267121 0.000494 0.224425 0.308248 0.267482 1403.87 1406.95 1.001
pi(T){all} 0.190099 0.000370 0.153863 0.227602 0.189364 1315.41 1356.35 1.000
alpha{1,2} 0.424273 0.246133 0.000146 1.416917 0.242261 1048.46 1106.82 1.000
alpha{3} 0.461024 0.242524 0.000289 1.456086 0.299727 1388.55 1444.78 1.000
pinvar{all} 0.995782 0.000030 0.986773 0.999997 0.997441 1258.77 1337.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -525.304808
Model 2: PositiveSelection -525.304808
Model 0: one-ratio -525.304916
Model 7: beta -525.304808
Model 8: beta&w>1 -525.304808
Model 0 vs 1 2.1600000013677345E-4
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C2
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C3
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C4
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C5
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C6
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132
C1 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C2 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C3 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C4 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C5 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C6 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
**************************************************
C1 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C2 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C3 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C4 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C5 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C6 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
**************************************************
C1 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C2 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C3 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C4 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C5 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C6 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 132 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 132 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3960]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3960]--->[3960]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.452 Mb, Max= 30.652 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C2 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C3 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C4 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C5 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
C6 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
**************************************************
C1 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C2 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C3 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C4 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C5 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
C6 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
**************************************************
C1 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C2 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C3 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C4 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C5 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
C6 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C2 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C3 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C4 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C5 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
C6 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
**************************************************
C1 TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C2 TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C3 TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C4 TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C5 TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
C6 TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
**************************************************
C1 AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C2 AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C3 AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C4 AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C5 AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
C6 AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
**************************************************
C1 GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C2 GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C3 GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C4 GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C5 GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
C6 GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
**************************************************
C1 CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C2 CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C3 CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C4 CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C5 CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
C6 CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
**************************************************
C1 TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C2 TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C3 TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C4 TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C5 TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
C6 TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
**************************************************
C1 CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C2 CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C3 CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C4 CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C5 CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
C6 CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
**************************************************
C1 CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C2 CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C3 CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C4 CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C5 CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
C6 CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
**********************************************
>C1
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C2
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C3
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C4
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C5
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C6
ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA
TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA
AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC
GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT
CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC
TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC
CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT
CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>C1
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C2
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C3
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C4
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C5
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
>C6
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 396 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790150
Setting output file names to "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1227373927
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0027983882
Seed = 1596822155
Swapseed = 1579790150
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -886.266852 -- -24.965149
Chain 2 -- -886.266937 -- -24.965149
Chain 3 -- -886.266987 -- -24.965149
Chain 4 -- -886.266937 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -886.266987 -- -24.965149
Chain 2 -- -886.266937 -- -24.965149
Chain 3 -- -886.266937 -- -24.965149
Chain 4 -- -886.266937 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-886.267] (-886.267) (-886.267) (-886.267) * [-886.267] (-886.267) (-886.267) (-886.267)
500 -- [-552.293] (-549.194) (-558.586) (-556.939) * [-544.985] (-556.749) (-554.503) (-555.594) -- 0:00:00
1000 -- [-546.704] (-549.347) (-555.604) (-561.580) * (-551.806) (-547.913) (-551.494) [-548.925] -- 0:00:00
1500 -- (-555.035) (-556.005) (-560.577) [-553.970] * (-551.785) (-557.917) [-547.594] (-551.187) -- 0:00:00
2000 -- (-549.500) (-550.381) [-548.226] (-549.254) * [-546.557] (-554.940) (-552.772) (-548.351) -- 0:00:00
2500 -- [-550.129] (-547.893) (-554.032) (-549.123) * (-559.286) [-551.690] (-550.268) (-555.676) -- 0:00:00
3000 -- (-549.578) [-548.453] (-547.677) (-552.884) * (-550.005) (-552.760) (-548.055) [-562.646] -- 0:00:00
3500 -- (-558.972) (-547.952) [-551.835] (-557.592) * (-548.074) [-545.685] (-551.062) (-554.078) -- 0:00:00
4000 -- (-558.212) (-551.762) [-548.810] (-553.238) * (-552.117) (-561.386) (-550.453) [-547.572] -- 0:00:00
4500 -- [-550.430] (-557.669) (-549.278) (-549.755) * (-557.258) (-551.793) [-549.093] (-550.416) -- 0:00:00
5000 -- (-547.514) (-558.186) (-551.698) [-552.002] * (-541.485) (-555.366) (-551.834) [-546.496] -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- (-550.744) (-552.814) [-548.647] (-545.258) * (-542.410) (-550.794) (-551.019) [-547.337] -- 0:00:00
6000 -- (-546.951) (-552.845) (-550.154) [-550.080] * [-540.723] (-549.154) (-559.503) (-567.809) -- 0:00:00
6500 -- (-564.029) (-559.023) (-557.052) [-550.006] * [-542.120] (-548.905) (-551.009) (-559.903) -- 0:00:00
7000 -- (-563.275) (-550.072) (-547.820) [-551.421] * (-542.359) [-547.337] (-558.816) (-550.895) -- 0:00:00
7500 -- (-549.913) [-549.131] (-558.083) (-552.703) * (-541.464) [-550.489] (-552.290) (-545.580) -- 0:00:00
8000 -- (-552.102) (-555.949) [-547.960] (-559.423) * (-542.715) [-555.425] (-558.707) (-542.271) -- 0:00:00
8500 -- [-550.679] (-557.445) (-550.188) (-549.931) * (-542.616) [-552.376] (-550.514) (-543.429) -- 0:00:00
9000 -- (-550.588) (-546.287) (-558.738) [-547.240] * (-541.644) (-567.161) (-553.997) [-541.805] -- 0:00:00
9500 -- [-549.422] (-566.741) (-548.117) (-547.798) * [-542.505] (-558.006) (-558.934) (-542.352) -- 0:00:00
10000 -- [-548.601] (-570.014) (-554.757) (-556.793) * (-541.895) (-556.757) (-558.278) [-543.347] -- 0:00:00
Average standard deviation of split frequencies: 0.090714
10500 -- (-554.992) (-557.531) [-557.137] (-556.947) * (-540.501) (-550.547) [-564.008] (-546.152) -- 0:00:00
11000 -- (-547.709) (-542.783) (-565.503) [-547.805] * [-541.375] (-546.169) (-562.148) (-542.889) -- 0:00:00
11500 -- (-550.665) (-543.031) [-544.224] (-552.467) * (-541.933) (-554.314) (-557.325) [-542.530] -- 0:00:00
12000 -- (-551.121) [-541.450] (-541.813) (-558.302) * (-542.734) (-555.394) [-550.548] (-543.175) -- 0:00:00
12500 -- (-554.087) (-541.349) (-542.863) [-553.596] * (-543.744) (-553.558) (-559.782) [-541.704] -- 0:00:00
13000 -- (-567.736) (-545.009) [-542.229] (-551.693) * (-544.092) [-548.216] (-557.514) (-542.167) -- 0:00:00
13500 -- (-552.814) (-541.910) [-542.826] (-553.783) * [-542.788] (-550.021) (-554.402) (-541.803) -- 0:00:00
14000 -- (-552.584) [-541.564] (-542.482) (-572.851) * (-543.186) (-547.228) (-551.917) [-541.839] -- 0:00:00
14500 -- (-540.470) (-541.123) [-541.323] (-558.771) * (-541.337) (-551.511) [-548.816] (-542.599) -- 0:00:00
15000 -- [-542.241] (-541.330) (-545.602) (-563.485) * (-543.665) [-550.333] (-554.135) (-541.753) -- 0:00:00
Average standard deviation of split frequencies: 0.068230
15500 -- (-543.552) (-544.441) (-542.201) [-545.290] * (-542.122) (-552.800) (-556.530) [-544.020] -- 0:01:03
16000 -- [-541.081] (-547.852) (-542.813) (-545.416) * [-544.883] (-551.597) (-543.870) (-547.154) -- 0:01:01
16500 -- (-541.666) (-544.163) (-543.056) [-546.177] * (-541.280) [-549.103] (-542.060) (-542.721) -- 0:00:59
17000 -- (-542.470) (-540.495) [-543.494] (-543.661) * (-544.083) (-569.389) [-540.936] (-541.039) -- 0:00:57
17500 -- [-541.780] (-542.274) (-543.285) (-541.600) * (-543.465) [-552.357] (-542.153) (-542.794) -- 0:00:56
18000 -- (-543.481) (-542.929) [-542.335] (-541.561) * (-544.260) (-554.428) [-542.221] (-541.241) -- 0:00:54
18500 -- (-542.905) (-543.333) [-541.213] (-542.439) * [-541.905] (-541.060) (-542.143) (-542.247) -- 0:00:53
19000 -- (-544.831) (-546.500) [-541.691] (-541.270) * (-541.673) [-544.498] (-543.232) (-540.485) -- 0:00:51
19500 -- (-545.256) (-544.073) [-543.200] (-541.277) * (-541.683) (-546.688) (-543.744) [-544.661] -- 0:00:50
20000 -- (-548.260) (-541.525) (-541.941) [-544.787] * (-541.567) (-542.222) (-544.645) [-546.438] -- 0:00:49
Average standard deviation of split frequencies: 0.062727
20500 -- (-541.973) (-547.029) [-540.799] (-544.311) * (-542.532) (-547.752) (-542.153) [-546.762] -- 0:00:47
21000 -- (-543.474) (-553.695) (-543.555) [-543.689] * [-542.263] (-543.386) (-540.828) (-540.420) -- 0:00:46
21500 -- (-540.755) [-542.132] (-549.711) (-543.863) * (-546.933) (-542.814) (-541.879) [-540.630] -- 0:00:45
22000 -- (-543.835) [-547.067] (-542.407) (-540.577) * [-542.572] (-544.745) (-541.266) (-542.054) -- 0:00:44
22500 -- [-544.569] (-544.422) (-543.567) (-542.345) * [-541.291] (-548.849) (-543.691) (-541.605) -- 0:00:43
23000 -- (-545.059) (-541.379) [-541.285] (-541.442) * [-544.268] (-544.752) (-542.613) (-541.872) -- 0:00:42
23500 -- (-545.891) (-543.748) (-541.767) [-540.840] * (-542.639) [-544.005] (-541.987) (-542.717) -- 0:00:41
24000 -- (-541.829) (-542.266) (-541.733) [-541.142] * (-543.002) [-543.830] (-540.751) (-548.179) -- 0:00:40
24500 -- [-543.837] (-544.177) (-542.656) (-542.599) * (-546.817) (-542.916) (-541.883) [-546.121] -- 0:00:39
25000 -- (-544.183) (-550.218) (-542.103) [-547.238] * [-542.972] (-543.722) (-540.652) (-544.270) -- 0:00:39
Average standard deviation of split frequencies: 0.043514
25500 -- [-542.168] (-545.140) (-543.644) (-541.131) * (-541.158) [-544.690] (-542.232) (-545.905) -- 0:00:38
26000 -- (-542.666) (-540.667) [-545.000] (-540.950) * (-541.519) (-541.670) [-541.969] (-540.765) -- 0:00:37
26500 -- (-543.137) (-542.251) [-543.318] (-541.601) * [-542.891] (-541.874) (-543.959) (-540.692) -- 0:00:36
27000 -- (-541.227) (-543.992) [-543.325] (-542.325) * (-542.104) [-543.833] (-545.791) (-540.886) -- 0:00:36
27500 -- (-544.522) (-541.879) [-540.662] (-541.909) * (-541.460) (-540.916) [-547.665] (-541.098) -- 0:00:35
28000 -- [-542.495] (-541.717) (-541.699) (-543.254) * (-540.685) (-542.934) (-543.871) [-541.162] -- 0:00:34
28500 -- (-541.642) [-542.947] (-546.046) (-542.812) * (-543.832) [-542.498] (-542.052) (-543.610) -- 0:00:34
29000 -- (-541.912) (-542.152) (-545.549) [-542.049] * (-542.962) (-542.422) [-542.371] (-544.106) -- 0:00:33
29500 -- (-544.172) [-541.507] (-542.723) (-543.095) * (-543.662) (-544.994) (-544.619) [-542.197] -- 0:00:32
30000 -- (-544.225) (-540.715) [-543.795] (-545.294) * (-543.255) [-543.310] (-546.556) (-543.025) -- 0:00:32
Average standard deviation of split frequencies: 0.040992
30500 -- (-541.851) (-541.087) (-544.850) [-542.762] * (-541.799) (-542.532) (-544.803) [-544.575] -- 0:00:31
31000 -- [-542.779] (-542.378) (-542.683) (-541.557) * (-541.731) (-542.306) (-543.125) [-541.232] -- 0:00:31
31500 -- (-542.861) [-542.576] (-544.956) (-541.526) * (-541.924) (-545.720) [-542.100] (-541.820) -- 0:00:30
32000 -- [-541.769] (-544.393) (-544.564) (-541.279) * (-542.794) (-541.469) [-540.834] (-543.102) -- 0:01:00
32500 -- (-541.709) [-544.117] (-543.392) (-542.502) * [-541.479] (-541.318) (-542.403) (-544.037) -- 0:00:59
33000 -- (-541.027) (-541.729) [-545.101] (-541.175) * (-542.723) (-543.414) (-544.691) [-544.533] -- 0:00:58
33500 -- (-542.007) (-540.799) [-544.848] (-548.990) * (-540.895) (-543.509) [-543.221] (-546.738) -- 0:00:57
34000 -- (-545.959) (-540.747) [-545.439] (-540.928) * (-541.662) (-542.574) [-543.842] (-541.204) -- 0:00:56
34500 -- (-541.790) (-540.335) [-541.867] (-541.401) * (-541.478) (-544.017) (-545.907) [-542.795] -- 0:00:55
35000 -- (-541.250) (-540.823) (-542.028) [-541.972] * (-544.249) (-543.528) [-542.437] (-542.581) -- 0:00:55
Average standard deviation of split frequencies: 0.039284
35500 -- (-541.545) (-543.373) (-541.842) [-541.820] * (-543.944) (-542.016) (-541.092) [-543.821] -- 0:00:54
36000 -- (-540.923) (-546.478) [-540.762] (-542.330) * (-544.153) (-541.954) [-542.240] (-545.069) -- 0:00:53
36500 -- (-540.867) (-544.073) [-542.254] (-542.091) * (-543.139) (-541.954) (-543.567) [-541.734] -- 0:00:52
37000 -- (-547.182) (-541.696) [-541.454] (-544.568) * (-541.999) (-546.376) [-541.291] (-540.418) -- 0:00:52
37500 -- (-543.849) [-542.242] (-541.342) (-543.386) * (-544.349) (-544.129) (-541.252) [-541.305] -- 0:00:51
38000 -- (-541.539) [-543.790] (-540.528) (-544.252) * (-540.983) [-545.852] (-542.017) (-544.344) -- 0:00:50
38500 -- (-546.444) (-544.638) (-543.592) [-540.624] * (-543.852) [-543.699] (-541.773) (-541.710) -- 0:00:49
39000 -- (-541.588) (-542.479) [-542.445] (-542.803) * [-542.066] (-544.685) (-546.196) (-543.204) -- 0:00:49
39500 -- (-542.611) [-542.445] (-543.683) (-541.145) * (-543.317) (-546.049) (-544.604) [-541.085] -- 0:00:48
40000 -- [-544.491] (-541.500) (-542.989) (-543.754) * [-540.755] (-541.975) (-542.489) (-541.917) -- 0:00:48
Average standard deviation of split frequencies: 0.031298
40500 -- (-542.617) (-541.982) [-543.972] (-542.640) * (-545.496) (-543.437) (-541.661) [-546.048] -- 0:00:47
41000 -- [-542.087] (-541.061) (-544.850) (-544.856) * (-543.732) (-542.751) (-541.894) [-543.626] -- 0:00:46
41500 -- [-541.239] (-541.459) (-545.228) (-545.161) * (-549.854) (-542.554) (-541.883) [-541.154] -- 0:00:46
42000 -- (-543.346) (-543.017) (-543.413) [-542.802] * (-542.170) (-544.450) [-541.884] (-544.769) -- 0:00:45
42500 -- (-546.947) (-543.914) [-541.987] (-545.873) * (-544.065) [-543.666] (-541.467) (-540.871) -- 0:00:45
43000 -- (-545.255) (-541.815) [-541.758] (-540.911) * [-541.491] (-540.796) (-544.531) (-541.799) -- 0:00:44
43500 -- (-544.037) (-541.332) (-541.751) [-541.181] * [-541.989] (-545.306) (-541.936) (-540.739) -- 0:00:43
44000 -- (-548.492) (-540.305) [-544.264] (-541.205) * (-541.905) (-543.441) [-543.156] (-547.262) -- 0:00:43
44500 -- (-543.249) [-541.588] (-541.583) (-541.413) * (-542.689) [-543.496] (-546.173) (-543.334) -- 0:00:42
45000 -- [-541.924] (-541.153) (-541.650) (-544.548) * (-542.524) [-541.033] (-543.124) (-541.654) -- 0:00:42
Average standard deviation of split frequencies: 0.026086
45500 -- (-550.019) (-542.983) [-546.565] (-543.921) * (-545.386) (-542.303) (-541.049) [-540.496] -- 0:00:41
46000 -- [-544.334] (-541.677) (-542.425) (-543.112) * (-541.116) [-541.151] (-542.693) (-541.752) -- 0:00:41
46500 -- (-541.755) [-542.098] (-541.027) (-543.569) * [-541.443] (-541.890) (-544.453) (-540.716) -- 0:00:41
47000 -- [-541.622] (-542.524) (-544.007) (-542.938) * (-540.688) [-542.631] (-541.203) (-542.348) -- 0:00:40
47500 -- [-546.222] (-543.890) (-542.423) (-541.723) * (-540.604) (-542.574) [-541.966] (-546.966) -- 0:00:40
48000 -- (-544.405) (-540.275) (-545.479) [-542.692] * [-540.648] (-541.513) (-548.082) (-546.053) -- 0:00:39
48500 -- (-543.338) (-546.412) [-544.988] (-541.073) * (-543.457) (-541.548) (-546.554) [-543.614] -- 0:00:39
49000 -- (-543.697) [-546.235] (-543.631) (-542.698) * (-542.132) [-544.158] (-542.646) (-543.425) -- 0:00:38
49500 -- [-540.927] (-544.038) (-541.935) (-541.412) * [-541.202] (-546.036) (-541.925) (-541.959) -- 0:00:57
50000 -- (-541.680) (-540.777) (-543.520) [-544.435] * (-541.399) (-544.439) (-542.093) [-542.861] -- 0:00:57
Average standard deviation of split frequencies: 0.027912
50500 -- (-544.611) (-543.289) (-541.658) [-544.186] * [-544.374] (-544.876) (-544.808) (-543.730) -- 0:00:56
51000 -- (-542.180) (-543.215) (-541.629) [-544.063] * [-542.420] (-541.192) (-543.599) (-548.385) -- 0:00:55
51500 -- (-542.631) [-540.528] (-543.381) (-541.952) * [-543.273] (-542.732) (-545.474) (-543.860) -- 0:00:55
52000 -- (-541.743) [-540.979] (-543.419) (-541.052) * (-541.460) (-544.031) (-544.430) [-542.314] -- 0:00:54
52500 -- (-543.407) (-542.781) (-544.713) [-540.744] * (-541.024) (-541.636) (-540.976) [-542.419] -- 0:00:54
53000 -- (-543.540) [-543.457] (-541.219) (-541.041) * (-545.411) (-541.015) [-542.286] (-545.017) -- 0:00:53
53500 -- [-541.154] (-543.235) (-546.597) (-543.567) * (-543.088) (-541.968) (-544.237) [-544.143] -- 0:00:53
54000 -- (-542.353) (-540.735) (-545.831) [-544.108] * (-542.633) (-541.388) (-540.188) [-541.581] -- 0:00:52
54500 -- [-543.365] (-545.244) (-541.324) (-542.532) * (-541.325) (-541.633) (-540.856) [-542.285] -- 0:00:52
55000 -- (-542.602) (-544.005) (-542.026) [-540.749] * [-541.697] (-546.204) (-542.145) (-542.010) -- 0:00:51
Average standard deviation of split frequencies: 0.031476
55500 -- [-542.994] (-542.341) (-546.366) (-544.444) * (-544.728) [-542.102] (-543.464) (-542.083) -- 0:00:51
56000 -- (-541.585) (-542.341) [-543.598] (-545.038) * (-543.505) (-544.835) (-543.059) [-540.616] -- 0:00:50
56500 -- (-540.766) [-541.413] (-540.741) (-543.051) * (-540.882) [-540.613] (-541.906) (-546.113) -- 0:00:50
57000 -- [-540.547] (-544.085) (-542.865) (-544.332) * (-541.578) (-543.032) [-541.341] (-543.163) -- 0:00:49
57500 -- (-542.749) [-543.272] (-543.391) (-542.025) * (-541.432) [-543.396] (-542.268) (-542.308) -- 0:00:49
58000 -- (-545.365) [-544.577] (-543.517) (-546.052) * [-541.795] (-543.718) (-541.464) (-541.500) -- 0:00:48
58500 -- (-545.984) (-546.576) (-540.618) [-546.648] * (-542.238) (-541.745) [-541.012] (-542.954) -- 0:00:48
59000 -- [-541.042] (-544.006) (-541.173) (-541.911) * (-542.968) [-541.704] (-541.332) (-541.674) -- 0:00:47
59500 -- (-543.241) (-544.905) (-540.669) [-544.323] * (-541.265) (-543.320) (-543.457) [-543.986] -- 0:00:47
60000 -- (-542.393) (-544.299) (-541.578) [-542.578] * (-541.223) [-542.472] (-542.103) (-542.843) -- 0:00:47
Average standard deviation of split frequencies: 0.030342
60500 -- (-548.284) (-543.666) (-542.085) [-543.008] * (-545.482) [-540.369] (-543.371) (-546.228) -- 0:00:46
61000 -- (-540.956) (-547.059) [-542.424] (-541.528) * [-544.281] (-541.552) (-544.298) (-542.350) -- 0:00:46
61500 -- [-544.573] (-544.464) (-541.196) (-541.725) * [-543.047] (-542.059) (-545.264) (-543.238) -- 0:00:45
62000 -- (-547.259) (-541.750) (-544.386) [-540.256] * (-542.154) (-541.401) (-541.074) [-541.222] -- 0:00:45
62500 -- (-542.128) [-545.887] (-543.338) (-541.696) * (-542.570) (-542.953) (-541.730) [-545.818] -- 0:00:45
63000 -- [-544.830] (-545.930) (-540.965) (-545.863) * (-547.273) [-542.519] (-543.083) (-541.315) -- 0:00:44
63500 -- (-543.419) (-540.955) [-543.249] (-542.201) * [-544.885] (-541.254) (-541.771) (-543.433) -- 0:00:44
64000 -- [-543.914] (-541.148) (-542.926) (-541.258) * [-547.644] (-542.095) (-542.560) (-543.406) -- 0:00:43
64500 -- [-542.562] (-540.708) (-543.764) (-540.903) * [-543.786] (-543.596) (-543.063) (-542.151) -- 0:00:43
65000 -- [-540.635] (-543.142) (-543.208) (-541.059) * [-541.256] (-544.963) (-547.232) (-543.172) -- 0:00:43
Average standard deviation of split frequencies: 0.028230
65500 -- (-542.278) (-544.602) [-542.212] (-541.872) * [-541.270] (-543.269) (-541.607) (-540.955) -- 0:00:42
66000 -- [-541.631] (-545.084) (-542.433) (-541.630) * [-541.553] (-545.086) (-542.092) (-542.885) -- 0:00:42
66500 -- (-540.927) (-545.216) (-541.628) [-544.619] * (-542.572) [-545.466] (-541.149) (-541.411) -- 0:00:42
67000 -- [-542.397] (-542.848) (-544.295) (-542.525) * (-543.731) (-544.760) (-541.253) [-540.709] -- 0:00:55
67500 -- (-547.515) (-544.393) (-543.824) [-542.525] * [-547.776] (-544.300) (-542.713) (-542.448) -- 0:00:55
68000 -- (-544.434) (-544.331) (-542.561) [-540.177] * (-547.176) [-541.145] (-542.799) (-543.173) -- 0:00:54
68500 -- (-543.753) [-541.637] (-542.841) (-541.457) * [-541.036] (-545.273) (-544.084) (-542.619) -- 0:00:54
69000 -- (-543.084) [-541.505] (-541.266) (-541.468) * (-541.389) [-542.534] (-545.978) (-541.689) -- 0:00:53
69500 -- (-542.288) (-541.901) (-541.475) [-541.040] * (-545.193) (-542.105) (-543.988) [-542.265] -- 0:00:53
70000 -- (-546.349) (-542.650) [-540.765] (-543.458) * [-541.866] (-541.313) (-542.614) (-543.368) -- 0:00:53
Average standard deviation of split frequencies: 0.025095
70500 -- [-542.120] (-541.544) (-542.765) (-541.323) * (-541.989) (-543.009) (-541.211) [-541.708] -- 0:00:52
71000 -- (-541.429) [-540.789] (-547.617) (-542.740) * (-543.683) (-542.063) [-542.170] (-541.319) -- 0:00:52
71500 -- [-540.912] (-541.371) (-546.549) (-540.605) * [-543.584] (-543.396) (-541.422) (-541.571) -- 0:00:51
72000 -- (-544.286) (-542.677) [-541.624] (-542.511) * (-543.330) [-546.527] (-542.359) (-544.898) -- 0:00:51
72500 -- (-541.198) [-542.882] (-542.709) (-541.298) * (-540.674) (-541.019) (-541.771) [-544.312] -- 0:00:51
73000 -- (-541.352) (-541.360) [-542.675] (-544.700) * (-540.778) [-541.631] (-545.409) (-541.604) -- 0:00:50
73500 -- (-543.336) (-542.549) (-544.529) [-542.499] * (-542.066) [-542.365] (-541.138) (-545.261) -- 0:00:50
74000 -- [-542.282] (-541.979) (-543.777) (-543.271) * [-544.760] (-542.205) (-540.799) (-542.464) -- 0:00:50
74500 -- (-548.901) (-543.407) (-540.867) [-541.165] * (-543.489) [-541.928] (-542.489) (-542.372) -- 0:00:49
75000 -- (-544.243) [-540.771] (-541.378) (-542.876) * (-542.082) [-543.156] (-544.109) (-541.789) -- 0:00:49
Average standard deviation of split frequencies: 0.025697
75500 -- (-544.548) [-544.224] (-541.745) (-543.958) * (-542.689) [-543.331] (-546.685) (-540.333) -- 0:00:48
76000 -- (-542.717) (-544.253) (-541.017) [-544.367] * (-544.025) (-541.547) [-547.884] (-543.836) -- 0:00:48
76500 -- (-541.583) (-543.272) [-540.717] (-541.758) * (-542.205) (-545.084) (-544.576) [-540.983] -- 0:00:48
77000 -- (-544.000) [-542.201] (-542.196) (-546.298) * (-540.917) [-542.390] (-542.167) (-542.294) -- 0:00:47
77500 -- (-543.781) (-543.326) (-541.451) [-542.650] * (-541.034) (-543.601) [-542.263] (-541.548) -- 0:00:47
78000 -- (-541.974) (-541.552) [-545.238] (-541.455) * (-540.515) (-540.809) (-541.541) [-540.791] -- 0:00:47
78500 -- [-541.649] (-541.762) (-545.665) (-541.686) * (-541.341) (-544.063) [-542.482] (-545.598) -- 0:00:46
79000 -- (-543.064) (-542.978) [-541.819] (-544.091) * [-543.733] (-541.638) (-541.864) (-543.460) -- 0:00:46
79500 -- (-542.403) (-542.639) (-543.253) [-543.995] * (-543.735) (-541.001) (-542.941) [-541.689] -- 0:00:46
80000 -- (-544.673) (-542.412) (-541.289) [-541.371] * [-541.786] (-540.375) (-541.666) (-541.469) -- 0:00:46
Average standard deviation of split frequencies: 0.025713
80500 -- (-541.466) [-540.737] (-543.654) (-543.294) * [-542.717] (-548.238) (-542.741) (-544.990) -- 0:00:45
81000 -- [-543.644] (-540.961) (-541.298) (-544.485) * (-542.259) (-542.425) [-541.347] (-542.209) -- 0:00:45
81500 -- (-542.727) (-540.538) (-542.216) [-542.932] * (-546.375) (-542.146) (-542.249) [-541.348] -- 0:00:45
82000 -- [-540.862] (-542.892) (-543.734) (-541.079) * (-540.343) (-541.122) [-541.959] (-543.457) -- 0:00:44
82500 -- (-541.183) (-547.543) [-541.761] (-544.030) * (-541.189) (-543.494) (-544.793) [-542.363] -- 0:00:44
83000 -- (-542.474) (-540.955) (-543.561) [-548.555] * (-541.726) (-542.908) (-542.451) [-541.149] -- 0:00:44
83500 -- (-543.510) [-541.975] (-541.121) (-546.001) * (-543.490) (-545.033) [-541.008] (-540.598) -- 0:00:43
84000 -- (-543.091) (-540.468) [-543.968] (-543.186) * (-541.834) [-540.383] (-541.686) (-543.410) -- 0:00:43
84500 -- (-547.538) [-540.619] (-541.789) (-544.398) * (-543.383) (-541.109) [-540.331] (-542.118) -- 0:00:54
85000 -- (-546.187) (-542.594) (-543.013) [-544.967] * (-540.741) (-540.999) [-544.484] (-544.978) -- 0:00:53
Average standard deviation of split frequencies: 0.022673
85500 -- [-541.457] (-542.401) (-543.006) (-544.316) * (-543.945) [-540.720] (-541.736) (-542.356) -- 0:00:53
86000 -- [-541.753] (-545.347) (-542.216) (-542.893) * (-546.966) [-542.469] (-545.428) (-543.630) -- 0:00:53
86500 -- [-541.873] (-546.082) (-545.562) (-541.781) * [-541.563] (-541.190) (-541.893) (-541.271) -- 0:00:52
87000 -- (-544.623) (-548.034) [-544.427] (-543.507) * (-541.878) (-542.866) [-543.116] (-541.384) -- 0:00:52
87500 -- [-542.168] (-543.211) (-545.843) (-541.229) * (-542.285) (-545.474) (-540.894) [-541.859] -- 0:00:52
88000 -- (-543.319) [-544.080] (-545.708) (-543.826) * (-546.118) (-544.645) [-541.397] (-543.918) -- 0:00:51
88500 -- (-544.304) [-541.417] (-547.221) (-545.006) * [-545.080] (-541.002) (-546.119) (-541.699) -- 0:00:51
89000 -- [-544.354] (-542.049) (-542.118) (-542.909) * (-543.511) (-540.911) (-548.325) [-541.200] -- 0:00:51
89500 -- [-541.716] (-541.325) (-540.934) (-541.631) * (-541.234) (-542.591) [-545.937] (-542.422) -- 0:00:50
90000 -- (-544.630) (-547.497) (-543.979) [-542.203] * [-540.668] (-544.218) (-542.604) (-543.267) -- 0:00:50
Average standard deviation of split frequencies: 0.025997
90500 -- (-546.093) (-542.207) [-544.273] (-541.302) * [-543.704] (-543.515) (-541.458) (-542.350) -- 0:00:50
91000 -- (-543.725) (-541.702) [-541.556] (-541.329) * (-546.410) (-544.170) (-541.640) [-543.073] -- 0:00:49
91500 -- (-541.830) (-541.608) [-541.443] (-540.840) * (-550.527) (-542.066) (-541.268) [-540.726] -- 0:00:49
92000 -- (-545.033) (-543.417) (-541.363) [-541.628] * (-549.657) [-541.207] (-541.581) (-542.956) -- 0:00:49
92500 -- (-542.448) (-541.283) [-541.800] (-542.541) * [-542.301] (-544.402) (-540.872) (-543.429) -- 0:00:49
93000 -- [-543.542] (-541.025) (-543.095) (-541.162) * (-542.685) (-541.823) (-541.040) [-543.741] -- 0:00:48
93500 -- (-541.666) (-543.960) (-541.740) [-541.779] * (-544.711) [-541.284] (-542.908) (-542.429) -- 0:00:48
94000 -- (-541.092) [-540.626] (-542.675) (-542.653) * [-544.309] (-543.056) (-541.315) (-541.023) -- 0:00:48
94500 -- [-541.377] (-542.258) (-542.470) (-543.673) * [-540.872] (-543.540) (-542.417) (-544.354) -- 0:00:47
95000 -- (-543.570) (-543.489) (-543.642) [-544.969] * [-543.934] (-546.100) (-543.848) (-542.735) -- 0:00:47
Average standard deviation of split frequencies: 0.025955
95500 -- (-540.950) [-542.432] (-542.470) (-544.463) * (-544.495) (-542.876) [-544.733] (-541.977) -- 0:00:47
96000 -- (-546.479) (-541.790) (-544.083) [-542.469] * (-545.767) (-541.036) (-543.645) [-544.599] -- 0:00:47
96500 -- (-545.130) [-541.649] (-543.436) (-542.683) * [-543.999] (-541.821) (-543.617) (-545.497) -- 0:00:46
97000 -- (-544.484) (-542.796) (-541.521) [-547.979] * [-543.010] (-544.157) (-545.326) (-543.146) -- 0:00:46
97500 -- [-541.705] (-544.561) (-542.387) (-544.856) * (-544.062) (-542.473) [-541.569] (-544.831) -- 0:00:46
98000 -- (-542.632) (-541.755) (-544.402) [-544.394] * [-540.535] (-543.764) (-541.976) (-541.051) -- 0:00:46
98500 -- (-542.164) (-542.115) [-542.633] (-543.177) * (-541.331) (-541.517) (-541.393) [-540.365] -- 0:00:45
99000 -- [-545.504] (-543.525) (-541.839) (-543.459) * (-544.046) (-542.898) (-540.996) [-540.973] -- 0:00:45
99500 -- (-541.484) (-541.967) [-544.735] (-543.454) * [-541.309] (-549.286) (-542.356) (-543.569) -- 0:00:45
100000 -- (-543.172) (-543.875) [-543.343] (-547.020) * (-540.266) [-543.710] (-541.108) (-541.704) -- 0:00:45
Average standard deviation of split frequencies: 0.025756
100500 -- (-543.423) (-541.628) [-545.204] (-540.483) * (-542.023) [-540.368] (-541.572) (-542.742) -- 0:00:44
101000 -- [-541.392] (-542.532) (-543.418) (-541.712) * (-542.557) [-540.855] (-542.408) (-542.328) -- 0:00:44
101500 -- [-543.059] (-540.981) (-544.457) (-542.542) * [-541.551] (-543.534) (-543.193) (-541.498) -- 0:00:53
102000 -- (-543.088) [-541.413] (-545.314) (-541.946) * (-542.204) [-541.049] (-542.551) (-540.885) -- 0:00:52
102500 -- (-540.788) [-545.373] (-541.856) (-546.111) * (-543.384) (-541.065) [-540.668] (-542.430) -- 0:00:52
103000 -- (-542.298) (-543.689) [-541.959] (-543.668) * (-541.923) (-545.274) (-545.232) [-542.444] -- 0:00:52
103500 -- (-542.722) (-543.627) (-541.517) [-541.377] * (-541.675) (-543.372) (-545.610) [-541.004] -- 0:00:51
104000 -- (-542.089) (-542.069) (-543.294) [-544.230] * (-544.356) (-542.747) (-545.526) [-544.819] -- 0:00:51
104500 -- [-542.531] (-541.996) (-541.834) (-544.075) * (-543.679) (-541.808) (-543.342) [-541.074] -- 0:00:51
105000 -- [-540.969] (-542.191) (-543.669) (-544.075) * (-542.651) (-542.239) [-542.027] (-542.831) -- 0:00:51
Average standard deviation of split frequencies: 0.025470
105500 -- (-542.257) [-541.291] (-546.963) (-543.135) * (-544.204) (-542.457) (-542.121) [-542.698] -- 0:00:50
106000 -- [-544.251] (-541.209) (-543.940) (-541.628) * (-543.260) (-542.300) (-544.244) [-545.335] -- 0:00:50
106500 -- (-541.529) (-541.591) [-544.637] (-541.649) * (-542.728) (-543.834) (-543.727) [-541.651] -- 0:00:50
107000 -- (-542.502) (-541.945) (-542.677) [-541.611] * [-541.435] (-544.865) (-542.656) (-541.532) -- 0:00:50
107500 -- (-542.499) [-545.539] (-541.299) (-542.003) * (-544.743) (-541.472) (-542.274) [-542.168] -- 0:00:49
108000 -- [-541.089] (-546.584) (-542.724) (-541.634) * (-545.175) (-540.862) [-541.617] (-541.919) -- 0:00:49
108500 -- (-540.854) (-544.342) (-541.842) [-542.674] * (-541.334) (-540.467) [-541.333] (-542.044) -- 0:00:49
109000 -- (-545.806) [-542.394] (-541.576) (-544.485) * (-541.580) [-540.898] (-543.027) (-543.621) -- 0:00:49
109500 -- (-542.146) (-541.379) [-541.504] (-542.593) * (-543.875) [-542.124] (-543.530) (-543.102) -- 0:00:48
110000 -- [-541.285] (-541.147) (-545.299) (-541.787) * (-540.428) [-548.097] (-547.832) (-543.319) -- 0:00:48
Average standard deviation of split frequencies: 0.025345
110500 -- (-541.817) [-543.682] (-544.090) (-540.782) * (-545.044) (-543.953) [-545.460] (-542.467) -- 0:00:48
111000 -- (-541.039) (-541.973) (-541.455) [-541.916] * (-541.694) [-541.711] (-544.014) (-541.953) -- 0:00:48
111500 -- [-540.405] (-542.749) (-541.641) (-543.286) * (-541.574) (-545.453) (-543.350) [-540.436] -- 0:00:47
112000 -- [-543.586] (-541.875) (-543.625) (-542.947) * (-545.837) [-543.813] (-544.859) (-541.898) -- 0:00:47
112500 -- (-541.430) (-540.481) [-545.828] (-544.656) * (-543.475) (-541.967) [-544.729] (-542.283) -- 0:00:47
113000 -- [-543.504] (-541.258) (-542.579) (-545.596) * (-541.774) (-544.257) [-541.660] (-551.023) -- 0:00:47
113500 -- [-545.383] (-542.345) (-541.486) (-542.847) * (-541.068) (-542.773) (-541.151) [-543.750] -- 0:00:46
114000 -- (-544.680) [-541.091] (-545.794) (-540.651) * [-541.292] (-541.177) (-540.655) (-541.696) -- 0:00:46
114500 -- (-541.369) (-541.840) [-541.740] (-543.036) * (-544.446) (-544.250) [-542.998] (-543.043) -- 0:00:46
115000 -- (-545.091) [-540.543] (-542.226) (-544.864) * (-541.167) [-541.926] (-543.166) (-542.710) -- 0:00:46
Average standard deviation of split frequencies: 0.022458
115500 -- (-543.140) (-541.512) [-543.882] (-545.116) * (-540.968) (-549.497) [-542.972] (-541.312) -- 0:00:45
116000 -- [-543.125] (-544.326) (-542.404) (-542.157) * (-542.347) [-540.956] (-544.085) (-541.219) -- 0:00:45
116500 -- (-544.968) [-541.801] (-541.540) (-544.762) * (-543.379) (-540.629) [-543.165] (-544.924) -- 0:00:45
117000 -- (-543.228) (-547.525) (-542.148) [-544.014] * [-543.568] (-540.792) (-544.892) (-540.587) -- 0:00:45
117500 -- (-543.253) (-542.528) (-541.240) [-543.252] * (-543.752) (-540.557) [-540.492] (-544.220) -- 0:00:45
118000 -- (-545.487) (-542.989) (-541.401) [-543.266] * (-542.410) (-545.941) (-540.970) [-542.279] -- 0:00:44
118500 -- (-541.015) (-543.155) (-541.323) [-545.189] * (-542.210) [-543.096] (-542.274) (-541.618) -- 0:00:44
119000 -- [-543.558] (-543.815) (-542.520) (-541.119) * (-540.160) [-543.334] (-541.568) (-541.428) -- 0:00:51
119500 -- [-541.805] (-541.988) (-543.974) (-545.337) * (-545.212) (-543.188) (-543.484) [-540.707] -- 0:00:51
120000 -- [-544.150] (-542.198) (-543.982) (-543.458) * (-544.728) (-541.293) (-541.196) [-545.084] -- 0:00:51
Average standard deviation of split frequencies: 0.023223
120500 -- (-540.913) (-541.470) (-541.625) [-544.611] * (-543.981) [-541.844] (-541.297) (-541.861) -- 0:00:51
121000 -- [-542.788] (-541.980) (-543.850) (-543.684) * (-545.440) (-545.401) (-540.946) [-540.517] -- 0:00:50
121500 -- [-546.835] (-544.512) (-543.775) (-541.415) * [-543.154] (-544.004) (-544.236) (-543.364) -- 0:00:50
122000 -- (-546.526) (-547.777) [-548.355] (-544.194) * [-541.731] (-545.569) (-544.004) (-544.485) -- 0:00:50
122500 -- (-543.043) [-541.822] (-553.463) (-542.606) * (-546.212) (-545.777) (-544.260) [-541.655] -- 0:00:50
123000 -- [-540.550] (-547.229) (-546.079) (-542.254) * [-544.050] (-542.585) (-542.170) (-543.445) -- 0:00:49
123500 -- (-543.654) (-545.568) [-540.775] (-540.959) * (-545.406) [-543.684] (-540.747) (-542.348) -- 0:00:49
124000 -- (-545.350) (-542.649) (-544.137) [-542.867] * (-542.733) (-541.494) (-541.597) [-543.544] -- 0:00:49
124500 -- (-542.500) (-541.218) [-540.959] (-542.967) * (-544.012) (-541.709) (-543.828) [-540.773] -- 0:00:49
125000 -- (-542.087) [-541.306] (-543.411) (-542.070) * (-542.140) (-543.276) (-546.058) [-540.569] -- 0:00:49
Average standard deviation of split frequencies: 0.019297
125500 -- [-541.140] (-541.841) (-543.047) (-542.664) * [-540.912] (-542.315) (-541.064) (-541.507) -- 0:00:48
126000 -- [-541.882] (-544.048) (-543.525) (-541.979) * [-540.436] (-542.449) (-540.608) (-542.658) -- 0:00:48
126500 -- [-540.403] (-542.331) (-543.350) (-543.704) * (-541.642) (-546.495) [-540.747] (-542.987) -- 0:00:48
127000 -- [-541.542] (-541.911) (-542.686) (-541.892) * [-542.029] (-547.466) (-540.621) (-543.644) -- 0:00:48
127500 -- (-543.760) [-540.847] (-545.678) (-542.654) * (-545.377) [-541.684] (-542.681) (-543.717) -- 0:00:47
128000 -- (-542.632) [-541.501] (-551.269) (-542.458) * [-546.868] (-541.051) (-542.566) (-543.317) -- 0:00:47
128500 -- (-547.634) (-540.928) (-541.783) [-540.747] * (-543.371) [-541.139] (-548.980) (-543.749) -- 0:00:47
129000 -- (-541.863) (-541.847) (-545.134) [-541.848] * [-541.856] (-541.562) (-548.088) (-544.719) -- 0:00:47
129500 -- (-542.916) (-542.161) (-541.042) [-543.981] * [-544.915] (-542.385) (-546.388) (-542.680) -- 0:00:47
130000 -- (-541.205) (-543.860) [-542.349] (-545.356) * [-544.133] (-546.421) (-544.826) (-543.458) -- 0:00:46
Average standard deviation of split frequencies: 0.020127
130500 -- (-544.138) [-545.093] (-541.060) (-540.779) * (-541.838) [-543.152] (-545.855) (-544.779) -- 0:00:46
131000 -- [-541.612] (-541.621) (-540.649) (-545.697) * (-542.920) [-542.832] (-550.553) (-549.472) -- 0:00:46
131500 -- (-541.806) (-542.749) (-543.192) [-545.132] * (-545.031) (-544.155) (-546.164) [-543.015] -- 0:00:46
132000 -- [-540.844] (-543.401) (-542.690) (-545.089) * (-543.574) (-541.880) (-543.156) [-541.690] -- 0:00:46
132500 -- (-543.726) (-543.341) (-542.585) [-542.805] * [-542.646] (-543.409) (-544.510) (-547.813) -- 0:00:45
133000 -- (-544.902) [-543.157] (-541.380) (-541.616) * (-542.823) (-542.582) (-544.146) [-544.195] -- 0:00:45
133500 -- [-543.023] (-545.220) (-542.269) (-541.676) * [-540.492] (-544.451) (-543.100) (-542.509) -- 0:00:45
134000 -- (-542.733) [-541.759] (-544.149) (-543.720) * [-541.322] (-541.252) (-541.674) (-544.799) -- 0:00:45
134500 -- (-542.100) (-542.804) (-541.648) [-541.411] * (-541.354) [-541.071] (-541.722) (-544.859) -- 0:00:45
135000 -- (-540.990) [-541.701] (-542.551) (-541.926) * [-540.803] (-542.245) (-542.902) (-545.743) -- 0:00:44
Average standard deviation of split frequencies: 0.018973
135500 -- (-541.946) (-542.450) [-542.932] (-545.503) * [-542.366] (-541.520) (-543.680) (-542.998) -- 0:00:51
136000 -- [-542.732] (-541.265) (-542.127) (-541.501) * [-541.110] (-541.459) (-544.833) (-542.550) -- 0:00:50
136500 -- [-544.129] (-542.118) (-541.816) (-545.763) * (-542.602) [-543.718] (-543.740) (-542.924) -- 0:00:50
137000 -- (-540.950) (-540.544) (-543.614) [-542.507] * [-542.872] (-542.967) (-548.825) (-540.492) -- 0:00:50
137500 -- (-542.896) (-542.174) (-544.609) [-542.618] * (-540.734) (-544.210) (-543.600) [-540.976] -- 0:00:50
138000 -- (-541.980) (-542.222) [-544.297] (-541.319) * (-540.962) [-543.519] (-540.646) (-544.894) -- 0:00:49
138500 -- (-544.645) (-543.379) (-543.628) [-541.141] * (-540.954) (-541.975) (-541.981) [-543.474] -- 0:00:49
139000 -- (-548.906) (-543.812) [-543.404] (-545.204) * [-541.467] (-545.535) (-544.138) (-542.902) -- 0:00:49
139500 -- [-545.787] (-541.178) (-542.183) (-545.546) * (-543.052) (-543.147) (-546.641) [-540.205] -- 0:00:49
140000 -- [-543.160] (-542.630) (-541.505) (-544.266) * (-540.980) (-541.640) (-546.624) [-546.822] -- 0:00:49
Average standard deviation of split frequencies: 0.018520
140500 -- (-546.238) (-545.263) (-543.163) [-543.552] * (-543.618) [-540.528] (-543.529) (-545.099) -- 0:00:48
141000 -- (-543.843) (-544.404) (-542.056) [-541.070] * (-546.370) (-542.092) [-542.527] (-540.868) -- 0:00:48
141500 -- (-541.668) (-544.035) [-540.690] (-541.562) * (-540.593) [-541.452] (-545.009) (-541.947) -- 0:00:48
142000 -- (-544.073) (-543.431) [-544.876] (-542.948) * (-541.889) (-545.265) [-543.438] (-543.872) -- 0:00:48
142500 -- (-541.975) (-541.875) [-541.348] (-541.234) * (-541.698) (-541.559) (-542.372) [-541.992] -- 0:00:48
143000 -- (-540.868) (-544.087) (-541.073) [-546.125] * (-544.560) (-540.776) (-541.764) [-542.358] -- 0:00:47
143500 -- (-543.217) (-545.444) [-544.124] (-549.509) * (-542.701) [-541.681] (-543.880) (-543.934) -- 0:00:47
144000 -- (-541.521) (-541.077) (-542.569) [-544.015] * (-542.940) (-545.177) [-542.135] (-544.534) -- 0:00:47
144500 -- (-542.475) [-541.835] (-542.342) (-543.363) * (-543.060) (-541.508) [-542.170] (-542.730) -- 0:00:47
145000 -- (-543.308) [-541.473] (-543.146) (-543.327) * (-541.802) [-545.238] (-542.508) (-542.582) -- 0:00:47
Average standard deviation of split frequencies: 0.020503
145500 -- (-541.208) (-543.296) (-541.647) [-542.129] * [-541.690] (-543.565) (-541.941) (-541.785) -- 0:00:46
146000 -- (-541.527) [-543.379] (-543.086) (-544.137) * (-543.580) (-542.146) (-546.273) [-545.106] -- 0:00:46
146500 -- [-541.849] (-543.016) (-542.863) (-544.155) * (-546.187) [-541.435] (-542.879) (-542.973) -- 0:00:46
147000 -- (-540.378) (-544.975) (-542.420) [-543.881] * (-544.777) [-541.119] (-546.125) (-543.709) -- 0:00:46
147500 -- [-540.807] (-541.181) (-543.454) (-541.357) * (-545.376) [-540.750] (-545.318) (-543.193) -- 0:00:46
148000 -- (-545.293) [-540.941] (-544.713) (-544.918) * (-544.924) (-542.622) [-544.119] (-542.811) -- 0:00:46
148500 -- [-542.100] (-542.627) (-547.570) (-541.728) * (-541.889) (-540.522) [-543.091] (-543.888) -- 0:00:45
149000 -- (-541.461) (-542.944) (-541.427) [-543.747] * [-542.843] (-541.652) (-543.812) (-541.063) -- 0:00:45
149500 -- (-543.389) [-542.757] (-542.811) (-542.638) * (-540.705) (-543.360) [-542.173] (-544.477) -- 0:00:45
150000 -- (-541.693) (-542.965) (-540.377) [-543.487] * [-546.093] (-540.873) (-546.602) (-543.207) -- 0:00:45
Average standard deviation of split frequencies: 0.016467
150500 -- (-544.992) (-541.943) (-544.488) [-541.447] * (-542.433) (-543.503) [-543.610] (-540.824) -- 0:00:45
151000 -- (-546.372) [-541.509] (-546.250) (-542.193) * (-542.139) (-544.806) (-544.501) [-543.371] -- 0:00:44
151500 -- (-544.158) (-542.822) (-544.478) [-541.165] * (-544.207) (-545.619) [-544.343] (-541.021) -- 0:00:44
152000 -- (-540.723) [-543.240] (-544.893) (-543.369) * [-541.688] (-542.430) (-542.763) (-544.234) -- 0:00:44
152500 -- (-541.868) [-542.105] (-544.203) (-544.942) * (-542.762) [-540.995] (-540.634) (-541.777) -- 0:00:50
153000 -- [-541.560] (-541.788) (-542.112) (-542.300) * (-540.937) [-544.716] (-542.466) (-540.640) -- 0:00:49
153500 -- (-544.044) (-542.307) (-542.623) [-541.064] * (-541.854) [-542.704] (-541.788) (-543.179) -- 0:00:49
154000 -- (-542.739) (-545.127) [-543.303] (-546.368) * (-542.429) (-541.697) [-543.178] (-542.412) -- 0:00:49
154500 -- (-544.188) [-541.892] (-544.342) (-544.121) * (-540.920) [-540.309] (-544.318) (-541.445) -- 0:00:49
155000 -- (-544.259) (-544.827) (-543.062) [-542.621] * (-541.506) (-541.190) (-544.563) [-543.081] -- 0:00:49
Average standard deviation of split frequencies: 0.015904
155500 -- (-542.040) (-543.523) (-542.142) [-543.343] * (-544.081) [-541.126] (-541.369) (-540.876) -- 0:00:48
156000 -- (-542.774) [-543.926] (-542.887) (-545.215) * (-541.235) (-548.189) [-546.179] (-541.078) -- 0:00:48
156500 -- (-544.534) (-542.732) [-542.502] (-543.322) * [-544.370] (-542.266) (-542.090) (-541.177) -- 0:00:48
157000 -- (-547.531) [-543.806] (-545.019) (-541.542) * (-542.672) (-544.742) (-543.610) [-540.957] -- 0:00:48
157500 -- (-545.501) (-541.626) [-549.845] (-541.952) * (-545.504) (-542.324) [-545.236] (-543.087) -- 0:00:48
158000 -- (-542.189) [-542.954] (-543.231) (-541.196) * (-544.321) (-540.539) [-540.254] (-545.245) -- 0:00:47
158500 -- (-541.165) (-544.551) [-543.333] (-541.700) * (-541.782) (-548.419) (-542.755) [-542.209] -- 0:00:47
159000 -- (-540.550) (-543.175) [-541.091] (-541.792) * (-542.442) (-542.223) (-545.094) [-543.119] -- 0:00:47
159500 -- [-540.408] (-544.127) (-542.994) (-541.740) * [-542.537] (-542.648) (-540.551) (-545.969) -- 0:00:47
160000 -- (-544.275) (-541.895) (-543.857) [-541.765] * (-543.685) (-542.456) (-543.280) [-543.085] -- 0:00:47
Average standard deviation of split frequencies: 0.016369
160500 -- (-541.162) (-541.225) [-541.856] (-545.338) * (-542.891) (-542.665) (-543.850) [-544.950] -- 0:00:47
161000 -- (-542.248) [-540.788] (-545.838) (-545.004) * [-541.714] (-546.258) (-545.193) (-541.182) -- 0:00:46
161500 -- [-543.269] (-544.030) (-541.488) (-543.639) * (-541.068) (-544.675) (-542.114) [-542.353] -- 0:00:46
162000 -- (-545.241) (-543.931) (-541.112) [-542.833] * [-542.361] (-547.241) (-542.709) (-542.103) -- 0:00:46
162500 -- [-542.482] (-542.498) (-541.739) (-543.840) * (-543.360) (-541.369) [-542.939] (-541.929) -- 0:00:46
163000 -- (-542.274) (-542.762) (-541.946) [-542.259] * (-542.171) [-542.416] (-543.445) (-541.689) -- 0:00:46
163500 -- [-544.878] (-542.367) (-542.791) (-542.186) * (-541.588) (-544.282) [-542.152] (-542.229) -- 0:00:46
164000 -- [-541.211] (-543.806) (-543.811) (-542.233) * (-543.945) (-546.513) (-543.745) [-540.839] -- 0:00:45
164500 -- [-541.335] (-547.582) (-542.352) (-544.742) * (-541.537) (-542.737) (-542.130) [-541.803] -- 0:00:45
165000 -- (-543.730) [-541.972] (-543.176) (-546.647) * (-546.028) (-542.867) (-543.730) [-542.629] -- 0:00:45
Average standard deviation of split frequencies: 0.015843
165500 -- (-541.907) (-542.298) [-541.210] (-546.405) * [-542.008] (-541.755) (-541.587) (-541.522) -- 0:00:45
166000 -- (-541.902) [-545.895] (-541.557) (-544.028) * [-542.260] (-541.280) (-541.050) (-542.121) -- 0:00:45
166500 -- (-543.234) [-547.029] (-540.671) (-544.271) * (-542.464) [-541.396] (-542.228) (-541.244) -- 0:00:45
167000 -- [-544.362] (-542.819) (-542.162) (-544.741) * (-546.840) [-542.095] (-543.909) (-541.426) -- 0:00:44
167500 -- (-541.223) (-547.147) (-542.443) [-544.814] * (-541.532) [-541.531] (-541.347) (-542.470) -- 0:00:44
168000 -- (-543.249) (-544.082) [-542.360] (-543.701) * (-543.408) [-541.774] (-544.053) (-543.917) -- 0:00:44
168500 -- (-545.690) [-543.590] (-540.630) (-544.914) * (-543.975) (-542.393) (-543.058) [-543.032] -- 0:00:44
169000 -- [-541.816] (-541.036) (-542.641) (-544.382) * (-541.185) [-540.556] (-542.061) (-541.750) -- 0:00:44
169500 -- [-544.042] (-543.039) (-546.568) (-544.500) * (-542.347) [-540.865] (-544.616) (-542.785) -- 0:00:44
170000 -- (-545.024) [-543.152] (-546.417) (-543.835) * (-542.317) (-540.553) (-540.814) [-542.637] -- 0:00:48
Average standard deviation of split frequencies: 0.015555
170500 -- (-543.587) (-541.295) [-544.372] (-543.391) * (-542.007) [-542.759] (-541.870) (-541.080) -- 0:00:48
171000 -- (-544.218) [-541.178] (-545.292) (-542.505) * (-542.845) (-542.535) [-541.321] (-541.890) -- 0:00:48
171500 -- (-544.786) (-542.467) (-543.912) [-543.451] * (-541.812) (-545.920) [-540.351] (-547.468) -- 0:00:48
172000 -- (-543.045) (-542.058) (-544.613) [-541.899] * (-542.986) (-541.702) (-542.233) [-545.355] -- 0:00:48
172500 -- (-542.655) (-541.338) [-543.923] (-540.269) * (-543.886) (-541.890) [-541.124] (-540.967) -- 0:00:47
173000 -- (-545.177) (-542.474) (-543.792) [-542.848] * (-546.067) (-541.539) (-541.341) [-542.115] -- 0:00:47
173500 -- [-544.977] (-542.895) (-541.417) (-540.796) * (-545.544) (-541.910) [-543.949] (-543.781) -- 0:00:47
174000 -- (-543.682) (-542.510) [-542.665] (-540.995) * [-543.118] (-541.872) (-543.611) (-540.355) -- 0:00:47
174500 -- (-545.102) (-544.675) (-544.124) [-542.812] * (-541.384) (-550.608) [-540.655] (-540.778) -- 0:00:47
175000 -- (-542.633) [-546.896] (-544.157) (-546.716) * (-540.923) (-545.075) (-540.747) [-542.290] -- 0:00:47
Average standard deviation of split frequencies: 0.016071
175500 -- (-541.762) [-545.025] (-545.620) (-546.739) * [-541.000] (-542.420) (-544.287) (-540.897) -- 0:00:46
176000 -- [-541.053] (-543.613) (-543.463) (-542.092) * (-542.618) [-540.784] (-542.629) (-541.146) -- 0:00:46
176500 -- (-544.026) (-543.541) [-541.534] (-541.115) * (-542.445) (-542.064) (-541.759) [-543.046] -- 0:00:46
177000 -- (-544.448) [-551.704] (-543.129) (-542.620) * (-543.863) (-542.532) (-542.925) [-542.389] -- 0:00:46
177500 -- (-545.393) (-542.954) (-543.815) [-544.649] * [-540.635] (-542.674) (-542.698) (-545.315) -- 0:00:46
178000 -- (-543.097) [-540.860] (-547.541) (-544.444) * [-540.843] (-544.204) (-541.207) (-543.835) -- 0:00:46
178500 -- (-541.919) (-540.919) (-549.600) [-541.830] * [-540.831] (-545.776) (-540.940) (-554.693) -- 0:00:46
179000 -- (-541.310) (-541.197) (-547.727) [-546.103] * (-540.275) (-546.157) [-542.268] (-548.754) -- 0:00:45
179500 -- (-545.220) [-542.262] (-546.559) (-541.759) * (-543.284) (-543.984) [-542.215] (-542.931) -- 0:00:45
180000 -- (-542.357) [-545.440] (-543.104) (-541.954) * (-542.768) (-541.556) (-542.432) [-543.365] -- 0:00:45
Average standard deviation of split frequencies: 0.016960
180500 -- [-542.969] (-544.395) (-543.794) (-541.305) * (-544.360) (-543.807) [-541.990] (-542.511) -- 0:00:45
181000 -- (-542.411) (-544.034) [-543.205] (-540.967) * (-541.303) [-540.960] (-541.080) (-543.037) -- 0:00:45
181500 -- (-541.955) (-541.566) (-542.164) [-543.109] * (-542.851) (-544.560) [-540.831] (-540.930) -- 0:00:45
182000 -- (-541.373) (-543.043) [-541.683] (-542.540) * (-544.989) (-545.830) [-541.268] (-544.061) -- 0:00:44
182500 -- (-540.212) (-544.339) (-542.940) [-542.075] * (-543.591) [-542.023] (-545.704) (-540.810) -- 0:00:44
183000 -- (-545.576) [-541.197] (-543.879) (-542.735) * (-540.382) (-541.863) (-541.411) [-540.756] -- 0:00:44
183500 -- (-541.305) [-540.420] (-542.265) (-543.085) * (-542.123) [-543.557] (-544.108) (-542.361) -- 0:00:44
184000 -- [-540.878] (-548.674) (-543.607) (-544.129) * [-541.257] (-542.510) (-541.651) (-541.471) -- 0:00:44
184500 -- (-540.634) [-543.506] (-541.444) (-541.190) * (-541.902) [-542.326] (-544.316) (-544.102) -- 0:00:44
185000 -- (-541.943) (-543.352) (-542.127) [-541.265] * (-542.947) (-540.685) [-541.567] (-544.091) -- 0:00:44
Average standard deviation of split frequencies: 0.017207
185500 -- (-542.980) [-542.131] (-545.548) (-541.178) * (-542.088) [-541.119] (-542.704) (-540.942) -- 0:00:43
186000 -- [-541.328] (-542.663) (-542.780) (-542.650) * (-544.757) (-541.377) [-541.291] (-542.263) -- 0:00:43
186500 -- [-541.690] (-542.204) (-543.725) (-542.267) * (-544.587) (-548.019) [-542.228] (-542.131) -- 0:00:43
187000 -- [-541.453] (-542.468) (-542.548) (-544.156) * (-543.509) (-541.514) [-541.938] (-545.188) -- 0:00:47
187500 -- (-540.949) [-541.736] (-543.432) (-541.924) * (-544.973) (-547.312) [-541.234] (-543.065) -- 0:00:47
188000 -- (-543.468) [-540.762] (-543.348) (-543.861) * (-542.610) (-547.334) [-540.658] (-543.739) -- 0:00:47
188500 -- [-541.112] (-541.414) (-542.025) (-541.940) * (-541.939) (-550.490) [-541.281] (-545.801) -- 0:00:47
189000 -- (-540.258) [-541.625] (-543.374) (-543.937) * (-544.137) (-541.871) [-543.492] (-541.744) -- 0:00:47
189500 -- (-541.650) [-541.324] (-541.975) (-541.351) * [-545.604] (-541.087) (-544.583) (-542.313) -- 0:00:47
190000 -- [-541.430] (-541.407) (-542.952) (-540.713) * (-543.839) (-541.655) (-544.389) [-543.242] -- 0:00:46
Average standard deviation of split frequencies: 0.018268
190500 -- [-541.496] (-544.031) (-542.225) (-542.318) * [-549.294] (-543.362) (-545.777) (-541.068) -- 0:00:46
191000 -- (-542.891) [-543.306] (-543.470) (-543.421) * (-549.181) (-543.656) [-544.358] (-540.733) -- 0:00:46
191500 -- [-544.250] (-543.603) (-546.407) (-541.883) * (-543.158) [-542.895] (-544.260) (-540.689) -- 0:00:46
192000 -- (-542.260) (-541.700) [-541.106] (-542.556) * (-540.517) (-542.855) [-542.211] (-542.865) -- 0:00:46
192500 -- [-541.704] (-542.914) (-541.101) (-541.419) * [-541.160] (-544.234) (-541.531) (-541.366) -- 0:00:46
193000 -- [-541.670] (-544.163) (-547.047) (-543.070) * (-542.764) (-546.233) [-544.403] (-541.114) -- 0:00:45
193500 -- (-541.818) (-542.734) (-544.052) [-542.810] * (-541.874) (-545.522) [-544.258] (-541.830) -- 0:00:45
194000 -- (-542.476) (-545.314) (-543.829) [-541.977] * [-540.871] (-542.847) (-542.933) (-544.776) -- 0:00:45
194500 -- (-543.252) (-542.657) [-542.660] (-542.703) * [-540.869] (-542.087) (-546.459) (-542.721) -- 0:00:45
195000 -- (-543.075) (-543.746) (-541.560) [-541.937] * [-541.309] (-540.734) (-543.138) (-541.351) -- 0:00:45
Average standard deviation of split frequencies: 0.018840
195500 -- (-541.495) (-546.016) [-541.002] (-541.846) * [-541.330] (-543.828) (-547.332) (-544.839) -- 0:00:45
196000 -- (-543.682) (-544.080) [-542.923] (-545.652) * [-542.296] (-544.802) (-543.334) (-541.181) -- 0:00:45
196500 -- (-547.731) (-542.752) [-541.576] (-540.577) * [-543.922] (-544.934) (-543.892) (-545.654) -- 0:00:44
197000 -- (-542.681) [-541.205] (-541.205) (-542.148) * [-543.095] (-542.082) (-547.835) (-540.682) -- 0:00:44
197500 -- (-541.775) (-545.705) [-541.064] (-543.142) * [-545.743] (-541.744) (-540.562) (-541.921) -- 0:00:44
198000 -- (-546.074) (-541.581) (-543.950) [-543.800] * [-540.725] (-541.220) (-545.046) (-540.788) -- 0:00:44
198500 -- [-542.482] (-542.754) (-541.581) (-544.571) * (-541.148) [-542.014] (-542.436) (-542.339) -- 0:00:44
199000 -- [-542.070] (-542.601) (-544.285) (-544.303) * [-541.052] (-541.755) (-540.533) (-542.207) -- 0:00:44
199500 -- (-547.394) [-543.209] (-546.871) (-541.123) * (-540.241) (-542.926) (-542.050) [-540.947] -- 0:00:44
200000 -- (-544.909) (-540.498) (-541.721) [-541.234] * [-540.904] (-542.526) (-542.335) (-542.906) -- 0:00:44
Average standard deviation of split frequencies: 0.017227
200500 -- (-541.064) (-543.560) [-542.899] (-543.167) * [-541.426] (-544.632) (-544.294) (-544.432) -- 0:00:43
201000 -- (-543.174) (-540.547) [-545.376] (-541.832) * (-545.177) (-541.214) (-548.365) [-541.220] -- 0:00:43
201500 -- (-542.220) [-540.697] (-543.375) (-540.689) * (-545.372) (-545.481) [-543.823] (-541.760) -- 0:00:43
202000 -- [-543.079] (-543.059) (-541.248) (-543.676) * (-542.849) [-545.873] (-540.560) (-542.274) -- 0:00:43
202500 -- [-545.350] (-546.468) (-542.794) (-541.380) * [-542.031] (-547.968) (-549.559) (-540.898) -- 0:00:43
203000 -- (-545.213) (-544.073) [-541.094] (-541.465) * [-541.845] (-544.274) (-545.985) (-543.614) -- 0:00:43
203500 -- (-544.121) (-542.804) (-542.994) [-540.930] * (-542.915) (-541.543) [-542.574] (-544.731) -- 0:00:43
204000 -- (-540.552) (-544.637) (-543.335) [-543.272] * (-543.064) (-547.025) (-541.816) [-540.527] -- 0:00:46
204500 -- (-543.779) (-543.467) (-542.094) [-542.584] * (-545.681) (-543.404) [-546.654] (-544.742) -- 0:00:46
205000 -- (-542.068) [-543.649] (-540.715) (-541.226) * (-541.264) (-542.625) (-541.090) [-540.244] -- 0:00:46
Average standard deviation of split frequencies: 0.018576
205500 -- (-541.302) [-541.416] (-545.944) (-541.910) * (-546.613) (-543.019) (-542.801) [-542.464] -- 0:00:46
206000 -- [-540.794] (-544.597) (-546.010) (-540.972) * (-548.796) (-540.652) (-542.418) [-540.898] -- 0:00:46
206500 -- [-541.193] (-543.407) (-544.272) (-541.432) * (-543.011) (-542.291) [-542.146] (-541.067) -- 0:00:46
207000 -- (-543.975) (-540.850) (-543.160) [-542.504] * (-544.079) (-542.460) [-544.150] (-543.333) -- 0:00:45
207500 -- [-543.004] (-541.319) (-541.557) (-543.266) * [-543.927] (-543.635) (-543.485) (-542.257) -- 0:00:45
208000 -- (-544.065) (-542.530) (-542.658) [-542.414] * (-545.848) [-542.399] (-541.291) (-542.262) -- 0:00:45
208500 -- (-541.406) (-544.709) [-542.354] (-543.530) * (-543.017) (-545.025) (-541.078) [-545.748] -- 0:00:45
209000 -- [-541.228] (-542.254) (-541.835) (-545.670) * (-543.855) (-551.466) (-545.408) [-544.103] -- 0:00:45
209500 -- (-542.328) (-542.582) (-540.290) [-543.089] * (-543.708) (-547.473) (-543.450) [-543.582] -- 0:00:45
210000 -- (-542.127) (-545.204) (-547.230) [-543.079] * (-542.900) (-545.389) (-543.337) [-543.077] -- 0:00:45
Average standard deviation of split frequencies: 0.017375
210500 -- (-545.751) (-543.098) (-540.568) [-540.809] * (-541.394) (-542.441) (-546.679) [-542.865] -- 0:00:45
211000 -- (-544.411) (-543.146) [-541.258] (-541.211) * [-541.251] (-542.308) (-542.257) (-541.603) -- 0:00:44
211500 -- (-545.101) (-548.085) (-544.063) [-544.588] * (-540.743) (-542.636) (-543.268) [-541.875] -- 0:00:44
212000 -- (-545.119) (-545.677) (-540.857) [-543.333] * (-542.473) (-543.299) [-541.833] (-541.238) -- 0:00:44
212500 -- (-545.200) [-544.203] (-543.346) (-543.663) * (-543.641) [-545.439] (-545.263) (-541.336) -- 0:00:44
213000 -- [-540.856] (-546.524) (-545.674) (-544.459) * [-541.030] (-542.530) (-544.108) (-541.488) -- 0:00:44
213500 -- (-541.149) (-542.396) (-541.431) [-541.230] * (-541.291) [-544.468] (-542.748) (-541.475) -- 0:00:44
214000 -- (-541.887) (-541.465) (-543.592) [-542.701] * [-542.187] (-541.047) (-541.781) (-543.439) -- 0:00:44
214500 -- (-542.033) [-540.904] (-540.587) (-543.855) * (-542.638) (-541.491) [-543.724] (-542.945) -- 0:00:43
215000 -- (-542.357) (-543.650) [-545.438] (-541.993) * [-541.664] (-540.985) (-544.057) (-546.814) -- 0:00:43
Average standard deviation of split frequencies: 0.017074
215500 -- (-540.369) [-541.837] (-543.552) (-542.460) * (-542.420) (-543.671) [-545.820] (-540.779) -- 0:00:43
216000 -- (-540.833) (-541.703) (-542.071) [-545.715] * (-542.409) [-542.317] (-542.401) (-541.570) -- 0:00:43
216500 -- [-540.613] (-541.671) (-541.923) (-542.843) * (-543.400) [-544.097] (-546.344) (-543.951) -- 0:00:43
217000 -- (-545.251) (-541.047) [-541.712] (-540.700) * (-544.040) [-542.886] (-545.383) (-543.253) -- 0:00:43
217500 -- (-543.177) (-541.398) (-544.306) [-545.615] * (-542.293) (-541.944) (-546.417) [-541.998] -- 0:00:43
218000 -- (-543.151) [-543.757] (-542.265) (-542.866) * (-542.712) (-542.767) (-541.238) [-543.170] -- 0:00:43
218500 -- (-546.224) [-543.138] (-542.709) (-544.861) * (-540.550) (-543.193) (-540.599) [-543.486] -- 0:00:42
219000 -- (-544.136) (-544.024) [-541.667] (-543.288) * (-541.919) (-540.903) [-542.079] (-541.294) -- 0:00:42
219500 -- [-543.241] (-543.099) (-544.053) (-543.404) * (-543.506) [-540.862] (-545.225) (-542.362) -- 0:00:42
220000 -- [-543.254] (-541.042) (-542.085) (-544.524) * (-543.020) (-543.554) (-544.043) [-544.080] -- 0:00:42
Average standard deviation of split frequencies: 0.017090
220500 -- [-546.729] (-541.653) (-542.049) (-544.638) * (-541.507) (-544.450) (-542.482) [-543.781] -- 0:00:42
221000 -- (-544.601) (-549.243) [-542.839] (-542.491) * [-541.034] (-541.170) (-542.235) (-546.129) -- 0:00:45
221500 -- (-549.644) (-543.950) (-542.522) [-541.159] * (-542.757) [-540.857] (-541.118) (-543.176) -- 0:00:45
222000 -- [-541.654] (-542.732) (-546.213) (-542.662) * [-542.529] (-541.196) (-543.294) (-543.072) -- 0:00:45
222500 -- (-546.417) (-541.619) (-542.187) [-542.257] * [-543.884] (-543.420) (-543.235) (-543.966) -- 0:00:45
223000 -- (-543.419) [-543.667] (-544.736) (-541.312) * (-547.658) (-543.774) (-542.822) [-542.757] -- 0:00:45
223500 -- (-541.469) [-542.568] (-542.157) (-542.530) * (-542.709) (-543.709) [-540.710] (-541.219) -- 0:00:45
224000 -- [-541.541] (-550.756) (-543.900) (-544.262) * (-542.412) (-544.824) [-543.764] (-542.076) -- 0:00:45
224500 -- [-540.434] (-544.367) (-547.079) (-542.156) * (-545.074) (-540.463) [-542.509] (-543.798) -- 0:00:44
225000 -- (-540.705) [-541.191] (-543.029) (-542.567) * (-543.204) (-542.525) (-542.010) [-544.448] -- 0:00:44
Average standard deviation of split frequencies: 0.017208
225500 -- [-540.633] (-542.665) (-543.361) (-542.184) * [-542.270] (-542.893) (-542.280) (-540.472) -- 0:00:44
226000 -- (-540.505) (-542.615) [-543.757] (-542.904) * [-541.692] (-546.325) (-542.112) (-541.123) -- 0:00:44
226500 -- (-541.263) [-541.242] (-543.393) (-541.776) * [-544.193] (-549.359) (-542.383) (-542.513) -- 0:00:44
227000 -- (-544.592) [-543.049] (-543.071) (-543.212) * (-541.992) (-542.017) (-542.564) [-543.716] -- 0:00:44
227500 -- [-541.475] (-552.147) (-542.625) (-543.893) * (-543.177) (-541.213) (-544.066) [-542.736] -- 0:00:44
228000 -- (-542.320) (-544.631) (-542.173) [-544.319] * (-542.666) (-544.750) [-540.835] (-545.977) -- 0:00:44
228500 -- (-540.720) (-540.489) (-541.702) [-543.390] * (-544.555) [-541.758] (-544.458) (-547.988) -- 0:00:43
229000 -- [-543.568] (-540.337) (-545.377) (-548.678) * (-543.070) [-545.753] (-540.836) (-543.318) -- 0:00:43
229500 -- (-542.431) [-546.793] (-542.927) (-548.687) * (-540.768) (-544.494) (-545.442) [-545.477] -- 0:00:43
230000 -- (-541.693) (-544.934) [-544.089] (-541.882) * (-543.208) (-546.530) (-542.088) [-544.211] -- 0:00:43
Average standard deviation of split frequencies: 0.016094
230500 -- (-549.783) (-543.273) [-543.256] (-541.480) * (-541.320) (-544.561) [-542.280] (-549.195) -- 0:00:43
231000 -- (-542.915) [-541.852] (-542.923) (-542.447) * (-541.786) (-542.768) (-541.749) [-541.532] -- 0:00:43
231500 -- (-548.344) [-543.033] (-540.996) (-541.771) * (-541.837) (-544.330) [-542.139] (-547.174) -- 0:00:43
232000 -- (-541.274) (-540.595) (-542.421) [-540.662] * (-541.466) (-541.628) [-542.604] (-543.259) -- 0:00:43
232500 -- (-541.151) [-543.707] (-543.889) (-541.517) * (-540.877) (-543.270) (-542.688) [-542.594] -- 0:00:42
233000 -- (-543.941) (-540.933) (-540.556) [-541.202] * (-542.831) [-544.041] (-545.275) (-542.645) -- 0:00:42
233500 -- (-542.916) (-541.803) [-541.277] (-543.199) * (-543.148) (-546.083) [-540.599] (-544.805) -- 0:00:42
234000 -- (-545.952) [-541.645] (-545.622) (-542.205) * (-547.952) (-541.954) (-541.489) [-548.567] -- 0:00:42
234500 -- [-543.585] (-543.065) (-544.946) (-543.922) * [-542.225] (-541.711) (-542.514) (-541.725) -- 0:00:42
235000 -- (-547.938) [-546.000] (-543.204) (-543.001) * (-546.104) (-543.170) (-540.841) [-545.631] -- 0:00:42
Average standard deviation of split frequencies: 0.014648
235500 -- [-542.060] (-541.711) (-544.135) (-545.403) * (-546.778) (-547.524) (-542.231) [-543.773] -- 0:00:42
236000 -- (-541.246) [-541.564] (-546.943) (-542.688) * (-542.716) (-542.095) (-542.992) [-541.191] -- 0:00:42
236500 -- (-542.479) (-542.471) [-542.022] (-540.452) * (-541.711) [-548.202] (-541.517) (-543.365) -- 0:00:41
237000 -- (-542.220) (-545.509) (-546.075) [-542.553] * (-541.205) (-542.649) (-543.787) [-541.032] -- 0:00:41
237500 -- (-542.665) (-543.130) [-544.615] (-542.724) * [-541.458] (-544.527) (-541.822) (-542.043) -- 0:00:41
238000 -- [-540.778] (-541.395) (-541.418) (-544.841) * (-541.912) (-543.621) (-543.100) [-543.365] -- 0:00:44
238500 -- [-542.181] (-541.325) (-543.960) (-545.223) * (-545.819) (-544.034) [-543.593] (-544.624) -- 0:00:44
239000 -- [-543.102] (-540.959) (-543.989) (-546.675) * (-541.812) [-544.046] (-541.542) (-544.250) -- 0:00:44
239500 -- (-543.062) [-541.648] (-541.055) (-540.428) * (-542.572) (-541.216) [-541.336] (-544.913) -- 0:00:44
240000 -- [-545.694] (-543.290) (-540.840) (-540.811) * (-543.282) [-543.698] (-542.905) (-541.805) -- 0:00:44
Average standard deviation of split frequencies: 0.012667
240500 -- (-542.940) (-541.800) (-541.291) [-540.524] * (-542.990) (-544.570) (-541.988) [-540.963] -- 0:00:44
241000 -- (-541.829) [-541.689] (-548.380) (-543.461) * (-547.253) (-540.609) [-542.164] (-542.966) -- 0:00:44
241500 -- (-541.821) [-543.550] (-545.328) (-542.725) * (-544.782) (-542.528) (-541.008) [-546.886] -- 0:00:43
242000 -- (-545.226) (-543.775) [-545.151] (-541.783) * (-540.682) [-541.768] (-542.503) (-545.946) -- 0:00:43
242500 -- (-544.796) [-544.501] (-541.524) (-542.239) * [-541.133] (-542.749) (-541.793) (-549.752) -- 0:00:43
243000 -- [-543.850] (-546.207) (-543.395) (-546.731) * (-541.427) (-544.267) (-540.750) [-542.609] -- 0:00:43
243500 -- (-543.970) (-543.178) [-542.818] (-544.166) * [-543.983] (-543.338) (-541.425) (-544.011) -- 0:00:43
244000 -- (-543.416) (-543.339) [-546.600] (-543.902) * [-545.071] (-544.855) (-544.674) (-544.212) -- 0:00:43
244500 -- [-542.123] (-541.094) (-542.220) (-544.105) * (-545.464) [-543.492] (-543.602) (-545.320) -- 0:00:43
245000 -- (-543.502) [-544.952] (-541.707) (-543.494) * (-543.150) (-542.994) (-541.744) [-542.094] -- 0:00:43
Average standard deviation of split frequencies: 0.013414
245500 -- (-544.599) (-541.428) [-540.674] (-540.559) * (-541.463) (-542.335) [-542.386] (-542.956) -- 0:00:43
246000 -- [-543.597] (-540.699) (-543.475) (-544.378) * (-542.296) (-545.663) (-542.219) [-542.642] -- 0:00:42
246500 -- (-544.858) [-543.492] (-540.629) (-544.984) * (-542.847) (-543.424) (-543.749) [-542.531] -- 0:00:42
247000 -- [-541.171] (-547.701) (-543.157) (-545.054) * (-543.231) (-545.483) [-544.789] (-545.746) -- 0:00:42
247500 -- (-541.037) [-543.228] (-541.509) (-541.548) * (-543.411) (-545.026) [-544.427] (-543.364) -- 0:00:42
248000 -- (-545.994) [-541.864] (-542.209) (-543.305) * [-543.595] (-543.684) (-544.014) (-541.251) -- 0:00:42
248500 -- (-542.326) [-541.310] (-542.902) (-541.864) * (-542.768) [-543.744] (-544.242) (-540.672) -- 0:00:42
249000 -- (-547.169) (-542.183) (-545.208) [-542.943] * [-542.156] (-543.421) (-545.129) (-547.916) -- 0:00:42
249500 -- [-543.785] (-544.718) (-542.276) (-544.474) * [-543.022] (-542.539) (-541.804) (-546.475) -- 0:00:42
250000 -- (-550.935) [-543.192] (-542.600) (-545.395) * (-545.999) (-542.715) (-543.539) [-542.212] -- 0:00:42
Average standard deviation of split frequencies: 0.012390
250500 -- (-549.400) (-540.794) (-541.706) [-541.049] * (-542.127) (-542.546) (-542.721) [-542.957] -- 0:00:41
251000 -- (-544.032) [-541.753] (-544.346) (-544.156) * (-544.650) (-543.306) (-541.514) [-541.965] -- 0:00:41
251500 -- (-542.372) (-540.922) (-546.404) [-544.500] * [-541.613] (-540.860) (-544.109) (-540.654) -- 0:00:41
252000 -- (-541.685) [-541.691] (-541.581) (-542.673) * (-544.577) (-542.967) (-545.409) [-542.939] -- 0:00:41
252500 -- (-540.664) (-541.144) [-540.707] (-540.832) * (-541.930) (-541.549) (-543.501) [-545.149] -- 0:00:41
253000 -- (-541.717) (-545.841) (-546.714) [-544.278] * (-540.557) (-541.496) [-544.517] (-548.246) -- 0:00:41
253500 -- (-541.296) [-541.498] (-548.676) (-544.245) * (-541.025) [-541.714] (-546.221) (-543.330) -- 0:00:41
254000 -- (-542.703) (-543.400) (-541.907) [-540.873] * (-545.735) [-542.496] (-541.901) (-542.345) -- 0:00:41
254500 -- (-542.144) (-543.890) (-542.628) [-543.006] * (-548.122) [-541.085] (-541.768) (-544.391) -- 0:00:41
255000 -- [-540.294] (-549.869) (-541.363) (-543.608) * (-545.588) (-541.183) [-541.369] (-540.712) -- 0:00:43
Average standard deviation of split frequencies: 0.010933
255500 -- (-540.338) (-543.258) (-541.532) [-542.115] * (-544.596) [-542.747] (-544.119) (-541.697) -- 0:00:43
256000 -- [-541.553] (-543.285) (-540.675) (-544.121) * (-547.841) [-541.383] (-544.027) (-542.394) -- 0:00:43
256500 -- (-541.502) (-543.424) (-541.184) [-541.806] * (-546.100) [-541.658] (-540.895) (-544.844) -- 0:00:43
257000 -- (-544.525) (-540.220) (-541.076) [-540.997] * (-544.524) (-541.628) (-544.682) [-542.743] -- 0:00:43
257500 -- (-543.236) (-542.611) (-541.730) [-541.060] * [-542.497] (-542.681) (-542.068) (-544.749) -- 0:00:43
258000 -- (-543.083) [-540.579] (-541.715) (-542.249) * (-541.615) (-540.814) (-541.686) [-541.874] -- 0:00:43
258500 -- [-541.934] (-540.463) (-541.804) (-543.624) * (-541.139) (-542.606) (-544.516) [-541.514] -- 0:00:43
259000 -- (-542.506) [-546.023] (-543.586) (-543.139) * [-540.902] (-540.378) (-541.609) (-542.484) -- 0:00:42
259500 -- (-541.155) (-540.909) (-541.597) [-542.491] * (-542.405) (-545.051) [-541.128] (-541.066) -- 0:00:42
260000 -- (-544.506) (-546.099) (-541.113) [-541.406] * (-540.793) (-542.125) (-541.755) [-542.278] -- 0:00:42
Average standard deviation of split frequencies: 0.011642
260500 -- [-542.089] (-546.815) (-542.498) (-542.120) * (-540.695) (-547.529) [-541.807] (-546.785) -- 0:00:42
261000 -- (-541.749) [-544.953] (-541.760) (-543.029) * (-542.203) [-545.632] (-543.268) (-542.039) -- 0:00:42
261500 -- [-541.115] (-545.515) (-542.149) (-545.520) * (-544.408) (-542.325) [-541.135] (-540.966) -- 0:00:42
262000 -- (-542.162) [-541.732] (-543.112) (-544.837) * (-542.197) (-541.918) [-545.565] (-542.452) -- 0:00:42
262500 -- (-544.845) (-545.703) [-542.143] (-544.295) * (-545.326) (-541.056) (-542.178) [-541.914] -- 0:00:42
263000 -- (-541.735) (-544.559) (-543.593) [-541.703] * [-541.408] (-542.591) (-541.063) (-540.830) -- 0:00:42
263500 -- (-541.201) (-544.632) (-541.881) [-543.675] * (-541.116) [-543.367] (-540.593) (-540.593) -- 0:00:41
264000 -- [-542.004] (-545.867) (-540.515) (-548.693) * [-545.720] (-541.933) (-542.135) (-545.236) -- 0:00:41
264500 -- (-545.842) (-546.399) (-540.355) [-543.547] * (-543.214) [-540.995] (-546.354) (-542.063) -- 0:00:41
265000 -- (-542.522) (-544.116) [-540.708] (-543.628) * (-543.365) (-541.122) (-541.874) [-544.032] -- 0:00:41
Average standard deviation of split frequencies: 0.013344
265500 -- (-545.464) [-542.340] (-544.717) (-544.449) * (-545.746) [-540.718] (-544.620) (-542.103) -- 0:00:41
266000 -- (-554.136) [-542.910] (-547.173) (-541.833) * (-542.961) (-541.188) (-540.870) [-541.736] -- 0:00:41
266500 -- (-550.018) [-542.922] (-545.579) (-544.109) * (-544.615) (-551.675) (-541.924) [-541.254] -- 0:00:41
267000 -- [-544.007] (-541.907) (-544.624) (-541.301) * (-542.563) (-541.789) (-547.284) [-544.098] -- 0:00:41
267500 -- (-540.796) (-541.403) (-542.360) [-541.665] * (-543.398) (-546.985) (-550.271) [-543.182] -- 0:00:41
268000 -- (-546.222) (-541.077) [-544.492] (-541.590) * (-543.253) (-543.084) [-545.798] (-541.331) -- 0:00:40
268500 -- (-550.583) (-541.416) (-541.967) [-543.142] * (-542.244) [-541.533] (-542.753) (-544.896) -- 0:00:40
269000 -- [-543.494] (-545.604) (-548.340) (-542.234) * (-542.658) [-543.974] (-547.366) (-541.871) -- 0:00:40
269500 -- (-545.531) (-542.529) [-541.074] (-541.964) * (-543.911) (-541.329) [-542.122] (-547.107) -- 0:00:40
270000 -- [-540.797] (-541.162) (-541.185) (-545.225) * (-545.066) (-544.397) [-541.982] (-541.878) -- 0:00:40
Average standard deviation of split frequencies: 0.013114
270500 -- (-547.271) [-540.909] (-546.553) (-543.746) * (-540.872) [-541.844] (-543.106) (-544.748) -- 0:00:40
271000 -- (-542.106) (-541.230) (-541.109) [-546.638] * (-543.893) [-541.219] (-541.312) (-545.090) -- 0:00:40
271500 -- (-541.525) [-541.664] (-540.865) (-546.948) * (-546.112) [-542.062] (-540.650) (-541.149) -- 0:00:40
272000 -- (-544.202) (-540.638) (-541.210) [-543.407] * [-543.308] (-544.868) (-543.995) (-542.408) -- 0:00:42
272500 -- [-544.842] (-542.366) (-542.092) (-547.629) * (-548.101) (-543.724) [-542.465] (-542.488) -- 0:00:42
273000 -- (-542.731) (-542.749) (-540.434) [-544.130] * (-540.674) [-541.363] (-543.602) (-544.839) -- 0:00:42
273500 -- (-543.822) (-543.422) (-542.866) [-541.259] * (-541.142) [-542.642] (-544.052) (-544.124) -- 0:00:42
274000 -- [-543.381] (-542.079) (-544.546) (-550.565) * (-541.500) (-540.947) (-543.851) [-544.873] -- 0:00:42
274500 -- (-542.311) (-541.493) (-544.441) [-550.700] * (-543.825) [-540.840] (-543.252) (-546.931) -- 0:00:42
275000 -- (-543.162) (-544.420) [-541.361] (-544.896) * (-541.489) [-543.346] (-541.591) (-541.395) -- 0:00:42
Average standard deviation of split frequencies: 0.014267
275500 -- [-546.690] (-543.413) (-542.542) (-549.245) * (-544.428) (-543.196) [-541.825] (-543.971) -- 0:00:42
276000 -- (-544.043) (-542.038) [-542.915] (-541.665) * (-542.496) [-540.592] (-543.182) (-542.393) -- 0:00:41
276500 -- [-542.501] (-543.530) (-541.763) (-542.770) * [-542.607] (-541.802) (-540.840) (-544.616) -- 0:00:41
277000 -- (-543.550) [-543.742] (-542.201) (-541.295) * (-542.262) (-541.700) [-542.738] (-544.041) -- 0:00:41
277500 -- [-540.794] (-541.641) (-543.133) (-542.996) * (-542.928) [-542.630] (-543.291) (-542.426) -- 0:00:41
278000 -- (-544.068) (-542.425) (-541.793) [-541.109] * (-547.464) [-541.994] (-542.246) (-542.005) -- 0:00:41
278500 -- [-541.986] (-542.849) (-544.571) (-543.634) * (-543.879) (-541.907) (-541.902) [-542.154] -- 0:00:41
279000 -- (-544.095) (-542.006) [-543.361] (-544.801) * (-545.599) [-543.428] (-540.604) (-543.635) -- 0:00:41
279500 -- (-542.024) (-544.155) [-541.606] (-544.472) * (-541.571) (-542.396) [-542.556] (-542.646) -- 0:00:41
280000 -- [-544.030] (-542.415) (-540.218) (-543.872) * (-540.724) (-546.392) (-542.874) [-542.817] -- 0:00:41
Average standard deviation of split frequencies: 0.013634
280500 -- (-547.271) [-541.418] (-549.082) (-547.579) * (-544.362) (-543.881) [-542.645] (-542.953) -- 0:00:41
281000 -- [-542.916] (-542.499) (-542.354) (-543.627) * (-540.447) (-541.218) (-541.529) [-542.187] -- 0:00:40
281500 -- (-541.654) (-544.354) (-541.325) [-541.242] * (-541.046) (-544.019) [-541.796] (-542.996) -- 0:00:40
282000 -- (-541.846) (-542.167) [-543.325] (-544.046) * (-542.690) (-540.731) [-542.269] (-543.756) -- 0:00:40
282500 -- (-541.067) [-540.813] (-545.272) (-546.527) * (-545.458) (-541.416) [-542.475] (-544.154) -- 0:00:40
283000 -- (-542.985) (-544.986) (-540.605) [-541.603] * [-543.281] (-541.314) (-541.293) (-549.025) -- 0:00:40
283500 -- [-546.437] (-543.580) (-541.329) (-542.649) * [-542.640] (-544.237) (-543.085) (-546.134) -- 0:00:40
284000 -- [-549.603] (-542.210) (-542.459) (-542.086) * [-543.019] (-542.872) (-542.331) (-541.831) -- 0:00:40
284500 -- (-542.936) (-541.816) [-542.107] (-541.199) * (-542.799) (-541.485) [-542.469] (-540.583) -- 0:00:40
285000 -- [-543.910] (-544.600) (-544.023) (-544.301) * (-546.818) [-541.766] (-541.687) (-545.355) -- 0:00:40
Average standard deviation of split frequencies: 0.011229
285500 -- (-543.944) (-543.696) (-543.441) [-541.278] * (-545.951) (-543.149) (-543.176) [-543.893] -- 0:00:40
286000 -- (-541.617) (-544.473) (-544.883) [-541.418] * (-543.334) (-544.330) (-545.175) [-540.840] -- 0:00:39
286500 -- [-544.470] (-546.043) (-543.519) (-541.296) * (-541.499) (-545.036) [-542.773] (-541.160) -- 0:00:39
287000 -- (-545.591) (-544.583) (-541.492) [-541.525] * (-541.977) (-544.144) [-541.583] (-540.810) -- 0:00:39
287500 -- (-545.858) (-541.565) (-542.665) [-544.016] * (-545.788) (-544.339) [-541.696] (-542.837) -- 0:00:39
288000 -- (-542.808) (-541.861) (-541.505) [-544.820] * (-544.526) (-541.647) (-542.731) [-542.975] -- 0:00:39
288500 -- (-541.232) [-540.858] (-542.668) (-543.065) * (-541.967) (-541.663) [-543.000] (-541.791) -- 0:00:39
289000 -- [-540.808] (-541.284) (-546.040) (-542.144) * (-543.526) (-545.561) (-541.085) [-541.486] -- 0:00:41
289500 -- (-542.434) (-541.314) [-541.911] (-541.178) * (-547.372) (-544.088) [-542.168] (-544.201) -- 0:00:41
290000 -- [-541.651] (-543.995) (-541.774) (-543.456) * (-543.687) (-541.574) [-543.595] (-542.013) -- 0:00:41
Average standard deviation of split frequencies: 0.010947
290500 -- [-542.159] (-543.708) (-541.686) (-545.164) * (-541.071) (-541.299) (-542.690) [-540.789] -- 0:00:41
291000 -- (-544.388) [-540.941] (-541.125) (-541.693) * (-545.726) (-544.636) (-543.833) [-542.117] -- 0:00:41
291500 -- (-544.800) (-541.993) (-543.048) [-543.232] * (-545.494) (-543.243) [-543.428] (-541.711) -- 0:00:41
292000 -- [-541.737] (-541.198) (-543.716) (-544.741) * (-543.245) (-542.558) (-541.733) [-541.741] -- 0:00:41
292500 -- (-542.224) (-541.727) (-544.177) [-541.400] * [-542.779] (-540.789) (-540.747) (-547.883) -- 0:00:41
293000 -- (-542.756) (-542.756) [-541.011] (-544.380) * [-542.182] (-547.266) (-542.733) (-540.713) -- 0:00:41
293500 -- [-543.122] (-544.266) (-545.653) (-545.991) * (-544.324) [-540.312] (-543.821) (-543.073) -- 0:00:40
294000 -- [-544.205] (-542.360) (-542.616) (-543.669) * [-543.423] (-545.643) (-543.120) (-547.414) -- 0:00:40
294500 -- (-545.918) (-543.676) [-543.056] (-544.839) * [-541.769] (-547.497) (-543.639) (-544.649) -- 0:00:40
295000 -- (-543.293) (-542.486) [-541.020] (-544.032) * (-544.634) (-548.450) [-544.154] (-542.507) -- 0:00:40
Average standard deviation of split frequencies: 0.011248
295500 -- (-543.328) (-541.179) (-544.863) [-544.204] * [-542.177] (-543.494) (-543.497) (-544.036) -- 0:00:40
296000 -- (-543.841) (-541.471) [-542.946] (-543.358) * (-548.284) [-544.357] (-541.980) (-542.823) -- 0:00:40
296500 -- [-542.471] (-541.684) (-546.874) (-541.862) * (-540.660) (-542.520) (-541.727) [-543.075] -- 0:00:40
297000 -- (-542.393) (-543.692) (-541.798) [-542.095] * [-543.282] (-542.906) (-540.328) (-544.189) -- 0:00:40
297500 -- (-543.088) (-542.235) (-550.707) [-541.467] * (-544.561) (-541.974) [-541.599] (-543.457) -- 0:00:40
298000 -- [-542.733] (-542.741) (-545.846) (-542.220) * (-541.239) (-544.503) (-545.690) [-546.696] -- 0:00:40
298500 -- (-542.309) (-546.470) (-544.569) [-544.965] * (-541.739) [-542.097] (-544.031) (-552.439) -- 0:00:39
299000 -- [-542.431] (-542.533) (-543.185) (-543.880) * [-547.489] (-541.534) (-543.489) (-543.028) -- 0:00:39
299500 -- (-543.087) (-544.046) [-541.907] (-544.465) * [-542.780] (-541.301) (-542.659) (-544.516) -- 0:00:39
300000 -- (-547.065) (-548.052) [-545.406] (-542.519) * (-543.648) (-543.543) (-544.829) [-542.822] -- 0:00:39
Average standard deviation of split frequencies: 0.011289
300500 -- (-542.110) (-543.887) (-541.870) [-544.207] * (-540.897) [-541.777] (-541.893) (-543.670) -- 0:00:39
301000 -- (-540.921) [-542.579] (-542.229) (-540.718) * (-541.519) (-543.628) [-541.379] (-542.057) -- 0:00:39
301500 -- [-541.421] (-541.676) (-542.068) (-543.351) * [-542.514] (-542.117) (-541.558) (-544.267) -- 0:00:39
302000 -- (-541.993) [-544.379] (-542.072) (-545.508) * (-544.391) (-541.934) [-541.890] (-541.366) -- 0:00:39
302500 -- (-541.646) (-542.019) [-544.994] (-541.739) * (-545.542) [-542.588] (-543.049) (-546.874) -- 0:00:39
303000 -- (-545.556) [-544.065] (-543.718) (-541.170) * [-544.103] (-541.362) (-547.842) (-541.866) -- 0:00:39
303500 -- (-547.378) (-541.453) [-543.651] (-541.147) * (-543.733) [-543.193] (-543.348) (-543.193) -- 0:00:39
304000 -- (-543.730) [-541.838] (-542.503) (-543.736) * [-546.100] (-543.569) (-542.873) (-541.456) -- 0:00:38
304500 -- (-540.539) (-543.079) (-540.798) [-541.401] * (-542.715) (-542.376) [-543.398] (-546.038) -- 0:00:38
305000 -- (-544.775) (-541.020) [-542.735] (-543.743) * (-542.636) [-543.987] (-543.522) (-547.788) -- 0:00:38
Average standard deviation of split frequencies: 0.010784
305500 -- (-542.491) (-542.729) [-541.674] (-542.856) * (-542.936) [-541.817] (-542.978) (-541.953) -- 0:00:38
306000 -- (-542.684) (-541.801) [-542.288] (-543.575) * (-546.114) (-541.899) (-540.889) [-543.544] -- 0:00:38
306500 -- (-543.392) [-540.947] (-543.990) (-541.493) * [-542.788] (-542.804) (-540.976) (-542.673) -- 0:00:40
307000 -- (-542.044) [-542.319] (-542.320) (-544.357) * (-542.498) [-543.455] (-545.254) (-543.018) -- 0:00:40
307500 -- (-545.669) (-544.405) [-543.277] (-542.925) * [-541.736] (-542.785) (-541.910) (-543.165) -- 0:00:40
308000 -- (-543.046) (-543.382) [-541.529] (-542.695) * (-542.152) [-541.338] (-541.868) (-541.473) -- 0:00:40
308500 -- [-542.881] (-541.217) (-544.277) (-543.494) * (-542.980) [-541.195] (-544.839) (-542.918) -- 0:00:40
309000 -- (-543.867) [-542.212] (-545.453) (-540.216) * (-542.302) (-542.325) [-543.228] (-540.732) -- 0:00:40
309500 -- (-541.203) (-541.320) [-542.514] (-541.426) * [-542.838] (-542.686) (-545.768) (-543.276) -- 0:00:40
310000 -- (-541.671) (-542.324) [-541.971] (-544.020) * [-540.446] (-543.626) (-542.820) (-545.024) -- 0:00:40
Average standard deviation of split frequencies: 0.011001
310500 -- (-544.545) (-540.905) (-543.912) [-544.818] * (-540.468) (-545.729) (-548.071) [-546.515] -- 0:00:39
311000 -- [-541.680] (-541.907) (-542.440) (-541.706) * (-540.553) (-543.618) [-540.410] (-541.840) -- 0:00:39
311500 -- (-541.209) [-542.655] (-549.631) (-542.694) * (-542.909) (-544.917) (-541.068) [-544.589] -- 0:00:39
312000 -- (-545.252) [-541.057] (-545.304) (-540.788) * (-542.913) [-542.279] (-541.987) (-542.614) -- 0:00:39
312500 -- (-541.658) [-543.056] (-541.462) (-541.978) * [-542.997] (-543.044) (-542.023) (-545.205) -- 0:00:39
313000 -- [-541.263] (-542.571) (-541.676) (-540.950) * (-541.351) [-543.596] (-541.000) (-541.509) -- 0:00:39
313500 -- [-541.296] (-542.072) (-541.587) (-541.400) * (-541.114) (-545.035) (-543.244) [-541.851] -- 0:00:39
314000 -- (-542.709) (-544.662) (-541.574) [-542.375] * (-547.208) (-541.952) [-541.788] (-542.042) -- 0:00:39
314500 -- (-547.068) [-541.729] (-543.498) (-542.334) * (-547.781) (-541.964) (-542.598) [-542.687] -- 0:00:39
315000 -- (-542.378) (-545.686) (-542.486) [-541.399] * [-545.321] (-544.970) (-541.753) (-549.129) -- 0:00:39
Average standard deviation of split frequencies: 0.010349
315500 -- (-541.338) (-544.255) [-547.596] (-541.680) * (-547.376) (-543.762) (-546.698) [-543.149] -- 0:00:39
316000 -- (-540.614) [-544.727] (-544.391) (-543.192) * (-548.242) (-547.726) [-541.362] (-545.831) -- 0:00:38
316500 -- (-545.330) (-545.031) [-545.129] (-540.581) * (-541.832) (-543.995) (-542.094) [-543.335] -- 0:00:38
317000 -- (-541.637) (-541.603) (-541.443) [-541.178] * (-543.772) [-542.269] (-545.553) (-541.649) -- 0:00:38
317500 -- (-542.870) (-541.270) [-544.244] (-540.967) * [-540.846] (-540.752) (-544.782) (-542.484) -- 0:00:38
318000 -- (-542.135) (-541.106) [-542.123] (-540.533) * (-552.129) [-541.665] (-541.634) (-542.963) -- 0:00:38
318500 -- (-547.819) [-541.150] (-545.597) (-541.431) * (-541.567) (-546.927) (-546.678) [-541.762] -- 0:00:38
319000 -- (-545.415) [-541.872] (-544.329) (-542.485) * (-540.783) (-545.262) (-546.148) [-540.994] -- 0:00:38
319500 -- (-540.982) [-541.767] (-540.862) (-544.489) * (-542.273) [-542.412] (-542.975) (-540.999) -- 0:00:38
320000 -- [-540.998] (-544.135) (-545.123) (-543.566) * (-540.410) (-543.501) [-544.076] (-542.326) -- 0:00:38
Average standard deviation of split frequencies: 0.010781
320500 -- (-544.202) (-541.648) [-545.890] (-543.580) * (-543.053) (-543.737) (-542.157) [-541.985] -- 0:00:38
321000 -- (-549.866) (-543.509) (-543.429) [-540.574] * [-544.812] (-544.212) (-544.113) (-542.773) -- 0:00:38
321500 -- [-541.776] (-544.599) (-543.368) (-541.176) * (-542.224) [-541.883] (-550.581) (-543.895) -- 0:00:37
322000 -- (-540.467) (-542.179) (-541.076) [-540.998] * (-544.207) [-541.718] (-548.224) (-542.937) -- 0:00:37
322500 -- (-541.642) (-545.495) (-544.250) [-541.171] * [-543.604] (-543.099) (-544.371) (-544.067) -- 0:00:37
323000 -- (-544.477) (-546.466) (-541.159) [-543.831] * [-542.074] (-545.042) (-542.553) (-543.358) -- 0:00:37
323500 -- [-540.723] (-547.078) (-543.746) (-541.909) * (-541.224) (-542.878) [-543.161] (-542.438) -- 0:00:39
324000 -- (-543.490) (-541.755) (-548.846) [-541.316] * [-543.344] (-546.214) (-544.078) (-542.336) -- 0:00:39
324500 -- [-543.057] (-540.606) (-541.698) (-540.609) * (-544.525) (-541.763) (-541.599) [-542.276] -- 0:00:39
325000 -- (-542.245) (-544.738) (-541.436) [-543.223] * (-543.427) (-541.219) [-541.801] (-541.279) -- 0:00:39
Average standard deviation of split frequencies: 0.011116
325500 -- (-543.784) (-545.820) (-541.643) [-542.730] * (-541.998) (-540.576) (-540.701) [-541.644] -- 0:00:39
326000 -- (-542.269) (-545.972) [-541.072] (-544.467) * (-541.827) [-544.645] (-540.933) (-542.862) -- 0:00:39
326500 -- [-547.500] (-545.217) (-542.456) (-542.843) * (-541.399) [-542.390] (-544.595) (-541.284) -- 0:00:39
327000 -- (-542.466) (-542.821) (-543.077) [-541.938] * (-542.436) (-544.736) (-544.296) [-542.784] -- 0:00:39
327500 -- (-546.166) [-540.323] (-541.961) (-542.089) * [-542.367] (-541.284) (-541.602) (-540.906) -- 0:00:39
328000 -- (-544.484) [-540.334] (-544.328) (-540.915) * (-544.799) (-545.532) (-543.224) [-541.231] -- 0:00:38
328500 -- [-544.572] (-544.048) (-544.989) (-543.433) * [-542.414] (-543.135) (-541.817) (-542.151) -- 0:00:38
329000 -- (-544.955) [-545.690] (-542.515) (-544.496) * (-543.989) [-544.071] (-542.085) (-542.592) -- 0:00:38
329500 -- (-541.821) (-543.007) (-541.459) [-547.398] * [-540.617] (-547.933) (-542.788) (-543.161) -- 0:00:38
330000 -- (-541.645) [-541.372] (-541.361) (-542.626) * (-541.781) (-543.806) (-545.658) [-542.165] -- 0:00:38
Average standard deviation of split frequencies: 0.010902
330500 -- (-543.009) (-549.150) (-542.225) [-547.936] * (-543.588) (-542.139) [-543.026] (-544.824) -- 0:00:38
331000 -- (-542.754) [-544.560] (-542.528) (-541.311) * (-544.982) (-542.462) [-542.376] (-543.246) -- 0:00:38
331500 -- [-544.691] (-544.785) (-543.707) (-541.278) * (-545.395) (-541.400) [-541.336] (-543.189) -- 0:00:38
332000 -- (-544.820) [-543.486] (-544.121) (-541.888) * (-543.738) (-542.003) (-542.084) [-540.827] -- 0:00:38
332500 -- (-547.644) (-541.273) [-543.596] (-542.474) * (-543.941) [-541.305] (-543.316) (-546.197) -- 0:00:38
333000 -- (-547.995) (-542.397) (-545.439) [-541.483] * [-541.849] (-541.829) (-543.191) (-542.937) -- 0:00:38
333500 -- (-542.066) (-542.664) [-542.216] (-542.600) * (-541.799) (-542.675) (-544.375) [-544.186] -- 0:00:37
334000 -- (-540.510) [-541.533] (-542.552) (-544.603) * (-541.882) [-545.443] (-543.754) (-542.668) -- 0:00:37
334500 -- (-544.464) (-542.818) (-547.288) [-542.820] * (-542.369) [-544.464] (-542.699) (-543.773) -- 0:00:37
335000 -- (-541.713) [-540.871] (-542.392) (-544.798) * (-541.740) (-541.661) (-542.009) [-542.392] -- 0:00:37
Average standard deviation of split frequencies: 0.010698
335500 -- [-540.677] (-543.176) (-542.140) (-545.149) * (-542.009) [-544.657] (-541.284) (-547.907) -- 0:00:37
336000 -- (-541.773) [-547.709] (-542.548) (-542.035) * (-546.782) [-543.121] (-542.465) (-543.742) -- 0:00:37
336500 -- (-541.374) (-545.129) [-542.918] (-547.672) * [-550.770] (-544.953) (-541.958) (-543.934) -- 0:00:37
337000 -- [-541.868] (-540.891) (-542.313) (-540.968) * (-550.351) [-542.040] (-540.625) (-546.258) -- 0:00:37
337500 -- (-540.953) (-542.203) [-543.806] (-542.804) * (-542.221) (-540.591) [-541.004] (-543.056) -- 0:00:37
338000 -- (-541.004) (-542.684) [-540.768] (-544.394) * (-542.547) [-540.477] (-541.087) (-548.478) -- 0:00:37
338500 -- (-544.870) (-542.198) [-540.301] (-542.547) * (-544.439) (-541.648) [-541.167] (-543.562) -- 0:00:37
339000 -- (-547.609) (-543.182) [-540.326] (-544.036) * (-541.180) (-549.945) [-540.603] (-542.496) -- 0:00:37
339500 -- (-543.880) (-541.218) (-541.599) [-541.270] * (-541.216) [-542.579] (-543.188) (-544.993) -- 0:00:36
340000 -- (-543.123) (-541.356) [-541.533] (-540.914) * (-544.109) (-543.867) (-543.091) [-543.191] -- 0:00:36
Average standard deviation of split frequencies: 0.010897
340500 -- (-542.114) (-543.566) (-544.937) [-540.953] * (-543.050) (-545.980) [-541.264] (-542.387) -- 0:00:36
341000 -- (-542.876) (-543.442) [-541.867] (-542.717) * (-541.777) [-544.472] (-541.246) (-543.834) -- 0:00:38
341500 -- (-541.503) (-542.101) (-542.381) [-540.800] * [-542.808] (-541.835) (-541.221) (-543.075) -- 0:00:38
342000 -- (-543.228) (-541.742) [-542.340] (-541.889) * (-544.828) (-541.158) [-540.867] (-546.627) -- 0:00:38
342500 -- (-541.271) (-544.400) (-541.661) [-545.858] * (-541.851) (-541.083) [-540.780] (-540.832) -- 0:00:38
343000 -- [-543.562] (-540.511) (-541.281) (-543.346) * (-541.724) (-540.910) [-540.658] (-543.501) -- 0:00:38
343500 -- (-543.456) (-543.601) [-541.712] (-542.570) * (-542.125) (-543.518) [-543.443] (-541.648) -- 0:00:38
344000 -- (-543.655) (-545.648) (-542.662) [-541.111] * [-548.721] (-545.053) (-543.118) (-544.835) -- 0:00:38
344500 -- (-540.270) (-542.209) (-540.673) [-544.931] * (-540.301) (-544.622) [-541.675] (-543.171) -- 0:00:38
345000 -- [-541.050] (-541.620) (-547.082) (-543.501) * (-543.097) (-543.868) (-541.883) [-543.147] -- 0:00:37
Average standard deviation of split frequencies: 0.010133
345500 -- (-544.531) (-542.713) [-540.941] (-543.590) * (-545.489) (-545.243) (-540.631) [-541.005] -- 0:00:37
346000 -- (-541.585) [-544.588] (-543.555) (-540.616) * [-543.334] (-541.034) (-540.913) (-545.109) -- 0:00:37
346500 -- [-543.262] (-541.848) (-543.895) (-541.534) * (-541.874) [-541.938] (-542.831) (-543.672) -- 0:00:37
347000 -- [-543.604] (-545.846) (-545.666) (-544.730) * (-546.378) (-543.900) [-542.535] (-542.586) -- 0:00:37
347500 -- (-540.339) [-541.404] (-548.297) (-542.992) * (-541.439) (-542.531) [-544.747] (-540.903) -- 0:00:37
348000 -- (-540.335) (-543.825) (-545.339) [-545.084] * (-541.205) (-544.271) (-542.290) [-542.725] -- 0:00:37
348500 -- (-541.968) (-546.124) [-548.963] (-541.097) * (-544.750) (-542.689) (-541.528) [-547.109] -- 0:00:37
349000 -- (-545.673) (-544.056) (-545.189) [-540.527] * (-541.312) [-548.185] (-540.960) (-544.721) -- 0:00:37
349500 -- (-551.628) (-544.298) (-541.681) [-544.821] * [-541.253] (-542.413) (-543.645) (-542.693) -- 0:00:37
350000 -- (-541.232) (-543.512) [-540.875] (-540.399) * (-540.681) (-543.859) [-543.032] (-540.593) -- 0:00:37
Average standard deviation of split frequencies: 0.010923
350500 -- (-542.143) (-541.920) [-543.402] (-540.590) * (-541.997) [-542.925] (-542.449) (-540.984) -- 0:00:37
351000 -- (-542.993) [-543.321] (-544.489) (-540.412) * (-540.977) [-542.120] (-543.212) (-542.752) -- 0:00:36
351500 -- (-542.855) (-544.213) [-542.785] (-542.551) * (-540.458) [-540.562] (-543.001) (-541.584) -- 0:00:36
352000 -- (-545.210) [-542.973] (-541.765) (-541.869) * [-544.196] (-543.803) (-542.254) (-541.732) -- 0:00:36
352500 -- (-542.345) (-541.968) [-540.887] (-542.564) * [-541.183] (-540.813) (-542.715) (-543.947) -- 0:00:36
353000 -- (-544.085) (-540.465) [-542.726] (-543.956) * (-544.264) (-542.788) (-542.186) [-542.614] -- 0:00:36
353500 -- (-544.112) [-543.444] (-540.716) (-542.075) * [-543.213] (-540.352) (-542.351) (-541.616) -- 0:00:36
354000 -- (-541.275) (-541.062) (-541.051) [-541.048] * [-542.419] (-541.321) (-541.666) (-545.151) -- 0:00:36
354500 -- (-541.458) (-542.278) (-544.682) [-541.887] * (-542.653) [-542.327] (-540.601) (-543.801) -- 0:00:36
355000 -- (-542.752) [-542.220] (-544.741) (-541.045) * [-541.655] (-541.225) (-540.507) (-544.151) -- 0:00:36
Average standard deviation of split frequencies: 0.010180
355500 -- [-547.842] (-542.061) (-543.709) (-542.937) * (-540.888) (-542.077) (-542.289) [-543.609] -- 0:00:36
356000 -- (-540.879) [-542.340] (-542.338) (-542.379) * (-540.784) (-543.368) [-543.039] (-542.025) -- 0:00:36
356500 -- (-541.807) (-546.241) (-544.833) [-541.449] * (-542.974) [-541.574] (-545.808) (-542.890) -- 0:00:36
357000 -- (-541.036) [-547.708] (-541.648) (-541.738) * [-540.452] (-544.645) (-544.540) (-541.620) -- 0:00:36
357500 -- (-540.368) (-542.803) [-541.723] (-540.197) * (-546.776) (-543.390) (-544.089) [-543.435] -- 0:00:35
358000 -- (-541.978) (-541.378) (-541.263) [-541.606] * (-542.232) (-541.307) [-543.162] (-544.253) -- 0:00:35
358500 -- (-546.080) (-541.193) [-540.873] (-541.576) * (-541.090) (-545.481) (-541.933) [-543.853] -- 0:00:37
359000 -- [-540.313] (-543.339) (-541.003) (-541.446) * [-540.762] (-542.777) (-542.283) (-543.595) -- 0:00:37
359500 -- (-542.105) (-543.253) [-541.244] (-543.780) * [-541.356] (-542.146) (-542.682) (-541.916) -- 0:00:37
360000 -- (-542.479) [-542.613] (-542.412) (-543.924) * (-542.400) (-543.241) (-545.351) [-543.396] -- 0:00:37
Average standard deviation of split frequencies: 0.010783
360500 -- [-541.629] (-542.024) (-542.983) (-544.172) * (-544.367) [-543.619] (-542.437) (-545.211) -- 0:00:37
361000 -- (-541.796) (-543.286) [-541.358] (-544.689) * [-543.546] (-542.341) (-541.058) (-541.315) -- 0:00:37
361500 -- (-548.788) (-543.613) (-546.257) [-542.143] * [-543.167] (-543.577) (-540.798) (-543.045) -- 0:00:37
362000 -- (-542.240) (-544.253) [-541.671] (-543.957) * (-542.260) [-544.302] (-540.552) (-541.018) -- 0:00:37
362500 -- (-543.089) (-541.948) [-540.903] (-542.262) * (-541.681) (-543.199) (-540.400) [-544.992] -- 0:00:36
363000 -- [-544.699] (-546.479) (-541.748) (-540.748) * (-543.343) (-540.741) [-541.545] (-544.062) -- 0:00:36
363500 -- (-545.180) (-541.546) [-542.304] (-541.062) * (-543.604) [-541.238] (-543.869) (-544.984) -- 0:00:36
364000 -- (-543.661) [-540.713] (-544.073) (-542.529) * (-543.400) (-541.397) [-542.715] (-543.592) -- 0:00:36
364500 -- (-543.748) (-540.843) [-542.877] (-543.823) * (-542.642) [-543.854] (-542.007) (-542.779) -- 0:00:36
365000 -- (-551.699) (-541.724) [-543.051] (-543.745) * (-541.015) [-546.175] (-542.098) (-542.857) -- 0:00:36
Average standard deviation of split frequencies: 0.012808
365500 -- (-541.871) [-543.273] (-543.695) (-542.560) * (-542.041) (-544.380) (-541.879) [-541.282] -- 0:00:36
366000 -- (-540.968) [-540.620] (-541.866) (-541.181) * (-541.423) (-546.293) [-542.869] (-545.130) -- 0:00:36
366500 -- (-543.489) [-541.777] (-542.536) (-542.437) * [-545.412] (-546.182) (-544.342) (-544.429) -- 0:00:36
367000 -- (-542.295) (-545.017) [-544.593] (-544.039) * (-544.710) [-540.515] (-542.080) (-542.783) -- 0:00:36
367500 -- (-544.955) (-542.818) (-542.716) [-541.962] * [-541.404] (-541.487) (-551.987) (-540.833) -- 0:00:36
368000 -- (-545.154) (-542.549) (-543.335) [-542.828] * (-541.028) [-542.030] (-542.166) (-546.502) -- 0:00:36
368500 -- (-541.510) (-542.869) (-543.246) [-543.008] * (-543.912) (-543.654) (-540.687) [-541.172] -- 0:00:35
369000 -- (-542.442) (-542.394) (-540.992) [-541.986] * [-541.736] (-543.709) (-542.744) (-545.739) -- 0:00:35
369500 -- (-541.186) [-542.326] (-544.264) (-542.435) * [-542.113] (-543.306) (-548.688) (-540.838) -- 0:00:35
370000 -- (-543.381) (-544.234) [-541.138] (-542.496) * (-543.133) [-542.883] (-543.168) (-540.838) -- 0:00:35
Average standard deviation of split frequencies: 0.013765
370500 -- [-542.386] (-544.158) (-542.299) (-541.828) * (-541.676) (-541.360) (-548.602) [-541.005] -- 0:00:35
371000 -- [-542.514] (-541.242) (-541.615) (-541.635) * (-543.093) [-540.540] (-549.873) (-542.529) -- 0:00:35
371500 -- [-542.129] (-542.110) (-542.938) (-545.997) * [-540.676] (-541.884) (-548.101) (-543.701) -- 0:00:35
372000 -- (-542.013) [-541.338] (-540.487) (-546.763) * (-542.687) (-544.369) (-542.935) [-541.106] -- 0:00:35
372500 -- [-541.412] (-541.413) (-541.774) (-543.165) * [-543.291] (-540.401) (-541.611) (-545.958) -- 0:00:35
373000 -- (-541.455) [-540.724] (-543.384) (-543.343) * [-543.446] (-540.781) (-549.441) (-544.535) -- 0:00:35
373500 -- (-542.359) [-545.675] (-545.178) (-543.797) * (-541.108) (-540.309) (-548.051) [-541.659] -- 0:00:35
374000 -- (-541.460) (-546.992) [-544.283] (-544.978) * (-541.572) (-541.598) (-542.314) [-540.978] -- 0:00:35
374500 -- (-540.785) [-541.769] (-542.220) (-541.932) * [-540.641] (-542.346) (-543.407) (-543.916) -- 0:00:35
375000 -- (-545.844) (-540.640) [-542.816] (-544.646) * (-545.357) (-545.294) (-542.724) [-541.705] -- 0:00:35
Average standard deviation of split frequencies: 0.013290
375500 -- (-544.682) (-545.601) (-541.409) [-542.834] * (-548.452) (-541.728) (-544.046) [-541.444] -- 0:00:36
376000 -- (-540.867) [-542.762] (-543.878) (-542.637) * (-542.742) (-544.044) [-543.090] (-543.157) -- 0:00:36
376500 -- [-542.451] (-542.843) (-542.085) (-542.702) * (-543.072) (-544.555) [-541.024] (-541.758) -- 0:00:36
377000 -- (-543.698) (-545.909) (-541.336) [-542.120] * (-545.303) (-541.701) [-541.046] (-540.690) -- 0:00:36
377500 -- [-543.899] (-543.421) (-541.687) (-544.587) * (-542.436) (-545.781) [-542.173] (-543.138) -- 0:00:36
378000 -- (-545.354) (-540.759) (-541.547) [-541.875] * [-544.474] (-545.805) (-544.323) (-542.956) -- 0:00:36
378500 -- (-546.127) [-544.940] (-543.133) (-543.361) * (-542.188) (-542.273) [-542.564] (-541.224) -- 0:00:36
379000 -- [-543.866] (-544.065) (-545.479) (-542.164) * (-544.179) (-542.644) (-540.334) [-541.699] -- 0:00:36
379500 -- (-542.695) [-542.637] (-544.047) (-546.172) * [-544.141] (-542.863) (-541.650) (-541.932) -- 0:00:35
380000 -- (-541.853) [-542.023] (-543.173) (-542.820) * [-544.465] (-543.943) (-540.672) (-541.748) -- 0:00:35
Average standard deviation of split frequencies: 0.012631
380500 -- (-542.775) (-544.865) (-541.744) [-540.945] * (-542.006) [-542.870] (-542.020) (-541.660) -- 0:00:35
381000 -- (-543.481) [-540.474] (-544.133) (-544.806) * (-540.839) [-542.175] (-543.214) (-544.677) -- 0:00:35
381500 -- (-542.455) [-541.881] (-543.861) (-547.876) * (-545.537) (-546.660) [-545.063] (-542.612) -- 0:00:35
382000 -- (-543.258) (-544.587) (-542.621) [-542.272] * [-544.849] (-542.694) (-545.049) (-542.797) -- 0:00:35
382500 -- (-546.142) [-541.686] (-543.503) (-544.510) * (-542.619) (-542.325) (-542.197) [-541.188] -- 0:00:35
383000 -- (-545.077) (-544.479) (-547.304) [-541.806] * [-542.562] (-542.251) (-546.462) (-542.000) -- 0:00:35
383500 -- (-541.733) [-545.041] (-543.901) (-547.493) * (-543.487) (-544.771) (-541.734) [-542.769] -- 0:00:35
384000 -- (-542.580) (-542.768) [-540.834] (-548.422) * (-541.667) [-541.858] (-543.388) (-542.313) -- 0:00:35
384500 -- (-543.511) [-542.949] (-544.031) (-547.977) * [-541.060] (-544.949) (-542.622) (-541.097) -- 0:00:35
385000 -- (-542.528) [-543.099] (-542.445) (-544.120) * (-540.817) (-541.302) (-543.381) [-540.202] -- 0:00:35
Average standard deviation of split frequencies: 0.010848
385500 -- (-542.817) (-543.119) [-542.213] (-542.071) * (-541.294) [-542.438] (-543.228) (-541.452) -- 0:00:35
386000 -- (-542.304) (-542.041) (-543.858) [-541.650] * (-540.945) (-542.165) [-542.515] (-545.712) -- 0:00:34
386500 -- (-545.369) (-542.927) (-543.468) [-541.020] * (-544.865) [-541.137] (-542.882) (-546.285) -- 0:00:34
387000 -- [-542.983] (-549.126) (-541.040) (-542.050) * (-542.971) [-542.805] (-546.957) (-546.136) -- 0:00:34
387500 -- [-541.638] (-541.595) (-544.933) (-544.305) * (-541.902) [-541.464] (-542.940) (-540.718) -- 0:00:34
388000 -- (-541.524) (-541.221) (-547.481) [-542.049] * (-542.075) (-540.857) (-543.369) [-541.451] -- 0:00:34
388500 -- [-546.564] (-542.894) (-546.525) (-543.623) * (-543.635) (-541.717) (-544.919) [-542.933] -- 0:00:34
389000 -- (-545.300) (-542.600) (-545.750) [-541.890] * [-541.119] (-542.772) (-549.526) (-543.901) -- 0:00:34
389500 -- [-543.884] (-542.364) (-541.961) (-542.647) * (-542.653) (-540.996) [-546.205] (-546.612) -- 0:00:34
390000 -- [-544.828] (-542.344) (-541.569) (-543.492) * [-542.629] (-544.702) (-541.348) (-543.379) -- 0:00:34
Average standard deviation of split frequencies: 0.011073
390500 -- (-546.969) (-542.538) (-544.097) [-542.790] * (-541.056) [-543.893] (-542.936) (-546.192) -- 0:00:34
391000 -- (-541.127) (-541.485) [-541.725] (-541.208) * (-541.089) (-544.169) (-541.147) [-541.986] -- 0:00:34
391500 -- [-541.043] (-542.868) (-543.312) (-542.204) * (-542.558) (-542.753) [-542.108] (-542.480) -- 0:00:34
392000 -- (-543.997) (-547.258) [-543.226] (-542.788) * (-544.163) (-546.258) [-541.293] (-542.113) -- 0:00:34
392500 -- (-540.773) (-543.495) [-542.033] (-540.867) * (-545.826) (-543.116) [-541.652] (-541.676) -- 0:00:34
393000 -- (-542.492) (-542.533) [-541.766] (-541.994) * [-542.159] (-542.993) (-544.004) (-541.947) -- 0:00:35
393500 -- (-545.621) (-542.801) (-541.664) [-543.662] * (-542.430) [-547.224] (-542.885) (-543.703) -- 0:00:35
394000 -- (-546.531) [-542.046] (-540.220) (-552.355) * (-542.925) [-541.033] (-541.462) (-541.381) -- 0:00:35
394500 -- [-542.288] (-541.761) (-541.324) (-546.910) * (-542.761) (-541.596) (-540.946) [-541.382] -- 0:00:35
395000 -- [-543.065] (-543.109) (-541.660) (-541.934) * (-546.771) [-540.585] (-541.438) (-541.838) -- 0:00:35
Average standard deviation of split frequencies: 0.010854
395500 -- (-541.956) (-542.286) [-543.872] (-542.799) * (-542.213) (-540.879) [-542.637] (-541.233) -- 0:00:35
396000 -- (-547.719) (-546.538) (-541.453) [-540.755] * (-545.578) (-541.492) [-542.695] (-541.821) -- 0:00:35
396500 -- (-544.732) (-543.966) [-543.734] (-546.591) * (-548.138) (-546.010) (-546.908) [-545.078] -- 0:00:35
397000 -- (-543.076) (-543.536) [-542.470] (-544.905) * [-541.674] (-543.018) (-542.844) (-542.164) -- 0:00:34
397500 -- (-542.460) [-543.267] (-541.959) (-542.261) * [-543.567] (-542.828) (-547.968) (-541.313) -- 0:00:34
398000 -- (-543.453) (-541.945) (-541.015) [-541.270] * [-541.498] (-544.004) (-545.532) (-542.195) -- 0:00:34
398500 -- (-544.387) [-541.332] (-543.268) (-543.432) * [-542.858] (-543.524) (-542.178) (-541.129) -- 0:00:34
399000 -- (-544.700) [-541.316] (-543.742) (-541.210) * (-542.001) (-543.165) [-541.060] (-541.879) -- 0:00:34
399500 -- (-544.528) (-541.080) (-545.096) [-545.877] * [-543.751] (-542.321) (-541.085) (-542.330) -- 0:00:34
400000 -- (-541.395) (-542.312) (-541.178) [-543.891] * [-541.037] (-542.660) (-541.251) (-544.108) -- 0:00:34
Average standard deviation of split frequencies: 0.010520
400500 -- (-545.338) (-544.872) (-544.193) [-542.209] * (-541.575) [-543.195] (-542.917) (-543.908) -- 0:00:34
401000 -- [-544.017] (-545.051) (-541.142) (-541.328) * [-541.613] (-544.209) (-540.700) (-543.071) -- 0:00:34
401500 -- (-541.662) [-540.694] (-542.066) (-542.421) * (-541.650) (-541.373) (-544.875) [-541.422] -- 0:00:34
402000 -- (-541.199) (-541.449) (-541.388) [-542.064] * (-543.129) [-542.491] (-542.559) (-543.253) -- 0:00:34
402500 -- [-541.963] (-542.634) (-541.247) (-542.027) * (-544.220) [-540.994] (-541.168) (-543.101) -- 0:00:34
403000 -- (-544.859) [-542.497] (-541.620) (-548.494) * [-541.373] (-542.759) (-544.228) (-544.443) -- 0:00:34
403500 -- (-543.390) (-541.891) (-540.992) [-546.401] * (-541.766) (-543.807) [-540.889] (-545.995) -- 0:00:34
404000 -- (-542.187) [-544.157] (-542.333) (-541.401) * (-541.165) (-544.684) (-541.171) [-544.542] -- 0:00:33
404500 -- (-542.638) (-542.358) (-544.767) [-542.057] * (-542.181) [-540.771] (-541.240) (-544.073) -- 0:00:33
405000 -- (-544.388) [-541.413] (-541.892) (-541.134) * [-541.903] (-541.451) (-542.455) (-541.569) -- 0:00:33
Average standard deviation of split frequencies: 0.010450
405500 -- [-547.772] (-542.106) (-548.903) (-544.497) * (-546.896) [-542.865] (-540.509) (-542.906) -- 0:00:33
406000 -- (-541.839) (-541.592) (-544.867) [-541.041] * (-543.400) (-545.318) (-541.832) [-541.968] -- 0:00:33
406500 -- [-541.661] (-540.990) (-545.713) (-542.226) * [-542.768] (-542.367) (-543.330) (-543.343) -- 0:00:33
407000 -- (-541.234) [-541.029] (-541.425) (-542.087) * (-543.483) [-544.207] (-544.326) (-545.882) -- 0:00:33
407500 -- (-543.012) (-544.248) (-541.903) [-541.634] * [-549.511] (-545.157) (-543.928) (-542.866) -- 0:00:33
408000 -- (-541.043) [-544.036] (-544.020) (-545.599) * (-544.391) (-543.387) [-545.353] (-544.689) -- 0:00:33
408500 -- (-549.225) (-541.533) (-541.682) [-541.640] * (-540.395) (-542.708) [-542.470] (-541.880) -- 0:00:33
409000 -- [-543.957] (-543.001) (-541.261) (-542.579) * (-541.721) [-541.967] (-540.284) (-542.843) -- 0:00:33
409500 -- (-540.990) (-543.207) [-540.530] (-542.083) * (-540.962) (-540.810) [-540.698] (-542.168) -- 0:00:33
410000 -- [-541.959] (-541.657) (-540.730) (-541.719) * (-540.597) [-540.286] (-540.364) (-541.862) -- 0:00:34
Average standard deviation of split frequencies: 0.010601
410500 -- (-542.428) [-541.982] (-543.348) (-542.600) * [-544.549] (-544.417) (-540.702) (-544.779) -- 0:00:34
411000 -- (-542.867) [-541.544] (-544.108) (-541.738) * (-543.043) (-544.646) (-542.171) [-543.952] -- 0:00:34
411500 -- (-545.350) (-542.385) [-542.298] (-541.598) * [-542.804] (-542.891) (-543.207) (-543.615) -- 0:00:34
412000 -- (-542.759) (-542.943) (-542.859) [-545.858] * (-542.303) (-541.687) [-544.191] (-543.844) -- 0:00:34
412500 -- (-543.745) [-545.182] (-545.353) (-548.745) * (-541.163) [-541.263] (-543.574) (-541.189) -- 0:00:34
413000 -- [-540.974] (-541.481) (-544.768) (-543.532) * (-544.216) [-540.651] (-542.202) (-544.690) -- 0:00:34
413500 -- (-543.338) [-542.699] (-546.790) (-543.046) * [-542.883] (-540.484) (-541.548) (-544.713) -- 0:00:34
414000 -- (-542.403) (-543.529) [-540.424] (-547.011) * [-543.291] (-543.250) (-544.108) (-544.649) -- 0:00:33
414500 -- (-541.767) (-540.968) [-541.482] (-544.349) * (-543.730) (-543.197) (-541.181) [-543.591] -- 0:00:33
415000 -- [-542.043] (-542.626) (-543.850) (-542.025) * (-541.552) (-543.590) (-541.696) [-541.506] -- 0:00:33
Average standard deviation of split frequencies: 0.010865
415500 -- (-541.881) [-542.073] (-542.440) (-543.074) * [-542.880] (-545.055) (-540.713) (-542.909) -- 0:00:33
416000 -- (-545.036) [-546.373] (-541.858) (-540.905) * (-541.833) (-541.617) [-542.187] (-541.177) -- 0:00:33
416500 -- (-546.692) [-543.843] (-541.835) (-541.374) * (-542.682) (-543.441) [-542.973] (-542.517) -- 0:00:33
417000 -- (-543.376) (-542.213) [-541.438] (-543.554) * (-542.350) (-548.317) (-540.848) [-542.313] -- 0:00:33
417500 -- (-542.359) [-542.375] (-542.288) (-547.501) * [-540.475] (-552.604) (-541.571) (-541.242) -- 0:00:33
418000 -- [-543.277] (-542.920) (-542.278) (-546.296) * (-543.486) [-540.663] (-541.524) (-542.977) -- 0:00:33
418500 -- (-544.442) (-543.184) [-542.399] (-542.392) * (-544.284) (-541.062) (-540.844) [-542.770] -- 0:00:33
419000 -- (-546.287) (-544.099) [-544.045] (-542.310) * (-544.292) [-542.142] (-542.233) (-542.769) -- 0:00:33
419500 -- (-548.186) (-542.633) [-541.305] (-541.393) * (-541.853) (-544.440) [-541.115] (-541.651) -- 0:00:33
420000 -- (-544.050) [-544.230] (-540.622) (-548.372) * (-541.618) (-543.148) [-541.472] (-542.855) -- 0:00:33
Average standard deviation of split frequencies: 0.010349
420500 -- (-542.130) (-541.975) [-542.502] (-543.759) * (-541.878) (-544.690) [-542.356] (-543.093) -- 0:00:33
421000 -- (-543.129) [-545.356] (-544.730) (-541.966) * (-541.373) (-543.513) (-540.599) [-541.260] -- 0:00:33
421500 -- (-543.078) [-541.408] (-541.378) (-540.760) * (-541.973) (-546.813) (-541.930) [-547.765] -- 0:00:32
422000 -- (-542.536) (-543.892) (-542.701) [-546.431] * [-544.168] (-542.705) (-541.420) (-546.569) -- 0:00:32
422500 -- (-545.629) (-541.851) [-542.559] (-541.128) * (-546.228) (-546.649) [-541.144] (-541.989) -- 0:00:32
423000 -- (-542.170) (-543.459) (-547.817) [-541.327] * (-542.479) [-544.715] (-541.341) (-543.487) -- 0:00:32
423500 -- [-541.842] (-541.840) (-542.869) (-542.090) * (-544.434) (-545.481) [-542.234] (-541.882) -- 0:00:32
424000 -- (-542.237) (-544.698) (-542.626) [-542.325] * (-541.687) [-543.300] (-542.278) (-545.680) -- 0:00:32
424500 -- (-540.787) (-541.915) [-541.694] (-542.928) * (-542.495) (-542.922) [-541.342] (-545.639) -- 0:00:32
425000 -- (-542.723) [-540.900] (-542.471) (-545.534) * (-540.287) (-541.267) [-542.889] (-541.972) -- 0:00:32
Average standard deviation of split frequencies: 0.009504
425500 -- (-541.005) (-541.129) [-543.202] (-541.701) * (-542.913) (-545.292) (-543.714) [-542.139] -- 0:00:32
426000 -- [-541.442] (-541.528) (-541.777) (-541.763) * (-542.353) (-548.690) [-540.866] (-548.250) -- 0:00:32
426500 -- (-541.903) [-544.934] (-540.893) (-542.894) * (-546.615) [-541.526] (-544.989) (-546.623) -- 0:00:32
427000 -- [-542.499] (-542.114) (-541.883) (-542.265) * (-543.688) (-541.652) (-543.811) [-540.639] -- 0:00:33
427500 -- (-542.231) (-540.696) [-541.920] (-542.942) * (-546.914) [-542.229] (-543.717) (-542.117) -- 0:00:33
428000 -- (-541.220) [-544.519] (-541.812) (-543.291) * [-543.957] (-543.922) (-541.274) (-543.242) -- 0:00:33
428500 -- (-542.510) [-542.441] (-544.294) (-544.623) * (-541.981) (-541.377) [-545.943] (-546.995) -- 0:00:33
429000 -- (-541.504) (-542.558) (-540.714) [-543.467] * [-540.771] (-542.274) (-543.161) (-542.418) -- 0:00:33
429500 -- (-542.647) (-540.811) (-546.995) [-543.897] * (-542.730) (-541.406) [-541.599] (-540.454) -- 0:00:33
430000 -- (-543.282) (-542.469) [-543.727] (-542.086) * (-540.782) (-542.288) [-541.415] (-542.587) -- 0:00:33
Average standard deviation of split frequencies: 0.010109
430500 -- [-547.107] (-542.182) (-542.049) (-543.396) * (-540.837) [-540.527] (-543.054) (-541.483) -- 0:00:33
431000 -- [-545.290] (-542.182) (-546.981) (-543.965) * (-549.335) (-540.345) (-544.778) [-545.449] -- 0:00:33
431500 -- (-542.719) [-542.172] (-542.626) (-540.758) * (-546.576) [-540.388] (-543.186) (-541.465) -- 0:00:32
432000 -- (-543.314) (-545.433) (-541.991) [-540.582] * (-542.352) (-540.504) [-544.937] (-544.237) -- 0:00:32
432500 -- (-545.782) (-546.873) [-540.819] (-541.299) * (-541.910) (-545.014) (-547.236) [-541.395] -- 0:00:32
433000 -- (-547.124) (-541.416) (-542.994) [-541.210] * (-543.337) (-548.056) (-542.959) [-543.025] -- 0:00:32
433500 -- (-544.945) (-541.473) (-542.579) [-543.493] * (-543.515) (-541.319) (-542.386) [-548.782] -- 0:00:32
434000 -- [-541.289] (-542.691) (-542.406) (-542.912) * (-542.017) (-541.362) [-543.632] (-545.204) -- 0:00:32
434500 -- (-540.799) (-546.619) [-540.873] (-540.632) * (-541.609) (-541.187) (-541.386) [-543.316] -- 0:00:32
435000 -- [-542.892] (-549.030) (-540.747) (-541.911) * [-541.792] (-540.916) (-547.883) (-546.057) -- 0:00:32
Average standard deviation of split frequencies: 0.010474
435500 -- (-544.810) (-542.237) [-540.462] (-544.002) * (-542.730) (-543.740) (-540.845) [-544.115] -- 0:00:32
436000 -- (-541.224) (-543.557) [-542.599] (-542.777) * (-541.709) (-541.895) (-542.624) [-541.867] -- 0:00:32
436500 -- [-541.996] (-543.733) (-541.730) (-542.463) * (-541.387) (-542.493) [-544.744] (-541.808) -- 0:00:32
437000 -- (-540.361) [-542.799] (-542.972) (-541.132) * (-543.259) [-546.222] (-542.376) (-541.989) -- 0:00:32
437500 -- [-542.514] (-541.783) (-541.774) (-543.047) * (-541.522) [-546.163] (-542.253) (-545.228) -- 0:00:32
438000 -- [-540.659] (-541.264) (-541.741) (-546.514) * (-543.023) [-549.295] (-540.674) (-541.934) -- 0:00:32
438500 -- (-542.769) (-543.665) [-540.829] (-547.401) * (-542.924) [-544.553] (-541.204) (-543.848) -- 0:00:32
439000 -- (-545.741) (-543.172) (-543.221) [-541.808] * (-543.189) [-541.853] (-542.176) (-542.112) -- 0:00:31
439500 -- [-546.253] (-544.407) (-544.796) (-545.616) * (-543.889) (-543.029) [-541.688] (-542.942) -- 0:00:31
440000 -- (-547.624) [-541.234] (-542.433) (-542.685) * (-541.043) (-542.265) (-542.912) [-542.665] -- 0:00:31
Average standard deviation of split frequencies: 0.010497
440500 -- [-541.455] (-541.524) (-542.932) (-541.274) * (-544.462) (-541.243) [-542.807] (-544.379) -- 0:00:31
441000 -- (-544.757) (-541.524) (-543.943) [-541.142] * (-543.951) (-543.822) [-543.873] (-540.713) -- 0:00:31
441500 -- [-540.918] (-544.056) (-542.256) (-542.657) * (-543.423) (-541.078) [-542.569] (-544.019) -- 0:00:31
442000 -- (-541.633) (-543.413) (-542.459) [-546.357] * [-542.045] (-543.904) (-544.213) (-543.878) -- 0:00:31
442500 -- (-542.775) [-547.402] (-542.524) (-543.241) * (-541.171) (-542.297) [-540.712] (-544.594) -- 0:00:31
443000 -- (-544.872) [-544.263] (-542.538) (-543.152) * (-543.532) (-542.991) (-544.540) [-541.061] -- 0:00:31
443500 -- (-543.881) (-542.643) (-542.878) [-545.892] * [-544.286] (-542.603) (-541.988) (-540.986) -- 0:00:31
444000 -- [-541.923] (-543.230) (-542.068) (-542.344) * (-542.637) [-540.542] (-542.360) (-548.920) -- 0:00:31
444500 -- [-543.069] (-545.194) (-543.658) (-541.997) * (-540.810) [-541.215] (-546.149) (-540.612) -- 0:00:32
445000 -- [-541.790] (-543.994) (-540.701) (-542.286) * (-543.129) [-542.428] (-542.499) (-548.183) -- 0:00:32
Average standard deviation of split frequencies: 0.010834
445500 -- (-543.118) (-543.530) [-542.619] (-542.532) * [-543.513] (-544.042) (-544.813) (-544.141) -- 0:00:32
446000 -- (-545.366) (-545.961) [-540.759] (-543.062) * [-542.907] (-541.685) (-542.856) (-543.820) -- 0:00:32
446500 -- (-544.016) (-542.647) (-542.180) [-540.893] * (-547.182) (-541.563) (-541.995) [-541.071] -- 0:00:32
447000 -- (-540.429) (-543.982) [-542.882] (-542.147) * [-541.913] (-547.662) (-540.875) (-542.607) -- 0:00:32
447500 -- [-542.753] (-541.231) (-541.987) (-543.281) * (-541.876) (-546.985) [-542.419] (-541.470) -- 0:00:32
448000 -- (-544.253) (-542.899) [-543.802] (-542.386) * (-542.892) (-541.784) [-540.885] (-546.613) -- 0:00:32
448500 -- (-542.837) (-542.489) [-542.945] (-547.373) * (-543.163) (-543.340) (-545.372) [-545.722] -- 0:00:31
449000 -- [-542.625] (-544.251) (-543.236) (-542.246) * (-542.692) [-541.482] (-544.003) (-541.434) -- 0:00:31
449500 -- (-543.616) [-547.605] (-541.366) (-544.265) * (-543.387) [-540.731] (-542.852) (-540.273) -- 0:00:31
450000 -- (-540.786) (-546.939) (-544.421) [-542.711] * [-546.286] (-543.179) (-542.906) (-543.283) -- 0:00:31
Average standard deviation of split frequencies: 0.010264
450500 -- [-540.800] (-543.376) (-545.699) (-541.762) * (-544.453) [-541.626] (-544.017) (-544.691) -- 0:00:31
451000 -- (-542.860) (-544.139) (-542.552) [-545.136] * (-540.800) [-543.594] (-543.801) (-546.720) -- 0:00:31
451500 -- [-548.757] (-544.433) (-542.697) (-542.056) * (-541.368) (-540.987) [-543.283] (-542.161) -- 0:00:31
452000 -- (-541.687) [-541.109] (-543.120) (-541.269) * (-540.868) (-540.505) (-543.220) [-540.938] -- 0:00:31
452500 -- (-543.217) (-541.803) (-541.302) [-541.938] * (-541.762) (-541.996) (-542.859) [-542.278] -- 0:00:31
453000 -- (-546.346) [-543.367] (-543.814) (-543.336) * [-542.405] (-541.955) (-541.899) (-542.831) -- 0:00:31
453500 -- (-541.932) (-542.311) [-542.847] (-542.558) * [-542.068] (-543.292) (-543.109) (-541.769) -- 0:00:31
454000 -- [-543.612] (-548.344) (-544.261) (-546.834) * (-541.576) (-541.536) (-546.476) [-544.179] -- 0:00:31
454500 -- (-540.891) (-544.478) [-545.507] (-543.696) * [-545.171] (-541.737) (-543.056) (-542.814) -- 0:00:31
455000 -- (-541.752) (-544.388) [-543.519] (-545.755) * (-542.884) [-544.216] (-542.530) (-542.341) -- 0:00:31
Average standard deviation of split frequencies: 0.010338
455500 -- (-541.388) [-547.058] (-540.885) (-542.225) * (-546.988) (-541.178) (-540.778) [-542.541] -- 0:00:31
456000 -- [-541.699] (-543.569) (-541.397) (-543.561) * (-542.742) (-542.351) (-541.130) [-544.733] -- 0:00:31
456500 -- (-543.314) (-543.426) [-543.344] (-543.881) * [-542.158] (-548.208) (-544.856) (-542.880) -- 0:00:30
457000 -- [-542.505] (-542.438) (-543.374) (-543.259) * [-542.798] (-542.096) (-543.510) (-544.249) -- 0:00:30
457500 -- (-541.564) (-540.752) (-544.134) [-542.584] * (-541.411) (-547.647) (-540.987) [-540.969] -- 0:00:30
458000 -- (-542.538) (-544.879) (-541.599) [-542.901] * (-540.294) (-542.822) [-541.057] (-541.265) -- 0:00:30
458500 -- (-543.073) (-541.802) [-542.133] (-545.193) * (-541.905) (-542.641) [-542.152] (-541.725) -- 0:00:30
459000 -- (-542.364) (-542.306) [-542.087] (-550.436) * (-543.052) (-540.499) [-541.609] (-541.844) -- 0:00:30
459500 -- (-541.032) (-543.209) [-541.193] (-542.318) * [-540.467] (-549.844) (-544.137) (-544.362) -- 0:00:30
460000 -- (-545.834) (-542.598) (-542.760) [-543.073] * (-542.869) (-540.993) [-542.988] (-545.353) -- 0:00:30
Average standard deviation of split frequencies: 0.010297
460500 -- [-542.585] (-543.235) (-541.229) (-544.018) * (-545.025) (-542.645) [-540.888] (-552.454) -- 0:00:30
461000 -- (-544.347) (-543.693) [-541.805] (-543.965) * (-543.873) [-540.808] (-542.232) (-548.245) -- 0:00:30
461500 -- [-541.894] (-545.106) (-543.728) (-547.787) * (-544.097) (-543.677) (-540.984) [-542.738] -- 0:00:30
462000 -- (-544.192) (-543.623) [-544.358] (-546.580) * (-542.222) (-540.526) [-543.140] (-542.990) -- 0:00:31
462500 -- (-547.362) [-542.482] (-543.630) (-544.136) * (-542.215) (-541.842) (-541.987) [-541.039] -- 0:00:31
463000 -- (-540.780) [-542.594] (-543.101) (-540.626) * (-542.272) [-545.695] (-546.566) (-542.584) -- 0:00:31
463500 -- (-543.452) (-543.280) (-543.249) [-542.416] * [-541.914] (-541.478) (-542.629) (-542.096) -- 0:00:31
464000 -- (-542.131) (-541.102) (-543.434) [-541.653] * (-542.075) (-544.317) [-542.899] (-543.659) -- 0:00:31
464500 -- (-547.082) (-540.742) [-543.338] (-541.751) * (-543.191) [-544.814] (-543.668) (-546.807) -- 0:00:31
465000 -- (-544.752) [-540.799] (-544.827) (-544.026) * (-543.862) [-542.033] (-544.068) (-545.038) -- 0:00:31
Average standard deviation of split frequencies: 0.009926
465500 -- (-542.557) (-545.155) [-541.295] (-543.126) * [-544.624] (-544.636) (-542.665) (-546.870) -- 0:00:31
466000 -- [-542.995] (-543.050) (-542.323) (-547.000) * [-542.366] (-541.299) (-542.364) (-547.634) -- 0:00:30
466500 -- [-543.314] (-543.089) (-541.918) (-542.000) * (-545.639) (-542.773) [-543.730] (-542.931) -- 0:00:30
467000 -- (-541.683) [-542.315] (-546.494) (-540.892) * [-542.691] (-541.591) (-543.310) (-546.065) -- 0:00:30
467500 -- (-542.170) (-542.789) (-541.499) [-544.725] * (-542.726) (-542.777) (-542.021) [-543.045] -- 0:00:30
468000 -- (-541.396) [-542.766] (-541.111) (-546.858) * (-544.657) [-543.034] (-540.849) (-542.645) -- 0:00:30
468500 -- [-542.916] (-541.148) (-541.220) (-543.787) * (-542.516) [-540.998] (-545.329) (-540.659) -- 0:00:30
469000 -- (-541.862) (-541.904) (-543.908) [-543.658] * (-542.842) [-540.579] (-544.589) (-545.431) -- 0:00:30
469500 -- (-542.003) (-543.007) [-541.620] (-543.466) * (-542.808) [-540.309] (-543.978) (-543.688) -- 0:00:30
470000 -- [-544.368] (-541.005) (-541.996) (-541.447) * (-542.115) [-541.207] (-540.620) (-543.991) -- 0:00:30
Average standard deviation of split frequencies: 0.009577
470500 -- [-540.613] (-541.760) (-543.524) (-542.580) * (-543.444) [-542.438] (-541.722) (-541.236) -- 0:00:30
471000 -- (-542.979) [-543.380] (-546.172) (-547.137) * (-545.282) [-542.017] (-541.264) (-541.920) -- 0:00:30
471500 -- (-543.413) (-542.571) (-542.084) [-541.710] * (-543.445) (-541.834) (-541.494) [-541.995] -- 0:00:30
472000 -- (-545.827) (-545.095) [-542.030] (-541.462) * (-542.754) [-541.975] (-544.824) (-544.344) -- 0:00:30
472500 -- [-543.516] (-543.975) (-540.528) (-541.014) * (-542.295) [-541.036] (-542.765) (-541.750) -- 0:00:30
473000 -- (-544.020) (-548.763) [-540.336] (-541.915) * (-541.904) (-541.182) (-547.293) [-542.559] -- 0:00:30
473500 -- (-541.953) (-542.854) (-541.677) [-544.960] * (-542.622) (-541.205) (-543.793) [-542.530] -- 0:00:30
474000 -- (-541.739) [-542.481] (-542.030) (-542.064) * [-541.816] (-540.475) (-544.551) (-545.022) -- 0:00:29
474500 -- (-542.397) (-542.221) [-543.401] (-544.866) * (-541.828) (-541.623) (-542.138) [-542.756] -- 0:00:29
475000 -- (-544.080) (-541.050) (-540.358) [-540.749] * (-540.890) (-541.944) (-544.342) [-541.074] -- 0:00:29
Average standard deviation of split frequencies: 0.009532
475500 -- (-542.871) [-542.746] (-540.410) (-542.771) * (-542.136) (-544.959) [-542.417] (-542.610) -- 0:00:29
476000 -- [-541.081] (-542.751) (-541.603) (-544.066) * (-544.916) (-543.184) [-545.076] (-543.992) -- 0:00:29
476500 -- [-543.535] (-544.484) (-541.561) (-551.961) * (-543.899) (-540.771) [-546.008] (-543.431) -- 0:00:29
477000 -- (-541.722) (-541.869) [-543.522] (-543.501) * (-542.225) (-541.780) (-543.384) [-543.620] -- 0:00:29
477500 -- [-541.813] (-543.037) (-543.816) (-546.055) * [-541.548] (-542.661) (-540.898) (-542.116) -- 0:00:29
478000 -- (-544.528) (-542.857) [-540.881] (-545.191) * [-541.358] (-543.167) (-541.420) (-543.014) -- 0:00:29
478500 -- (-540.353) (-541.802) [-543.002] (-545.445) * [-542.370] (-542.885) (-541.433) (-544.851) -- 0:00:29
479000 -- (-543.911) [-541.736] (-542.942) (-544.445) * (-540.514) (-541.451) [-543.430] (-543.907) -- 0:00:30
479500 -- (-540.564) (-545.617) (-542.618) [-541.424] * (-541.010) (-541.265) [-542.479] (-540.688) -- 0:00:30
480000 -- (-543.405) (-546.197) (-542.265) [-540.221] * (-543.273) [-540.851] (-543.415) (-541.574) -- 0:00:30
Average standard deviation of split frequencies: 0.009256
480500 -- (-544.334) (-544.735) [-542.068] (-546.501) * [-542.149] (-541.775) (-542.165) (-543.672) -- 0:00:30
481000 -- [-542.344] (-543.782) (-542.016) (-544.403) * (-544.415) [-542.130] (-542.236) (-542.914) -- 0:00:30
481500 -- (-544.880) (-542.690) (-543.639) [-542.707] * (-542.714) (-542.279) (-545.101) [-541.613] -- 0:00:30
482000 -- (-542.914) (-542.170) (-545.058) [-542.656] * (-542.656) [-541.843] (-542.536) (-545.409) -- 0:00:30
482500 -- (-542.912) [-541.276] (-543.240) (-544.558) * (-542.932) (-540.970) (-541.388) [-543.220] -- 0:00:30
483000 -- (-542.048) [-544.131] (-542.305) (-543.724) * (-543.007) (-541.103) (-543.058) [-541.626] -- 0:00:29
483500 -- (-540.911) (-543.957) [-544.343] (-543.805) * [-542.995] (-543.834) (-545.541) (-541.564) -- 0:00:29
484000 -- (-540.668) [-543.494] (-548.906) (-541.005) * [-544.253] (-543.347) (-545.206) (-541.925) -- 0:00:29
484500 -- (-543.445) (-541.762) [-542.520] (-541.415) * (-542.659) (-542.017) [-548.148] (-541.666) -- 0:00:29
485000 -- (-543.411) (-543.042) (-544.680) [-544.518] * [-542.258] (-542.039) (-541.093) (-543.455) -- 0:00:29
Average standard deviation of split frequencies: 0.009215
485500 -- (-541.827) (-541.647) (-545.750) [-547.410] * (-542.769) (-544.053) [-542.705] (-547.324) -- 0:00:29
486000 -- [-541.422] (-542.402) (-540.743) (-542.425) * (-545.039) [-545.078] (-541.546) (-540.771) -- 0:00:29
486500 -- (-544.416) (-544.043) [-542.656] (-541.318) * (-543.398) (-546.273) [-541.519] (-541.141) -- 0:00:29
487000 -- (-543.658) (-543.579) (-544.659) [-540.918] * (-543.413) (-543.945) [-543.599] (-541.659) -- 0:00:29
487500 -- (-544.470) (-540.580) [-541.539] (-541.478) * (-543.717) [-544.296] (-543.925) (-540.644) -- 0:00:29
488000 -- (-543.055) (-540.706) [-543.892] (-542.711) * (-542.452) [-544.629] (-541.684) (-543.356) -- 0:00:29
488500 -- (-541.868) (-542.684) [-544.824] (-541.446) * (-546.639) (-541.339) (-541.779) [-541.602] -- 0:00:29
489000 -- (-542.844) (-544.720) (-543.790) [-543.425] * (-544.386) (-543.751) (-542.645) [-541.100] -- 0:00:29
489500 -- [-542.151] (-541.357) (-543.280) (-546.006) * [-544.034] (-543.010) (-544.762) (-541.151) -- 0:00:29
490000 -- (-546.087) (-543.221) [-544.074] (-541.565) * (-543.428) [-543.276] (-540.650) (-542.563) -- 0:00:29
Average standard deviation of split frequencies: 0.009667
490500 -- (-541.858) (-541.926) [-544.034] (-543.821) * (-544.428) (-543.234) (-543.563) [-541.419] -- 0:00:29
491000 -- (-540.605) (-546.944) [-541.446] (-541.983) * (-544.072) [-543.498] (-542.422) (-542.578) -- 0:00:29
491500 -- [-542.595] (-543.378) (-541.494) (-545.859) * (-543.656) [-541.112] (-549.329) (-540.982) -- 0:00:28
492000 -- (-542.711) (-542.390) [-544.268] (-542.717) * [-543.019] (-542.496) (-546.377) (-542.446) -- 0:00:28
492500 -- (-541.032) (-540.954) [-541.428] (-541.605) * (-542.329) (-543.679) (-545.580) [-543.047] -- 0:00:28
493000 -- (-541.707) (-541.212) [-541.341] (-544.364) * (-540.471) (-542.683) (-542.512) [-543.238] -- 0:00:28
493500 -- (-542.612) [-542.705] (-546.070) (-545.161) * (-541.461) (-542.846) (-543.154) [-541.890] -- 0:00:28
494000 -- (-541.219) (-543.594) (-546.913) [-542.821] * (-545.356) [-540.553] (-540.998) (-544.814) -- 0:00:28
494500 -- (-541.009) (-541.579) [-541.225] (-542.692) * (-542.473) (-541.286) (-540.624) [-542.024] -- 0:00:28
495000 -- (-542.317) (-541.578) [-540.858] (-542.437) * (-541.382) (-543.750) [-541.484] (-544.568) -- 0:00:28
Average standard deviation of split frequencies: 0.010039
495500 -- (-543.120) (-542.084) (-544.756) [-541.374] * (-540.595) (-542.383) (-541.283) [-542.340] -- 0:00:28
496000 -- (-542.229) (-545.714) (-545.384) [-541.687] * (-541.085) (-542.406) [-540.681] (-543.858) -- 0:00:29
496500 -- (-542.092) [-541.718] (-543.995) (-541.481) * (-540.951) [-542.621] (-540.786) (-541.732) -- 0:00:29
497000 -- (-545.465) [-541.288] (-541.469) (-545.038) * (-542.083) [-542.527] (-541.447) (-541.393) -- 0:00:29
497500 -- (-545.349) (-542.980) (-542.485) [-541.888] * (-540.938) (-542.109) (-540.615) [-540.722] -- 0:00:29
498000 -- (-542.265) (-543.990) [-543.552] (-543.299) * (-547.810) (-543.046) (-543.850) [-541.399] -- 0:00:29
498500 -- [-543.247] (-544.539) (-540.874) (-542.751) * [-543.140] (-544.930) (-542.599) (-543.642) -- 0:00:29
499000 -- [-542.996] (-543.858) (-541.414) (-545.582) * (-544.555) (-541.935) (-542.675) [-542.336] -- 0:00:29
499500 -- (-541.636) [-541.609] (-540.503) (-543.177) * (-544.301) [-544.552] (-543.599) (-543.255) -- 0:00:29
500000 -- [-543.511] (-542.548) (-541.980) (-541.513) * [-542.008] (-542.710) (-541.920) (-544.106) -- 0:00:29
Average standard deviation of split frequencies: 0.010063
500500 -- (-542.176) [-541.746] (-542.956) (-541.001) * (-542.950) [-544.052] (-541.111) (-543.465) -- 0:00:28
501000 -- (-542.320) (-541.375) [-544.613] (-540.505) * (-541.470) (-542.140) (-544.256) [-542.119] -- 0:00:28
501500 -- [-543.930] (-540.558) (-541.546) (-543.319) * [-545.797] (-541.690) (-543.046) (-541.210) -- 0:00:28
502000 -- (-543.817) (-545.609) [-542.815] (-542.554) * (-544.934) (-541.944) [-540.866] (-540.741) -- 0:00:28
502500 -- (-542.869) (-542.133) [-543.030] (-549.315) * (-540.870) (-541.330) [-541.219] (-543.095) -- 0:00:28
503000 -- (-541.615) (-544.383) [-543.494] (-545.648) * [-542.116] (-543.050) (-542.120) (-546.720) -- 0:00:28
503500 -- [-542.291] (-543.091) (-542.048) (-544.986) * (-545.190) (-542.823) [-543.454] (-541.516) -- 0:00:28
504000 -- (-542.171) [-546.879] (-545.678) (-542.980) * (-540.532) [-542.348] (-541.803) (-542.393) -- 0:00:28
504500 -- (-541.488) [-541.806] (-541.068) (-540.953) * (-542.751) (-543.423) (-541.376) [-542.919] -- 0:00:28
505000 -- (-542.085) (-541.854) [-542.469] (-542.573) * (-545.051) (-542.727) [-541.740] (-540.485) -- 0:00:28
Average standard deviation of split frequencies: 0.010029
505500 -- [-541.368] (-544.587) (-543.428) (-542.166) * (-542.801) (-540.679) [-542.205] (-540.929) -- 0:00:28
506000 -- [-541.113] (-544.216) (-540.808) (-544.317) * (-541.023) (-541.018) (-542.985) [-543.735] -- 0:00:28
506500 -- (-545.414) (-544.651) [-542.751] (-542.826) * (-544.821) (-542.057) (-543.701) [-541.696] -- 0:00:28
507000 -- (-551.152) [-545.225] (-543.057) (-542.098) * (-541.871) (-540.916) (-546.734) [-541.060] -- 0:00:28
507500 -- (-546.382) (-544.745) (-545.883) [-543.789] * (-542.483) [-542.281] (-546.472) (-542.680) -- 0:00:28
508000 -- (-545.719) [-542.107] (-543.389) (-545.786) * (-541.394) [-541.331] (-541.187) (-542.804) -- 0:00:28
508500 -- (-550.713) (-541.622) (-545.104) [-543.800] * (-543.023) [-543.724] (-541.947) (-543.161) -- 0:00:28
509000 -- (-547.838) [-541.205] (-546.024) (-541.398) * (-542.100) (-541.768) (-542.163) [-541.901] -- 0:00:27
509500 -- (-545.575) (-543.472) [-541.237] (-544.679) * [-544.574] (-542.509) (-541.649) (-542.265) -- 0:00:27
510000 -- [-543.822] (-542.270) (-548.083) (-541.559) * (-541.401) [-545.460] (-541.711) (-543.654) -- 0:00:27
Average standard deviation of split frequencies: 0.009611
510500 -- (-545.773) [-542.563] (-540.676) (-543.121) * (-543.443) [-540.637] (-543.474) (-545.454) -- 0:00:27
511000 -- [-550.180] (-544.360) (-540.639) (-542.977) * (-547.566) (-541.313) (-544.471) [-543.274] -- 0:00:27
511500 -- (-545.139) [-542.740] (-545.978) (-547.914) * [-540.526] (-541.881) (-548.196) (-543.469) -- 0:00:27
512000 -- (-541.908) [-543.545] (-541.796) (-542.740) * [-541.469] (-545.590) (-544.105) (-542.396) -- 0:00:27
512500 -- [-543.832] (-551.056) (-541.690) (-541.425) * (-542.915) (-542.023) [-542.577] (-544.007) -- 0:00:27
513000 -- (-542.458) [-544.500] (-543.419) (-542.526) * (-542.997) (-542.201) [-541.852] (-547.715) -- 0:00:28
513500 -- (-540.775) (-542.925) (-542.880) [-542.296] * (-541.418) [-542.381] (-548.486) (-541.692) -- 0:00:28
514000 -- (-541.648) [-541.582] (-542.766) (-544.587) * (-542.540) [-542.086] (-542.422) (-541.292) -- 0:00:28
514500 -- [-541.467] (-543.555) (-544.986) (-543.418) * (-542.074) [-543.226] (-545.039) (-546.545) -- 0:00:28
515000 -- [-542.726] (-541.799) (-546.365) (-546.357) * (-543.563) [-543.106] (-541.687) (-542.655) -- 0:00:28
Average standard deviation of split frequencies: 0.009243
515500 -- (-545.455) [-543.849] (-543.022) (-543.118) * (-541.157) [-542.763] (-540.891) (-541.667) -- 0:00:28
516000 -- (-542.976) [-542.441] (-545.255) (-542.905) * (-540.682) (-543.015) (-542.910) [-541.212] -- 0:00:28
516500 -- [-540.550] (-542.636) (-543.594) (-545.620) * (-541.054) [-541.454] (-542.695) (-542.038) -- 0:00:28
517000 -- (-540.463) (-544.600) (-543.993) [-543.655] * [-544.224] (-542.786) (-546.271) (-540.860) -- 0:00:28
517500 -- (-542.146) (-545.004) (-542.602) [-541.122] * (-549.983) (-545.300) (-541.086) [-541.976] -- 0:00:27
518000 -- (-542.390) [-541.628] (-542.252) (-542.051) * [-544.882] (-543.797) (-543.364) (-545.980) -- 0:00:27
518500 -- (-543.075) [-540.428] (-542.369) (-543.191) * (-544.303) [-541.933] (-547.363) (-545.392) -- 0:00:27
519000 -- (-542.602) [-541.272] (-542.934) (-540.899) * (-542.839) [-542.602] (-541.682) (-545.763) -- 0:00:27
519500 -- (-552.003) (-544.094) [-542.464] (-541.802) * [-540.826] (-542.439) (-541.267) (-544.378) -- 0:00:27
520000 -- (-541.911) (-547.326) [-543.832] (-543.941) * (-545.335) [-542.079] (-543.012) (-546.701) -- 0:00:27
Average standard deviation of split frequencies: 0.010013
520500 -- [-542.952] (-540.344) (-543.131) (-543.266) * (-542.266) (-546.503) [-544.373] (-540.728) -- 0:00:27
521000 -- (-542.134) (-542.426) [-542.397] (-542.847) * (-545.150) (-542.287) [-545.438] (-542.419) -- 0:00:27
521500 -- (-543.227) [-542.073] (-542.895) (-543.898) * (-545.417) (-540.573) [-541.212] (-543.679) -- 0:00:27
522000 -- [-541.544] (-541.458) (-543.111) (-546.821) * (-546.687) (-541.614) (-543.011) [-542.487] -- 0:00:27
522500 -- (-542.275) (-541.828) (-542.729) [-544.345] * (-541.544) (-541.462) [-542.641] (-544.578) -- 0:00:27
523000 -- (-540.699) [-543.014] (-540.247) (-548.287) * (-541.519) (-541.191) [-542.190] (-542.015) -- 0:00:27
523500 -- (-540.557) (-541.912) (-540.988) [-543.059] * (-541.123) (-541.588) (-545.337) [-544.630] -- 0:00:27
524000 -- (-542.122) (-541.372) (-542.109) [-540.833] * (-541.083) (-541.538) [-541.186] (-541.560) -- 0:00:27
524500 -- (-542.404) (-544.961) (-541.878) [-544.120] * [-542.769] (-540.876) (-543.677) (-542.537) -- 0:00:27
525000 -- [-542.507] (-543.581) (-543.746) (-546.591) * [-541.119] (-543.214) (-543.530) (-541.500) -- 0:00:27
Average standard deviation of split frequencies: 0.009700
525500 -- [-542.409] (-540.777) (-541.987) (-542.976) * (-545.100) (-540.332) (-540.761) [-542.664] -- 0:00:27
526000 -- [-541.659] (-543.010) (-543.218) (-541.892) * (-540.755) (-540.428) [-541.260] (-545.093) -- 0:00:27
526500 -- (-543.334) [-542.597] (-545.253) (-544.717) * [-541.121] (-544.193) (-541.277) (-543.034) -- 0:00:26
527000 -- (-540.872) [-540.939] (-543.019) (-547.064) * (-542.243) (-541.344) (-543.272) [-546.312] -- 0:00:26
527500 -- (-543.100) [-541.574] (-543.237) (-541.156) * [-543.729] (-544.493) (-543.243) (-542.384) -- 0:00:26
528000 -- [-540.777] (-541.617) (-540.620) (-541.000) * (-540.761) (-541.670) (-541.297) [-542.993] -- 0:00:26
528500 -- [-541.541] (-545.069) (-544.262) (-543.467) * (-542.176) (-541.626) (-542.899) [-548.620] -- 0:00:26
529000 -- (-543.069) (-542.203) (-542.088) [-541.971] * (-543.080) [-541.990] (-544.643) (-551.444) -- 0:00:26
529500 -- (-543.534) [-541.469] (-546.707) (-540.920) * (-543.433) [-543.364] (-541.447) (-542.970) -- 0:00:26
530000 -- (-544.128) [-541.553] (-543.085) (-541.215) * (-542.513) (-541.916) [-540.703] (-543.088) -- 0:00:26
Average standard deviation of split frequencies: 0.009928
530500 -- (-543.418) (-543.581) (-546.454) [-545.359] * [-541.800] (-542.544) (-541.792) (-542.559) -- 0:00:27
531000 -- (-543.726) [-542.414] (-542.640) (-552.463) * (-541.654) (-542.685) [-542.256] (-544.341) -- 0:00:27
531500 -- [-542.798] (-544.370) (-548.853) (-543.294) * (-542.164) (-541.371) [-543.198] (-544.453) -- 0:00:27
532000 -- (-544.443) (-541.434) [-542.020] (-542.778) * (-541.863) (-543.842) (-544.135) [-541.913] -- 0:00:27
532500 -- (-545.579) [-541.011] (-547.316) (-543.252) * [-543.050] (-544.785) (-545.804) (-543.691) -- 0:00:27
533000 -- (-546.612) (-542.905) [-545.490] (-549.625) * (-542.123) (-541.557) [-540.673] (-545.652) -- 0:00:27
533500 -- (-542.759) (-540.819) [-541.206] (-547.755) * (-542.372) [-543.121] (-545.984) (-541.882) -- 0:00:27
534000 -- [-541.011] (-543.147) (-541.259) (-545.642) * (-542.564) [-543.510] (-542.107) (-541.943) -- 0:00:27
534500 -- (-543.110) (-543.039) [-544.536] (-544.495) * (-541.134) [-542.016] (-541.894) (-542.738) -- 0:00:26
535000 -- (-541.675) (-542.591) [-541.836] (-543.883) * (-542.652) (-541.734) (-544.315) [-541.784] -- 0:00:26
Average standard deviation of split frequencies: 0.009985
535500 -- [-541.065] (-545.860) (-542.813) (-541.515) * (-541.609) (-542.478) (-545.863) [-542.221] -- 0:00:26
536000 -- (-544.380) (-542.422) [-542.463] (-541.062) * [-540.796] (-541.006) (-545.531) (-545.264) -- 0:00:26
536500 -- (-543.583) (-541.835) (-542.687) [-541.337] * (-543.138) [-541.731] (-544.775) (-543.443) -- 0:00:26
537000 -- (-541.632) (-542.841) [-541.425] (-543.297) * (-540.932) (-540.744) (-543.026) [-542.392] -- 0:00:26
537500 -- (-544.238) (-542.366) [-542.329] (-544.204) * (-541.864) [-543.935] (-542.736) (-543.402) -- 0:00:26
538000 -- (-543.387) (-542.446) (-544.240) [-541.908] * (-541.636) (-542.552) (-540.329) [-541.289] -- 0:00:26
538500 -- [-542.311] (-542.610) (-542.051) (-544.329) * (-541.361) (-542.160) (-540.881) [-541.216] -- 0:00:26
539000 -- (-542.847) (-543.255) (-542.573) [-543.035] * (-545.593) [-543.846] (-544.233) (-543.676) -- 0:00:26
539500 -- (-541.942) (-541.895) [-541.407] (-544.314) * (-542.140) (-541.472) (-542.743) [-540.816] -- 0:00:26
540000 -- (-542.863) [-546.819] (-544.236) (-543.789) * (-543.123) (-542.646) [-541.672] (-541.292) -- 0:00:26
Average standard deviation of split frequencies: 0.010206
540500 -- (-542.708) (-542.322) [-541.931] (-541.624) * (-542.182) (-541.646) [-543.776] (-542.123) -- 0:00:26
541000 -- [-543.174] (-543.383) (-543.146) (-541.879) * (-544.630) (-540.707) (-542.914) [-542.785] -- 0:00:26
541500 -- (-542.577) (-542.312) (-542.002) [-541.691] * (-543.603) [-543.936] (-542.553) (-546.302) -- 0:00:26
542000 -- (-544.428) (-546.373) (-541.531) [-541.364] * (-544.125) [-542.424] (-548.313) (-546.362) -- 0:00:26
542500 -- (-541.718) (-546.986) (-540.951) [-540.779] * (-549.625) (-544.235) (-546.098) [-543.757] -- 0:00:26
543000 -- (-541.064) (-541.155) [-546.364] (-543.623) * (-544.816) (-541.717) [-542.541] (-544.436) -- 0:00:26
543500 -- (-541.751) (-542.191) [-544.466] (-542.426) * [-542.650] (-543.651) (-543.649) (-541.209) -- 0:00:26
544000 -- (-541.638) (-541.975) [-543.227] (-543.424) * [-544.166] (-545.152) (-543.592) (-540.842) -- 0:00:25
544500 -- (-544.193) (-543.320) [-543.247] (-548.538) * [-542.805] (-541.797) (-542.126) (-545.346) -- 0:00:25
545000 -- (-547.855) (-544.543) [-544.662] (-542.183) * (-542.133) (-541.973) (-544.567) [-545.166] -- 0:00:25
Average standard deviation of split frequencies: 0.009650
545500 -- [-542.585] (-540.811) (-541.486) (-541.732) * (-546.803) [-544.609] (-545.774) (-542.986) -- 0:00:25
546000 -- (-542.495) [-540.687] (-541.271) (-542.597) * (-544.075) (-542.642) (-549.674) [-546.202] -- 0:00:25
546500 -- [-541.992] (-541.601) (-541.920) (-541.250) * [-542.890] (-542.232) (-542.438) (-549.294) -- 0:00:25
547000 -- (-541.518) (-541.774) (-545.363) [-542.657] * (-546.984) (-541.819) (-545.997) [-542.704] -- 0:00:25
547500 -- (-542.424) (-541.038) [-544.173] (-546.151) * (-541.538) [-541.317] (-541.561) (-540.351) -- 0:00:26
548000 -- [-542.610] (-541.581) (-543.467) (-548.744) * (-542.600) [-541.754] (-543.345) (-545.074) -- 0:00:26
548500 -- (-548.148) (-541.869) [-544.724] (-541.658) * (-543.915) (-542.439) [-545.418] (-544.616) -- 0:00:26
549000 -- (-544.236) (-544.755) [-545.279] (-542.987) * [-544.722] (-542.922) (-542.639) (-547.569) -- 0:00:26
549500 -- (-546.752) (-540.661) (-542.843) [-541.721] * [-542.473] (-544.077) (-541.626) (-540.373) -- 0:00:26
550000 -- (-541.232) (-543.652) (-542.707) [-541.325] * (-544.316) (-544.406) [-542.364] (-542.435) -- 0:00:26
Average standard deviation of split frequencies: 0.009165
550500 -- (-544.885) (-543.729) (-541.938) [-542.014] * [-540.919] (-541.535) (-541.184) (-542.137) -- 0:00:26
551000 -- (-544.967) (-541.846) [-543.201] (-545.131) * (-544.386) (-541.868) (-542.087) [-541.698] -- 0:00:26
551500 -- [-542.515] (-541.816) (-541.179) (-542.240) * (-542.526) (-541.918) [-542.202] (-542.086) -- 0:00:26
552000 -- (-540.630) [-541.211] (-543.800) (-541.517) * (-540.477) (-547.461) (-541.913) [-541.098] -- 0:00:25
552500 -- (-540.431) [-541.167] (-545.612) (-546.755) * (-544.571) (-544.028) (-544.409) [-542.085] -- 0:00:25
553000 -- (-541.356) [-540.846] (-543.000) (-543.258) * [-546.184] (-547.357) (-542.024) (-542.678) -- 0:00:25
553500 -- (-542.196) (-544.896) [-543.551] (-541.417) * (-542.488) (-541.937) (-541.902) [-541.118] -- 0:00:25
554000 -- (-543.065) (-545.857) (-541.845) [-542.397] * (-541.377) (-541.913) [-541.498] (-542.021) -- 0:00:25
554500 -- (-541.572) (-546.011) [-543.818] (-542.561) * (-542.768) (-543.307) [-543.173] (-547.131) -- 0:00:25
555000 -- (-542.864) (-543.564) (-541.216) [-541.968] * (-542.211) (-541.498) (-544.876) [-548.854] -- 0:00:25
Average standard deviation of split frequencies: 0.008728
555500 -- [-541.345] (-542.897) (-541.249) (-541.448) * (-541.315) (-542.872) [-543.215] (-541.386) -- 0:00:25
556000 -- (-542.092) (-543.854) [-540.848] (-544.499) * (-541.169) (-543.971) [-548.609] (-542.996) -- 0:00:25
556500 -- (-540.750) (-541.957) [-544.381] (-542.060) * [-541.137] (-542.454) (-543.931) (-543.574) -- 0:00:25
557000 -- (-541.315) (-543.230) [-544.194] (-541.660) * [-543.435] (-542.654) (-541.578) (-544.037) -- 0:00:25
557500 -- [-543.690] (-544.201) (-540.973) (-542.241) * (-541.500) (-541.124) [-541.747] (-541.868) -- 0:00:25
558000 -- (-541.165) [-544.978] (-542.155) (-540.442) * (-544.250) (-541.119) (-546.265) [-542.606] -- 0:00:25
558500 -- [-541.799] (-546.709) (-541.413) (-543.267) * (-541.960) (-543.243) [-541.436] (-542.539) -- 0:00:25
559000 -- (-541.585) (-543.253) (-541.712) [-540.379] * [-542.873] (-541.726) (-543.655) (-541.726) -- 0:00:25
559500 -- (-543.797) (-544.531) [-540.316] (-540.570) * [-540.891] (-540.237) (-544.350) (-551.631) -- 0:00:25
560000 -- (-543.817) (-542.625) [-541.418] (-541.535) * (-540.872) (-541.365) [-543.746] (-546.742) -- 0:00:25
Average standard deviation of split frequencies: 0.008705
560500 -- (-541.730) (-541.731) (-544.473) [-543.041] * (-541.860) [-540.515] (-543.890) (-541.747) -- 0:00:25
561000 -- [-541.431] (-542.147) (-543.998) (-544.412) * (-543.640) (-540.287) (-542.888) [-541.908] -- 0:00:25
561500 -- [-542.490] (-548.607) (-544.022) (-542.704) * (-546.163) (-544.213) (-543.166) [-544.417] -- 0:00:24
562000 -- [-540.874] (-547.226) (-542.355) (-540.261) * (-543.787) (-543.148) [-541.373] (-547.710) -- 0:00:24
562500 -- (-541.847) (-545.351) [-545.876] (-541.483) * (-541.306) [-542.436] (-542.261) (-546.969) -- 0:00:24
563000 -- [-548.650] (-544.312) (-542.240) (-543.171) * (-544.226) (-542.256) (-541.516) [-544.186] -- 0:00:24
563500 -- (-543.723) (-542.411) [-540.524] (-541.003) * (-546.357) (-540.833) (-541.958) [-544.901] -- 0:00:24
564000 -- (-543.998) [-542.644] (-540.522) (-542.197) * (-541.705) (-543.457) [-542.549] (-541.106) -- 0:00:24
564500 -- (-545.837) (-542.887) (-541.265) [-541.990] * (-541.225) (-542.051) [-540.655] (-547.958) -- 0:00:24
565000 -- (-543.336) [-541.967] (-542.413) (-541.486) * (-541.878) (-543.279) (-540.707) [-540.461] -- 0:00:25
Average standard deviation of split frequencies: 0.008917
565500 -- (-541.815) [-543.078] (-541.063) (-546.826) * (-542.184) [-542.214] (-540.389) (-541.173) -- 0:00:25
566000 -- (-542.508) (-542.518) [-540.510] (-548.351) * (-540.868) (-543.725) (-542.129) [-540.429] -- 0:00:25
566500 -- [-540.958] (-541.517) (-540.381) (-546.792) * (-542.970) (-542.762) [-545.385] (-540.746) -- 0:00:25
567000 -- [-541.719] (-542.006) (-544.074) (-541.258) * [-542.268] (-541.402) (-541.106) (-544.873) -- 0:00:25
567500 -- (-541.906) [-541.076] (-541.323) (-541.296) * (-542.037) [-542.567] (-544.337) (-542.447) -- 0:00:25
568000 -- [-542.796] (-541.395) (-548.728) (-544.633) * (-541.574) (-545.717) [-543.670] (-541.275) -- 0:00:25
568500 -- (-541.530) (-541.336) (-547.631) [-541.544] * (-541.942) [-544.555] (-546.922) (-545.206) -- 0:00:25
569000 -- (-541.799) (-543.327) (-545.251) [-543.070] * (-543.391) [-542.886] (-548.029) (-545.355) -- 0:00:24
569500 -- (-541.788) [-542.305] (-544.926) (-542.255) * [-541.112] (-542.012) (-545.230) (-543.739) -- 0:00:24
570000 -- (-543.853) (-544.444) (-543.258) [-542.380] * [-540.910] (-541.297) (-542.645) (-543.283) -- 0:00:24
Average standard deviation of split frequencies: 0.009184
570500 -- (-545.307) (-544.054) [-542.066] (-540.873) * [-541.633] (-542.667) (-541.670) (-541.023) -- 0:00:24
571000 -- (-541.055) [-542.328] (-541.291) (-544.312) * (-541.305) (-541.108) (-540.826) [-541.846] -- 0:00:24
571500 -- [-540.932] (-543.888) (-542.687) (-555.075) * [-545.080] (-550.935) (-541.865) (-540.971) -- 0:00:24
572000 -- [-541.278] (-543.474) (-544.190) (-542.370) * (-543.480) [-547.335] (-542.771) (-545.696) -- 0:00:24
572500 -- (-541.786) (-542.806) (-543.073) [-542.915] * [-543.216] (-543.836) (-544.084) (-541.637) -- 0:00:24
573000 -- [-541.521] (-541.667) (-542.502) (-543.169) * (-544.854) [-543.063] (-543.814) (-541.788) -- 0:00:24
573500 -- (-541.745) (-540.793) (-544.773) [-547.553] * (-545.994) [-542.376] (-542.302) (-544.580) -- 0:00:24
574000 -- (-541.321) (-544.244) [-541.176] (-541.967) * [-542.836] (-550.091) (-542.836) (-541.052) -- 0:00:24
574500 -- (-542.189) (-543.606) (-541.288) [-541.460] * (-541.955) [-542.876] (-545.406) (-541.184) -- 0:00:24
575000 -- (-542.166) [-545.071] (-541.145) (-549.608) * (-544.775) [-542.142] (-544.431) (-543.509) -- 0:00:24
Average standard deviation of split frequencies: 0.009003
575500 -- (-542.990) (-543.986) [-542.202] (-543.542) * (-542.126) [-540.836] (-541.715) (-542.150) -- 0:00:24
576000 -- (-541.537) [-544.747] (-542.599) (-543.341) * (-543.552) [-541.023] (-541.577) (-540.875) -- 0:00:24
576500 -- (-540.599) [-545.969] (-548.133) (-550.098) * (-542.026) [-540.901] (-543.551) (-548.626) -- 0:00:24
577000 -- (-542.309) [-543.971] (-541.950) (-546.543) * (-547.631) [-541.182] (-540.906) (-546.765) -- 0:00:24
577500 -- (-542.942) (-542.877) [-543.809] (-545.501) * [-543.883] (-544.173) (-546.081) (-542.780) -- 0:00:24
578000 -- [-542.449] (-544.122) (-540.793) (-542.153) * (-540.843) [-544.235] (-547.062) (-543.340) -- 0:00:24
578500 -- [-540.856] (-541.638) (-542.135) (-541.389) * (-542.916) (-544.767) [-541.306] (-543.853) -- 0:00:24
579000 -- (-542.787) (-545.529) [-542.331] (-546.211) * (-543.501) (-542.721) (-543.228) [-540.711] -- 0:00:23
579500 -- (-543.408) (-543.845) [-541.370] (-541.249) * (-544.910) (-545.706) (-545.326) [-543.754] -- 0:00:23
580000 -- [-541.495] (-543.757) (-540.867) (-542.433) * (-545.366) (-543.088) (-542.148) [-544.957] -- 0:00:23
Average standard deviation of split frequencies: 0.009121
580500 -- (-543.299) (-541.430) [-540.877] (-541.852) * [-545.079] (-549.565) (-541.007) (-543.885) -- 0:00:23
581000 -- (-542.587) (-542.807) [-540.515] (-542.516) * (-547.707) (-543.190) [-540.563] (-542.181) -- 0:00:23
581500 -- (-541.400) [-542.346] (-549.810) (-543.799) * [-542.158] (-548.194) (-541.412) (-544.494) -- 0:00:23
582000 -- [-541.502] (-541.395) (-545.121) (-544.442) * [-542.628] (-542.182) (-542.928) (-543.983) -- 0:00:24
582500 -- (-540.885) (-542.561) [-543.658] (-542.286) * (-541.865) [-545.943] (-541.759) (-544.874) -- 0:00:24
583000 -- (-542.196) [-541.439] (-542.340) (-541.919) * [-542.141] (-543.245) (-542.039) (-542.852) -- 0:00:24
583500 -- (-545.101) (-542.957) [-543.087] (-543.151) * [-541.800] (-542.433) (-545.379) (-540.853) -- 0:00:24
584000 -- (-542.619) (-546.284) (-544.138) [-542.361] * (-542.137) (-542.608) [-543.196] (-542.470) -- 0:00:24
584500 -- (-540.437) (-542.234) [-543.829] (-544.481) * [-542.085] (-541.343) (-542.954) (-540.852) -- 0:00:24
585000 -- (-543.194) (-541.796) [-541.387] (-544.171) * (-540.950) (-542.970) (-541.672) [-540.878] -- 0:00:24
Average standard deviation of split frequencies: 0.008849
585500 -- [-542.399] (-542.459) (-544.253) (-546.869) * [-544.157] (-542.981) (-542.158) (-541.338) -- 0:00:24
586000 -- [-541.126] (-546.810) (-544.857) (-544.155) * (-543.126) (-544.762) (-541.530) [-541.520] -- 0:00:24
586500 -- (-542.020) [-541.096] (-543.267) (-541.878) * [-542.340] (-543.797) (-541.592) (-542.234) -- 0:00:23
587000 -- [-541.024] (-542.151) (-541.459) (-542.114) * [-541.411] (-540.869) (-544.280) (-542.096) -- 0:00:23
587500 -- (-541.069) (-542.831) [-540.658] (-545.273) * (-544.375) (-542.138) [-541.372] (-542.861) -- 0:00:23
588000 -- (-543.783) (-543.930) [-541.534] (-540.366) * [-542.844] (-542.103) (-543.905) (-540.521) -- 0:00:23
588500 -- [-544.621] (-541.394) (-542.105) (-542.202) * (-542.263) (-542.179) [-541.963] (-540.834) -- 0:00:23
589000 -- (-542.926) (-542.370) [-542.408] (-541.658) * [-542.363] (-543.397) (-543.246) (-540.745) -- 0:00:23
589500 -- (-544.344) (-541.414) (-542.077) [-541.564] * (-543.427) [-543.099] (-543.213) (-541.792) -- 0:00:23
590000 -- (-544.835) (-544.349) [-542.715] (-542.239) * (-543.822) [-542.472] (-543.228) (-543.049) -- 0:00:23
Average standard deviation of split frequencies: 0.008823
590500 -- (-541.058) [-542.641] (-542.807) (-542.204) * [-543.142] (-542.159) (-543.373) (-542.815) -- 0:00:23
591000 -- (-542.910) [-543.253] (-546.255) (-545.361) * [-541.182] (-543.422) (-542.914) (-542.148) -- 0:00:23
591500 -- (-543.397) (-543.228) [-541.206] (-540.775) * (-543.096) (-544.938) (-542.569) [-541.775] -- 0:00:23
592000 -- (-542.295) [-541.474] (-545.024) (-543.246) * (-542.346) (-545.402) (-542.080) [-543.894] -- 0:00:23
592500 -- [-542.696] (-541.174) (-540.680) (-545.072) * (-541.654) (-543.636) [-541.565] (-541.497) -- 0:00:23
593000 -- (-541.246) (-541.597) [-542.890] (-543.677) * (-541.890) [-542.917] (-543.466) (-543.124) -- 0:00:23
593500 -- (-544.951) (-542.607) (-546.527) [-544.133] * [-541.457] (-542.878) (-541.883) (-547.496) -- 0:00:23
594000 -- (-541.327) (-543.675) [-541.209] (-543.430) * (-541.053) [-540.775] (-542.770) (-542.441) -- 0:00:23
594500 -- (-544.095) (-545.441) (-542.162) [-543.581] * [-542.490] (-545.555) (-541.380) (-542.210) -- 0:00:23
595000 -- (-541.900) (-544.585) [-544.609] (-544.381) * (-542.167) (-542.363) (-542.687) [-544.238] -- 0:00:23
Average standard deviation of split frequencies: 0.008561
595500 -- (-542.177) (-543.601) [-542.107] (-543.171) * (-542.114) (-547.187) [-540.710] (-540.326) -- 0:00:23
596000 -- [-542.315] (-542.752) (-541.696) (-542.830) * (-545.344) (-544.425) (-541.909) [-543.650] -- 0:00:23
596500 -- (-542.803) (-541.111) [-540.846] (-541.599) * (-543.251) [-541.277] (-541.931) (-543.053) -- 0:00:22
597000 -- (-543.512) (-540.280) [-542.232] (-541.230) * (-545.453) (-542.694) [-543.538] (-542.244) -- 0:00:22
597500 -- [-541.617] (-542.075) (-540.211) (-540.779) * (-544.017) [-544.820] (-544.427) (-546.896) -- 0:00:22
598000 -- (-546.217) (-544.737) [-540.730] (-543.748) * [-543.058] (-543.332) (-543.517) (-543.783) -- 0:00:22
598500 -- [-542.206] (-545.357) (-540.562) (-544.089) * (-543.757) (-543.802) [-541.435] (-542.585) -- 0:00:22
599000 -- (-542.897) (-543.242) [-543.830] (-541.729) * (-541.178) (-542.763) (-540.985) [-542.052] -- 0:00:22
599500 -- (-543.258) (-542.042) [-545.440] (-541.792) * [-541.749] (-543.292) (-542.945) (-543.384) -- 0:00:23
600000 -- [-543.765] (-544.603) (-542.273) (-542.568) * (-540.931) (-541.010) (-544.724) [-543.984] -- 0:00:23
Average standard deviation of split frequencies: 0.008910
600500 -- (-547.144) [-543.462] (-540.928) (-540.688) * (-547.477) (-545.239) [-544.429] (-542.899) -- 0:00:23
601000 -- (-544.189) (-542.092) [-540.744] (-540.504) * (-542.900) [-542.672] (-545.461) (-541.159) -- 0:00:23
601500 -- [-543.492] (-540.949) (-541.089) (-540.726) * (-540.680) (-545.624) [-544.221] (-542.160) -- 0:00:23
602000 -- (-545.617) (-544.348) [-541.240] (-541.236) * [-540.588] (-542.739) (-545.166) (-543.142) -- 0:00:23
602500 -- (-544.450) [-543.964] (-540.906) (-540.992) * (-543.809) [-543.050] (-540.625) (-542.361) -- 0:00:23
603000 -- (-543.436) (-541.518) [-541.168] (-547.980) * (-543.452) [-540.223] (-541.336) (-541.446) -- 0:00:23
603500 -- [-544.236] (-545.065) (-544.075) (-546.375) * (-541.937) (-541.753) [-544.792] (-545.358) -- 0:00:22
604000 -- (-543.070) (-541.297) [-540.907] (-542.450) * (-544.743) (-541.960) [-543.050] (-546.304) -- 0:00:22
604500 -- (-542.477) [-542.135] (-542.138) (-541.164) * (-543.497) [-544.775] (-544.711) (-544.562) -- 0:00:22
605000 -- (-542.190) [-544.062] (-543.647) (-540.579) * (-541.979) (-541.960) (-541.723) [-542.923] -- 0:00:22
Average standard deviation of split frequencies: 0.008923
605500 -- (-546.164) [-543.244] (-545.465) (-540.792) * [-542.722] (-540.901) (-542.185) (-546.281) -- 0:00:22
606000 -- (-545.108) (-542.404) (-545.618) [-541.693] * (-545.909) [-540.759] (-542.720) (-542.830) -- 0:00:22
606500 -- (-542.789) (-544.745) [-540.467] (-543.371) * (-542.509) (-542.625) [-540.814] (-546.745) -- 0:00:22
607000 -- (-542.716) (-541.766) [-541.934] (-541.275) * (-544.203) (-541.474) [-540.486] (-544.759) -- 0:00:22
607500 -- (-541.632) [-545.236] (-542.062) (-542.215) * (-545.021) [-541.150] (-541.957) (-544.385) -- 0:00:22
608000 -- (-541.081) (-541.622) (-542.314) [-542.758] * [-543.243] (-544.352) (-540.933) (-542.347) -- 0:00:22
608500 -- (-542.408) [-540.467] (-540.679) (-544.024) * (-542.212) (-541.758) [-541.977] (-540.982) -- 0:00:22
609000 -- (-543.360) (-542.178) (-540.666) [-541.474] * (-543.754) (-542.066) (-541.063) [-543.652] -- 0:00:22
609500 -- (-542.800) [-545.136] (-546.191) (-542.147) * (-542.621) (-541.159) (-541.840) [-543.893] -- 0:00:22
610000 -- (-542.062) (-540.438) (-543.591) [-542.317] * (-540.927) (-547.042) [-542.233] (-541.113) -- 0:00:22
Average standard deviation of split frequencies: 0.008900
610500 -- (-540.272) [-540.924] (-546.148) (-540.480) * (-542.889) [-547.929] (-545.672) (-541.174) -- 0:00:22
611000 -- [-540.428] (-542.967) (-545.515) (-540.718) * (-544.826) (-542.159) (-542.394) [-542.662] -- 0:00:22
611500 -- (-548.469) (-540.868) [-543.373] (-544.156) * [-542.314] (-541.842) (-543.879) (-540.694) -- 0:00:22
612000 -- (-541.225) [-543.433] (-542.399) (-542.514) * (-542.906) (-545.226) [-542.819] (-542.445) -- 0:00:22
612500 -- (-543.075) (-541.460) [-541.069] (-542.388) * (-545.591) (-541.268) (-541.502) [-541.898] -- 0:00:22
613000 -- (-544.962) (-542.957) (-541.872) [-541.306] * (-542.819) (-540.889) (-543.943) [-541.346] -- 0:00:22
613500 -- (-544.129) (-541.812) (-542.777) [-541.836] * [-542.614] (-542.715) (-541.607) (-543.966) -- 0:00:22
614000 -- [-541.291] (-543.694) (-542.944) (-540.981) * (-543.350) [-540.556] (-542.641) (-543.447) -- 0:00:22
614500 -- (-541.078) (-543.625) [-541.709] (-543.368) * [-540.929] (-543.054) (-542.907) (-542.293) -- 0:00:21
615000 -- (-548.729) (-540.724) (-541.887) [-541.974] * (-541.348) (-544.555) (-540.775) [-544.368] -- 0:00:21
Average standard deviation of split frequencies: 0.008322
615500 -- [-542.198] (-541.221) (-541.609) (-541.448) * (-543.305) (-544.313) (-541.487) [-541.799] -- 0:00:21
616000 -- (-542.046) (-545.676) [-541.155] (-543.711) * (-543.167) [-542.600] (-543.461) (-544.683) -- 0:00:21
616500 -- [-542.060] (-542.134) (-543.257) (-541.271) * (-544.063) [-541.324] (-543.565) (-540.779) -- 0:00:21
617000 -- [-540.843] (-541.879) (-541.483) (-540.278) * (-544.049) (-541.804) (-545.855) [-545.321] -- 0:00:22
617500 -- (-540.791) (-547.288) (-544.023) [-542.374] * (-540.852) [-543.749] (-540.957) (-545.717) -- 0:00:22
618000 -- (-541.551) [-540.697] (-542.407) (-541.004) * (-541.524) [-542.402] (-542.474) (-544.907) -- 0:00:22
618500 -- (-542.859) (-541.059) (-542.267) [-542.185] * [-541.786] (-543.142) (-541.552) (-540.927) -- 0:00:22
619000 -- (-543.295) (-542.491) [-544.223] (-542.561) * (-542.790) [-541.268] (-541.257) (-542.335) -- 0:00:22
619500 -- [-543.305] (-543.837) (-541.964) (-541.442) * (-541.408) (-541.323) [-541.161] (-545.534) -- 0:00:22
620000 -- (-545.700) [-544.453] (-541.589) (-541.243) * (-543.408) (-542.730) [-541.807] (-543.138) -- 0:00:22
Average standard deviation of split frequencies: 0.008924
620500 -- [-542.332] (-541.048) (-542.047) (-543.986) * [-540.698] (-541.698) (-544.106) (-546.563) -- 0:00:22
621000 -- (-541.899) [-541.850] (-541.017) (-544.570) * [-540.424] (-544.771) (-541.592) (-544.535) -- 0:00:21
621500 -- (-541.926) (-547.788) [-541.685] (-540.774) * (-543.795) (-541.203) [-544.887] (-543.784) -- 0:00:21
622000 -- (-542.015) [-544.019] (-542.453) (-541.747) * [-542.962] (-543.057) (-543.604) (-541.766) -- 0:00:21
622500 -- (-541.767) [-542.520] (-542.440) (-542.443) * (-546.843) (-545.162) (-541.523) [-541.929] -- 0:00:21
623000 -- (-545.254) [-542.052] (-546.295) (-540.455) * (-542.953) [-540.593] (-542.581) (-544.966) -- 0:00:21
623500 -- [-542.372] (-541.391) (-543.147) (-540.455) * (-542.987) [-541.134] (-541.206) (-541.730) -- 0:00:21
624000 -- (-542.656) [-545.886] (-541.415) (-543.986) * [-542.778] (-544.172) (-542.140) (-542.664) -- 0:00:21
624500 -- (-542.305) (-542.371) (-542.814) [-543.571] * [-543.018] (-546.086) (-542.973) (-542.535) -- 0:00:21
625000 -- (-550.697) (-541.009) [-540.856] (-542.189) * (-541.726) (-541.335) (-544.130) [-540.945] -- 0:00:21
Average standard deviation of split frequencies: 0.008754
625500 -- [-542.922] (-540.618) (-544.987) (-540.856) * (-541.684) (-541.856) (-541.653) [-543.967] -- 0:00:21
626000 -- (-543.349) (-545.985) [-540.944] (-541.229) * (-544.172) (-546.380) [-540.769] (-544.237) -- 0:00:21
626500 -- (-540.496) [-541.069] (-542.820) (-545.113) * [-541.427] (-544.395) (-542.718) (-542.000) -- 0:00:21
627000 -- [-541.931] (-541.413) (-541.856) (-543.276) * (-542.351) (-541.039) [-541.852] (-542.211) -- 0:00:21
627500 -- (-546.230) [-541.348] (-542.870) (-542.592) * (-545.742) (-543.579) [-541.830] (-543.389) -- 0:00:21
628000 -- [-544.313] (-542.482) (-544.235) (-541.607) * [-543.035] (-541.909) (-541.510) (-540.997) -- 0:00:21
628500 -- (-544.653) (-542.227) [-541.887] (-543.863) * (-542.678) [-542.707] (-541.924) (-543.732) -- 0:00:21
629000 -- (-543.560) (-543.521) [-540.591] (-540.910) * (-542.185) [-542.504] (-542.355) (-543.216) -- 0:00:21
629500 -- (-542.499) [-542.233] (-545.160) (-546.348) * (-542.235) (-543.218) (-541.150) [-542.290] -- 0:00:21
630000 -- (-542.960) (-541.280) (-544.324) [-541.282] * (-541.860) (-548.657) (-542.302) [-546.071] -- 0:00:21
Average standard deviation of split frequencies: 0.008970
630500 -- (-545.310) (-541.318) [-541.494] (-542.488) * (-543.396) (-543.083) [-541.280] (-542.406) -- 0:00:21
631000 -- (-545.424) (-542.176) (-543.052) [-543.848] * (-541.829) [-541.194] (-540.581) (-541.221) -- 0:00:21
631500 -- (-548.682) [-544.577] (-541.083) (-541.275) * [-540.425] (-547.704) (-543.129) (-541.935) -- 0:00:21
632000 -- (-546.047) (-543.364) (-542.425) [-540.929] * (-540.344) (-541.688) [-541.929] (-542.618) -- 0:00:20
632500 -- (-542.154) (-543.033) (-544.502) [-544.605] * [-540.923] (-541.907) (-542.162) (-541.530) -- 0:00:20
633000 -- (-542.928) (-543.424) (-543.393) [-541.914] * (-541.943) (-541.879) (-540.997) [-545.581] -- 0:00:20
633500 -- (-542.830) (-542.837) [-541.628] (-541.569) * (-542.437) (-543.182) [-541.745] (-542.354) -- 0:00:20
634000 -- [-543.560] (-542.608) (-541.539) (-540.229) * (-543.591) (-543.028) (-543.402) [-541.468] -- 0:00:21
634500 -- [-544.171] (-542.325) (-540.938) (-540.359) * (-544.261) (-542.671) [-540.815] (-543.944) -- 0:00:21
635000 -- (-548.601) (-543.337) [-540.511] (-541.725) * (-542.830) [-541.116] (-541.414) (-547.032) -- 0:00:21
Average standard deviation of split frequencies: 0.009682
635500 -- (-547.639) [-540.937] (-544.493) (-541.273) * (-541.374) (-541.378) [-541.689] (-542.395) -- 0:00:21
636000 -- [-542.700] (-541.765) (-540.785) (-541.299) * (-542.400) (-543.308) (-544.302) [-541.764] -- 0:00:21
636500 -- (-544.355) (-541.168) (-543.476) [-541.584] * (-541.152) (-542.203) [-541.908] (-544.873) -- 0:00:21
637000 -- (-544.051) [-542.875] (-542.389) (-540.945) * (-542.110) (-546.061) (-543.633) [-545.392] -- 0:00:21
637500 -- (-543.288) (-541.930) [-541.342] (-540.712) * (-542.838) (-542.026) [-545.069] (-545.090) -- 0:00:21
638000 -- (-540.754) (-545.060) [-541.579] (-543.432) * [-542.812] (-544.669) (-544.536) (-541.229) -- 0:00:20
638500 -- (-543.921) (-542.331) (-541.894) [-542.727] * (-542.292) [-544.323] (-541.428) (-544.302) -- 0:00:20
639000 -- (-542.464) (-541.838) [-543.802] (-543.178) * [-541.677] (-543.150) (-542.549) (-546.428) -- 0:00:20
639500 -- (-541.527) (-542.472) [-541.356] (-543.778) * (-541.402) (-542.483) [-541.494] (-541.414) -- 0:00:20
640000 -- (-543.954) (-547.375) [-540.997] (-543.371) * (-541.924) (-546.521) (-542.088) [-541.044] -- 0:00:20
Average standard deviation of split frequencies: 0.009244
640500 -- (-545.929) [-544.903] (-542.689) (-544.187) * (-542.813) (-542.201) (-542.191) [-544.703] -- 0:00:20
641000 -- [-545.565] (-543.479) (-542.296) (-542.262) * (-540.847) [-550.108] (-544.370) (-541.662) -- 0:00:20
641500 -- (-546.675) (-542.986) [-541.393] (-542.613) * (-545.387) (-542.813) [-546.493] (-541.100) -- 0:00:20
642000 -- (-544.166) (-545.666) [-540.521] (-540.964) * [-545.541] (-540.886) (-541.424) (-542.503) -- 0:00:20
642500 -- (-542.747) (-545.925) (-544.201) [-542.256] * (-542.613) (-541.287) [-543.084] (-542.952) -- 0:00:20
643000 -- (-543.554) (-541.558) (-545.579) [-543.145] * [-542.671] (-543.308) (-543.291) (-542.093) -- 0:00:20
643500 -- (-542.742) (-544.197) [-542.528] (-541.406) * (-545.085) [-541.821] (-540.753) (-543.549) -- 0:00:20
644000 -- [-544.788] (-540.706) (-544.483) (-541.193) * (-541.674) [-541.122] (-540.369) (-544.291) -- 0:00:20
644500 -- (-543.862) (-543.210) (-544.412) [-547.176] * (-542.449) [-545.056] (-542.580) (-541.423) -- 0:00:20
645000 -- [-541.152] (-542.519) (-543.897) (-545.108) * (-546.861) (-541.762) (-543.597) [-542.643] -- 0:00:20
Average standard deviation of split frequencies: 0.009532
645500 -- [-543.336] (-541.261) (-545.833) (-543.435) * (-543.517) [-541.658] (-540.377) (-541.093) -- 0:00:20
646000 -- (-543.429) [-543.319] (-542.715) (-542.791) * [-541.193] (-541.190) (-542.768) (-543.811) -- 0:00:20
646500 -- (-546.114) (-542.448) [-540.776] (-542.309) * (-540.450) (-544.651) (-541.998) [-547.373] -- 0:00:20
647000 -- (-541.937) (-542.330) (-544.697) [-542.335] * [-540.910] (-547.286) (-546.280) (-544.578) -- 0:00:20
647500 -- [-541.978] (-546.378) (-542.848) (-543.094) * [-544.792] (-545.988) (-541.561) (-542.059) -- 0:00:20
648000 -- (-545.975) (-545.641) (-545.292) [-540.729] * (-542.874) (-544.438) [-542.700] (-542.858) -- 0:00:20
648500 -- (-541.225) (-548.732) (-542.135) [-542.047] * (-541.237) [-542.674] (-548.063) (-544.459) -- 0:00:20
649000 -- [-544.975] (-544.000) (-543.517) (-541.092) * (-542.565) [-545.918] (-543.664) (-541.742) -- 0:00:20
649500 -- (-541.499) [-541.284] (-550.725) (-541.659) * [-543.478] (-543.752) (-542.331) (-546.644) -- 0:00:19
650000 -- (-543.255) [-544.712] (-548.596) (-541.320) * (-544.401) (-542.022) (-543.086) [-540.597] -- 0:00:19
Average standard deviation of split frequencies: 0.009917
650500 -- (-540.836) (-543.452) [-544.955] (-541.870) * (-543.858) [-541.260] (-541.565) (-541.934) -- 0:00:19
651000 -- (-540.459) [-541.212] (-542.815) (-541.998) * [-544.180] (-543.545) (-545.001) (-544.795) -- 0:00:19
651500 -- (-541.682) [-544.925] (-543.808) (-541.771) * (-542.975) (-548.246) (-543.504) [-541.514] -- 0:00:20
652000 -- (-540.942) (-544.683) [-541.387] (-544.211) * [-548.082] (-542.834) (-547.386) (-541.580) -- 0:00:20
652500 -- (-544.971) [-541.591] (-546.460) (-542.605) * (-543.268) [-542.783] (-540.599) (-541.935) -- 0:00:20
653000 -- (-542.394) (-540.916) (-543.024) [-540.985] * (-543.450) [-543.070] (-540.717) (-541.589) -- 0:00:20
653500 -- [-542.278] (-540.647) (-542.658) (-542.838) * [-546.250] (-543.203) (-541.368) (-540.552) -- 0:00:20
654000 -- (-541.060) (-540.377) [-543.314] (-541.124) * (-545.256) (-543.768) (-541.385) [-543.296] -- 0:00:20
654500 -- (-547.260) (-541.190) [-541.622] (-543.774) * [-544.517] (-541.309) (-541.992) (-541.817) -- 0:00:20
655000 -- (-543.159) [-542.577] (-541.638) (-542.597) * (-541.033) (-540.388) (-542.997) [-541.567] -- 0:00:20
Average standard deviation of split frequencies: 0.009656
655500 -- (-544.157) [-541.648] (-542.795) (-542.481) * (-541.219) (-542.815) [-543.201] (-542.557) -- 0:00:19
656000 -- (-543.813) (-542.751) (-542.198) [-543.325] * [-543.307] (-542.236) (-543.386) (-544.004) -- 0:00:19
656500 -- (-541.963) [-542.694] (-541.631) (-544.406) * (-541.614) [-540.628] (-544.622) (-541.781) -- 0:00:19
657000 -- [-542.779] (-541.530) (-541.600) (-541.396) * (-542.467) [-540.906] (-543.666) (-542.546) -- 0:00:19
657500 -- [-542.330] (-541.370) (-549.836) (-546.963) * (-545.270) [-542.886] (-545.533) (-542.547) -- 0:00:19
658000 -- (-542.858) (-541.476) (-543.041) [-547.606] * (-548.707) (-540.833) [-543.933] (-542.263) -- 0:00:19
658500 -- (-542.070) (-542.391) (-541.902) [-542.901] * (-542.972) [-541.138] (-544.967) (-542.289) -- 0:00:19
659000 -- (-542.623) (-544.741) [-544.208] (-543.068) * (-542.724) [-540.996] (-543.014) (-541.592) -- 0:00:19
659500 -- [-541.798] (-543.672) (-543.255) (-541.442) * (-542.757) (-541.309) [-543.828] (-540.633) -- 0:00:19
660000 -- [-543.621] (-544.835) (-541.647) (-542.932) * (-541.368) (-545.049) (-545.686) [-542.547] -- 0:00:19
Average standard deviation of split frequencies: 0.009677
660500 -- (-542.263) (-541.640) [-542.201] (-545.434) * (-545.815) (-547.867) (-542.429) [-541.752] -- 0:00:19
661000 -- (-541.644) (-543.053) (-543.571) [-542.907] * (-545.156) [-543.990] (-542.862) (-544.812) -- 0:00:19
661500 -- (-546.580) [-541.457] (-542.318) (-546.254) * [-541.788] (-543.204) (-542.731) (-548.647) -- 0:00:19
662000 -- (-545.039) (-544.229) (-542.084) [-541.412] * (-544.414) [-540.587] (-541.940) (-546.574) -- 0:00:19
662500 -- (-543.896) [-543.391] (-541.211) (-541.488) * (-540.831) [-542.369] (-541.650) (-548.227) -- 0:00:19
663000 -- [-542.008] (-543.154) (-548.393) (-542.147) * (-542.678) [-540.677] (-541.106) (-543.278) -- 0:00:19
663500 -- [-541.801] (-544.774) (-544.046) (-545.937) * (-547.870) (-541.646) [-541.665] (-544.588) -- 0:00:19
664000 -- (-544.499) [-541.280] (-544.528) (-544.701) * (-543.312) (-541.115) [-543.223] (-543.195) -- 0:00:19
664500 -- [-543.734] (-546.053) (-543.336) (-543.735) * [-541.906] (-544.369) (-546.665) (-541.575) -- 0:00:19
665000 -- (-540.679) [-544.998] (-543.245) (-545.886) * (-541.087) (-544.409) (-544.131) [-542.097] -- 0:00:19
Average standard deviation of split frequencies: 0.010308
665500 -- [-542.605] (-542.049) (-543.136) (-545.177) * (-542.386) (-540.898) [-545.276] (-543.682) -- 0:00:19
666000 -- (-545.394) (-541.259) (-542.387) [-541.527] * [-543.929] (-541.856) (-546.021) (-542.621) -- 0:00:19
666500 -- (-541.448) (-541.805) [-542.223] (-545.074) * (-541.686) (-543.049) (-543.853) [-542.802] -- 0:00:19
667000 -- [-542.290] (-543.123) (-542.426) (-541.055) * [-541.152] (-542.454) (-540.927) (-544.445) -- 0:00:18
667500 -- (-542.046) (-541.065) (-542.384) [-548.491] * (-542.877) (-543.776) [-541.027] (-542.742) -- 0:00:18
668000 -- [-540.981] (-541.402) (-544.415) (-554.991) * (-541.407) (-545.910) (-542.621) [-541.710] -- 0:00:18
668500 -- (-545.510) [-541.014] (-547.938) (-547.361) * (-541.662) (-543.242) (-541.488) [-546.082] -- 0:00:18
669000 -- (-544.967) (-541.365) (-543.134) [-542.373] * [-545.415] (-540.425) (-541.363) (-545.913) -- 0:00:19
669500 -- [-545.937] (-543.198) (-543.432) (-540.918) * (-542.376) (-544.011) [-541.631] (-541.634) -- 0:00:19
670000 -- (-541.507) [-541.094] (-542.241) (-541.624) * (-543.781) [-541.065] (-543.136) (-540.334) -- 0:00:19
Average standard deviation of split frequencies: 0.010148
670500 -- (-542.906) (-545.583) (-541.485) [-541.658] * (-544.756) (-541.794) [-542.610] (-540.231) -- 0:00:19
671000 -- (-543.866) [-540.900] (-542.442) (-543.920) * [-541.158] (-540.394) (-544.231) (-541.619) -- 0:00:19
671500 -- (-542.934) (-541.384) [-544.857] (-547.062) * [-544.231] (-543.352) (-543.692) (-542.171) -- 0:00:19
672000 -- (-543.670) (-541.625) (-543.825) [-543.239] * (-542.061) [-540.954] (-543.431) (-542.836) -- 0:00:19
672500 -- (-542.273) (-541.230) [-541.631] (-543.539) * (-543.255) (-540.328) [-542.172] (-544.665) -- 0:00:18
673000 -- (-542.620) [-542.462] (-542.534) (-540.229) * (-541.244) [-541.177] (-543.462) (-545.807) -- 0:00:18
673500 -- (-543.257) [-542.326] (-541.660) (-544.303) * (-543.051) (-542.323) [-544.460] (-544.355) -- 0:00:18
674000 -- (-542.821) [-540.722] (-540.777) (-541.680) * (-544.078) [-540.995] (-543.569) (-543.372) -- 0:00:18
674500 -- [-542.687] (-542.917) (-542.987) (-542.524) * (-543.558) (-545.720) (-543.108) [-542.059] -- 0:00:18
675000 -- (-545.313) (-543.697) [-543.792] (-541.781) * [-542.392] (-542.659) (-545.806) (-546.551) -- 0:00:18
Average standard deviation of split frequencies: 0.009981
675500 -- (-545.095) (-545.227) [-542.061] (-541.011) * [-543.334] (-545.412) (-544.387) (-541.142) -- 0:00:18
676000 -- (-543.048) (-542.259) (-540.957) [-540.853] * [-540.691] (-542.459) (-549.344) (-544.145) -- 0:00:18
676500 -- (-545.395) (-543.575) [-541.718] (-547.989) * [-541.941] (-542.236) (-541.736) (-546.309) -- 0:00:18
677000 -- (-544.476) (-541.648) [-541.062] (-544.774) * (-541.819) (-542.396) (-542.372) [-551.128] -- 0:00:18
677500 -- (-542.745) (-543.525) (-541.162) [-545.376] * (-543.623) [-540.890] (-542.662) (-542.375) -- 0:00:18
678000 -- (-545.495) (-542.897) [-540.889] (-544.617) * [-543.174] (-541.144) (-545.698) (-542.358) -- 0:00:18
678500 -- (-540.846) [-542.044] (-542.762) (-541.496) * (-541.521) [-541.297] (-542.350) (-542.740) -- 0:00:18
679000 -- (-540.920) (-543.444) (-542.771) [-543.665] * (-540.950) (-551.347) [-545.998] (-541.116) -- 0:00:18
679500 -- (-541.007) [-543.845] (-542.173) (-546.561) * (-542.057) (-542.237) (-544.215) [-546.717] -- 0:00:18
680000 -- [-540.730] (-543.640) (-541.885) (-542.142) * (-544.045) (-543.277) [-542.278] (-547.565) -- 0:00:18
Average standard deviation of split frequencies: 0.009523
680500 -- (-542.275) (-545.750) [-543.075] (-540.769) * (-547.045) (-541.726) (-545.594) [-544.134] -- 0:00:18
681000 -- (-545.427) (-544.326) (-546.756) [-542.076] * (-545.388) (-540.941) [-540.961] (-540.500) -- 0:00:18
681500 -- (-542.421) (-541.563) (-544.505) [-540.870] * (-543.319) (-541.998) [-541.424] (-540.332) -- 0:00:18
682000 -- (-543.592) (-543.786) (-546.317) [-544.271] * (-543.890) (-543.661) [-543.744] (-544.546) -- 0:00:18
682500 -- (-543.108) (-544.976) (-543.782) [-542.245] * (-542.956) (-546.054) (-541.739) [-541.411] -- 0:00:18
683000 -- (-543.145) [-540.743] (-542.494) (-544.521) * [-544.537] (-544.167) (-542.867) (-541.082) -- 0:00:18
683500 -- (-544.545) (-543.700) [-542.541] (-551.102) * (-545.385) (-542.869) [-542.382] (-543.402) -- 0:00:18
684000 -- [-542.024] (-542.508) (-544.837) (-543.350) * [-543.108] (-543.099) (-542.971) (-544.233) -- 0:00:18
684500 -- (-543.897) (-541.317) (-542.559) [-544.424] * (-542.284) [-541.283] (-546.399) (-543.961) -- 0:00:17
685000 -- (-541.693) (-548.693) (-541.283) [-543.693] * [-541.869] (-541.023) (-544.744) (-540.846) -- 0:00:17
Average standard deviation of split frequencies: 0.009363
685500 -- (-540.691) (-544.514) (-542.267) [-540.852] * (-543.192) (-541.080) (-540.474) [-543.743] -- 0:00:17
686000 -- (-541.378) [-541.365] (-540.156) (-545.236) * (-544.505) (-541.313) (-541.693) [-542.876] -- 0:00:18
686500 -- [-540.735] (-543.624) (-540.206) (-545.329) * (-542.992) (-540.831) [-541.544] (-540.934) -- 0:00:18
687000 -- [-543.293] (-542.022) (-543.931) (-542.333) * [-542.193] (-540.341) (-542.542) (-541.510) -- 0:00:18
687500 -- (-541.694) [-545.283] (-545.275) (-544.381) * (-541.918) [-541.112] (-543.454) (-544.959) -- 0:00:18
688000 -- (-542.458) (-544.720) [-544.624] (-542.871) * (-542.715) [-543.802] (-542.896) (-542.065) -- 0:00:18
688500 -- [-542.526] (-542.990) (-541.888) (-543.276) * (-541.164) [-542.907] (-542.624) (-542.583) -- 0:00:18
689000 -- (-544.414) (-540.179) [-540.857] (-543.527) * [-543.790] (-542.146) (-544.193) (-545.803) -- 0:00:18
689500 -- (-543.169) (-544.555) [-543.401] (-543.780) * [-542.512] (-540.772) (-542.268) (-545.561) -- 0:00:18
690000 -- (-545.174) (-541.216) (-545.177) [-543.709] * (-557.817) [-541.518] (-543.314) (-545.575) -- 0:00:17
Average standard deviation of split frequencies: 0.009214
690500 -- (-545.585) (-542.871) [-543.197] (-543.340) * (-545.679) (-547.645) (-543.428) [-544.760] -- 0:00:17
691000 -- (-547.314) [-541.323] (-542.734) (-543.214) * [-541.553] (-543.854) (-542.417) (-543.051) -- 0:00:17
691500 -- (-542.388) (-543.256) [-542.086] (-543.782) * [-541.445] (-541.840) (-543.264) (-541.680) -- 0:00:17
692000 -- (-542.099) [-542.322] (-544.317) (-542.882) * (-544.594) [-543.202] (-543.948) (-544.247) -- 0:00:17
692500 -- [-540.321] (-542.953) (-542.238) (-543.880) * (-544.673) (-542.501) (-541.766) [-541.475] -- 0:00:17
693000 -- [-540.889] (-541.116) (-541.398) (-544.712) * (-543.626) (-542.083) (-542.424) [-546.764] -- 0:00:17
693500 -- [-542.890] (-546.218) (-545.513) (-544.501) * (-541.305) (-543.630) [-540.649] (-542.555) -- 0:00:17
694000 -- (-541.538) (-543.869) [-541.284] (-545.989) * [-540.599] (-540.772) (-541.221) (-541.117) -- 0:00:17
694500 -- (-543.351) (-542.040) [-542.745] (-542.841) * (-544.083) [-541.123] (-543.751) (-544.619) -- 0:00:17
695000 -- (-542.435) [-542.213] (-542.943) (-543.028) * [-541.394] (-541.463) (-544.300) (-542.618) -- 0:00:17
Average standard deviation of split frequencies: 0.009017
695500 -- (-542.946) (-540.486) (-541.821) [-542.862] * [-541.450] (-541.740) (-542.940) (-541.798) -- 0:00:17
696000 -- (-542.587) (-546.537) [-541.745] (-544.899) * [-542.258] (-543.985) (-542.484) (-541.339) -- 0:00:17
696500 -- (-543.538) (-544.104) (-540.959) [-547.167] * [-542.146] (-542.247) (-546.218) (-542.912) -- 0:00:17
697000 -- (-546.524) [-540.593] (-541.200) (-542.098) * [-542.352] (-540.577) (-544.013) (-541.829) -- 0:00:17
697500 -- (-543.464) (-540.953) [-543.324] (-541.319) * (-543.061) (-545.347) (-541.563) [-542.448] -- 0:00:17
698000 -- [-541.884] (-543.011) (-542.729) (-544.242) * (-542.989) [-540.992] (-543.807) (-544.663) -- 0:00:17
698500 -- (-542.576) (-541.215) (-545.411) [-543.401] * (-542.349) (-545.714) [-544.676] (-541.373) -- 0:00:17
699000 -- (-542.296) (-544.757) (-546.803) [-543.351] * (-541.016) (-541.724) (-542.093) [-542.058] -- 0:00:17
699500 -- [-541.570] (-542.259) (-543.510) (-544.916) * (-541.961) [-543.997] (-544.090) (-541.894) -- 0:00:17
700000 -- [-540.832] (-543.016) (-544.531) (-542.209) * (-541.266) (-541.201) [-543.595] (-542.647) -- 0:00:17
Average standard deviation of split frequencies: 0.008999
700500 -- (-542.496) (-546.581) (-542.352) [-542.085] * [-541.037] (-543.359) (-542.528) (-541.403) -- 0:00:17
701000 -- (-542.287) (-540.953) (-543.715) [-542.188] * (-541.040) (-543.909) [-543.906] (-543.619) -- 0:00:17
701500 -- (-542.007) [-544.545] (-544.084) (-544.666) * (-540.816) (-544.671) (-543.120) [-542.967] -- 0:00:17
702000 -- (-541.412) [-542.275] (-542.119) (-543.548) * (-545.040) (-541.662) (-543.152) [-542.405] -- 0:00:16
702500 -- (-543.085) (-542.626) (-544.635) [-540.954] * [-542.716] (-541.419) (-542.674) (-541.185) -- 0:00:17
703000 -- (-543.582) (-549.012) (-541.238) [-542.401] * (-540.992) (-542.297) [-545.631] (-543.082) -- 0:00:17
703500 -- [-542.922] (-544.914) (-542.502) (-542.037) * (-541.637) (-546.216) [-542.531] (-543.101) -- 0:00:17
704000 -- (-540.681) [-542.062] (-545.705) (-544.317) * (-543.978) (-545.039) (-545.318) [-540.751] -- 0:00:17
704500 -- (-544.064) (-541.370) [-545.062] (-544.727) * (-546.007) (-541.704) [-541.774] (-547.373) -- 0:00:17
705000 -- [-542.769] (-547.558) (-542.196) (-541.834) * (-542.484) (-541.554) (-541.117) [-541.369] -- 0:00:17
Average standard deviation of split frequencies: 0.008597
705500 -- (-542.939) [-545.106] (-542.369) (-543.375) * (-541.938) (-541.496) (-544.266) [-544.209] -- 0:00:17
706000 -- [-541.463] (-541.438) (-540.458) (-542.428) * [-544.080] (-543.540) (-543.942) (-544.203) -- 0:00:17
706500 -- (-543.167) (-541.910) [-542.979] (-544.296) * (-545.543) [-541.180] (-541.981) (-544.061) -- 0:00:17
707000 -- (-543.477) [-541.057] (-543.169) (-542.015) * (-542.601) (-540.496) [-542.496] (-541.299) -- 0:00:16
707500 -- [-542.457] (-541.006) (-541.421) (-544.459) * (-544.282) (-540.821) (-543.090) [-542.751] -- 0:00:16
708000 -- (-542.296) (-543.121) [-541.739] (-542.833) * (-542.411) (-541.415) (-543.835) [-541.155] -- 0:00:16
708500 -- (-540.434) (-542.396) (-544.445) [-542.324] * (-541.257) (-543.402) (-542.080) [-541.171] -- 0:00:16
709000 -- (-542.045) (-542.588) [-543.951] (-546.638) * (-543.020) (-541.830) [-542.895] (-548.232) -- 0:00:16
709500 -- [-540.860] (-544.157) (-542.955) (-541.844) * (-541.184) (-542.105) (-540.882) [-543.475] -- 0:00:16
710000 -- [-542.986] (-541.185) (-543.323) (-544.125) * (-545.173) [-545.203] (-541.796) (-547.007) -- 0:00:16
Average standard deviation of split frequencies: 0.008499
710500 -- (-545.357) [-541.658] (-541.252) (-541.101) * (-544.950) (-546.094) [-542.775] (-546.383) -- 0:00:16
711000 -- [-543.824] (-541.065) (-542.881) (-542.584) * (-542.724) (-543.798) (-543.531) [-543.221] -- 0:00:16
711500 -- (-542.031) [-543.981] (-541.183) (-542.810) * [-544.218] (-541.383) (-540.942) (-543.570) -- 0:00:16
712000 -- (-543.359) (-542.093) [-541.380] (-547.806) * (-540.766) (-541.397) (-542.192) [-543.139] -- 0:00:16
712500 -- (-542.018) [-541.122] (-541.965) (-545.867) * (-542.489) [-543.157] (-541.298) (-545.698) -- 0:00:16
713000 -- (-542.636) [-542.615] (-542.713) (-543.124) * (-547.155) [-541.122] (-542.663) (-541.922) -- 0:00:16
713500 -- (-541.227) (-541.822) [-540.554] (-540.624) * (-543.643) (-541.582) (-551.115) [-542.759] -- 0:00:16
714000 -- (-543.639) [-544.599] (-543.958) (-540.529) * [-542.489] (-541.725) (-548.204) (-540.559) -- 0:00:16
714500 -- (-542.438) (-546.623) (-541.186) [-544.522] * [-543.594] (-542.157) (-541.228) (-542.394) -- 0:00:16
715000 -- (-543.106) [-543.614] (-542.488) (-542.856) * (-546.040) (-540.410) (-546.683) [-544.349] -- 0:00:16
Average standard deviation of split frequencies: 0.008559
715500 -- [-541.204] (-544.226) (-545.329) (-543.149) * (-542.357) (-541.594) (-546.740) [-542.264] -- 0:00:16
716000 -- (-540.952) (-541.281) [-543.181] (-544.839) * (-541.999) [-542.977] (-544.522) (-540.776) -- 0:00:16
716500 -- [-545.465] (-541.270) (-544.890) (-540.512) * (-541.898) [-542.851] (-542.457) (-541.936) -- 0:00:16
717000 -- (-543.782) (-543.251) (-543.306) [-540.574] * [-542.223] (-544.170) (-543.411) (-545.633) -- 0:00:16
717500 -- [-542.274] (-541.028) (-545.830) (-542.704) * (-542.813) (-542.276) (-544.279) [-540.631] -- 0:00:16
718000 -- [-542.422] (-542.240) (-545.176) (-542.998) * [-540.352] (-542.978) (-544.663) (-540.482) -- 0:00:16
718500 -- (-540.957) (-541.564) (-541.761) [-541.896] * (-541.006) (-541.390) (-544.200) [-541.525] -- 0:00:16
719000 -- [-543.937] (-541.945) (-542.040) (-542.992) * [-543.539] (-544.212) (-546.534) (-541.112) -- 0:00:16
719500 -- (-544.378) [-542.051] (-543.423) (-548.636) * (-542.230) (-543.139) [-546.810] (-542.271) -- 0:00:16
720000 -- (-545.792) (-544.747) [-543.097] (-548.048) * (-543.204) (-543.612) (-546.481) [-541.058] -- 0:00:16
Average standard deviation of split frequencies: 0.009280
720500 -- (-543.216) (-546.317) (-543.256) [-544.645] * (-546.415) (-544.921) [-542.326] (-540.859) -- 0:00:16
721000 -- (-543.782) [-541.537] (-546.027) (-543.268) * (-544.833) [-540.649] (-543.402) (-541.953) -- 0:00:16
721500 -- (-542.505) [-542.152] (-541.502) (-542.133) * [-541.117] (-543.504) (-541.829) (-545.404) -- 0:00:16
722000 -- [-546.324] (-543.570) (-542.069) (-541.265) * (-542.285) (-542.728) (-544.506) [-541.839] -- 0:00:16
722500 -- [-546.924] (-544.582) (-541.695) (-542.228) * (-542.012) [-542.510] (-543.095) (-542.078) -- 0:00:16
723000 -- [-546.276] (-546.955) (-542.468) (-543.334) * (-541.965) (-542.303) (-541.726) [-541.317] -- 0:00:16
723500 -- [-541.508] (-542.494) (-542.273) (-543.987) * (-544.824) (-551.649) [-540.524] (-543.733) -- 0:00:16
724000 -- [-543.566] (-541.381) (-544.311) (-543.708) * (-542.193) (-544.099) (-540.821) [-540.411] -- 0:00:16
724500 -- [-541.959] (-544.145) (-543.178) (-541.979) * (-543.263) (-547.162) [-542.747] (-542.216) -- 0:00:15
725000 -- (-547.575) [-541.980] (-543.420) (-546.983) * [-541.015] (-545.593) (-542.587) (-544.187) -- 0:00:15
Average standard deviation of split frequencies: 0.009131
725500 -- (-542.562) (-540.842) (-541.563) [-542.018] * [-541.577] (-543.353) (-540.876) (-542.819) -- 0:00:15
726000 -- [-542.791] (-548.956) (-542.615) (-540.759) * (-546.621) (-542.728) (-544.605) [-544.548] -- 0:00:15
726500 -- (-540.947) (-543.166) [-542.094] (-544.530) * (-546.037) [-543.590] (-544.104) (-541.786) -- 0:00:15
727000 -- [-540.976] (-543.909) (-541.388) (-543.011) * [-542.793] (-542.688) (-541.031) (-542.417) -- 0:00:15
727500 -- [-542.833] (-540.584) (-547.373) (-542.417) * (-542.662) [-544.713] (-541.153) (-541.201) -- 0:00:15
728000 -- (-551.031) (-540.648) [-541.814] (-544.044) * [-542.699] (-547.136) (-542.781) (-542.889) -- 0:00:15
728500 -- (-545.165) (-543.658) [-543.124] (-546.226) * (-541.160) (-543.220) (-543.891) [-540.956] -- 0:00:15
729000 -- (-543.187) (-543.694) [-541.815] (-540.824) * (-545.893) (-543.376) [-543.307] (-541.340) -- 0:00:15
729500 -- (-544.294) (-542.300) (-542.085) [-542.715] * [-542.941] (-546.714) (-545.178) (-541.117) -- 0:00:15
730000 -- (-543.502) (-546.010) [-542.394] (-541.899) * (-542.792) [-546.039] (-545.124) (-540.569) -- 0:00:15
Average standard deviation of split frequencies: 0.008669
730500 -- (-542.539) [-542.246] (-543.468) (-541.987) * [-543.452] (-546.386) (-543.031) (-542.209) -- 0:00:15
731000 -- (-545.383) (-540.741) (-542.429) [-541.953] * (-543.096) (-540.710) [-541.613] (-545.239) -- 0:00:15
731500 -- [-541.309] (-543.452) (-540.670) (-543.132) * (-541.159) [-540.710] (-542.922) (-542.503) -- 0:00:15
732000 -- (-541.286) [-541.975] (-550.079) (-541.994) * (-543.330) [-548.257] (-543.502) (-543.683) -- 0:00:15
732500 -- (-542.870) [-545.224] (-542.604) (-543.031) * [-545.004] (-541.185) (-542.700) (-541.794) -- 0:00:15
733000 -- [-542.833] (-545.335) (-543.005) (-543.371) * (-544.105) [-545.510] (-543.784) (-540.902) -- 0:00:15
733500 -- [-541.487] (-541.084) (-543.715) (-542.226) * (-543.260) (-542.543) [-541.393] (-541.853) -- 0:00:15
734000 -- (-542.639) [-541.225] (-543.180) (-543.099) * [-540.750] (-541.219) (-541.684) (-541.244) -- 0:00:15
734500 -- (-541.600) [-545.692] (-545.238) (-540.742) * (-545.154) (-541.805) (-547.319) [-540.872] -- 0:00:15
735000 -- (-541.771) (-547.385) [-544.801] (-544.224) * (-541.478) (-540.236) (-544.562) [-541.896] -- 0:00:15
Average standard deviation of split frequencies: 0.008887
735500 -- [-542.019] (-549.868) (-550.588) (-547.042) * (-542.442) (-540.631) (-543.521) [-547.212] -- 0:00:15
736000 -- (-546.266) (-546.382) [-542.240] (-548.096) * (-543.114) (-545.029) (-543.540) [-542.366] -- 0:00:15
736500 -- (-544.619) [-541.313] (-547.628) (-541.138) * (-543.631) (-543.897) [-541.544] (-545.370) -- 0:00:15
737000 -- (-543.722) (-545.807) [-544.997] (-541.405) * (-554.068) (-541.094) [-541.197] (-543.025) -- 0:00:15
737500 -- [-542.920] (-544.338) (-542.153) (-542.102) * (-547.677) (-543.015) (-543.255) [-541.219] -- 0:00:15
738000 -- (-540.834) [-541.962] (-540.247) (-543.182) * (-541.112) [-543.461] (-545.071) (-546.488) -- 0:00:15
738500 -- (-540.691) (-543.010) [-541.586] (-541.080) * [-541.450] (-541.199) (-547.774) (-542.628) -- 0:00:15
739000 -- [-542.802] (-543.120) (-541.389) (-541.746) * (-542.138) (-543.508) (-544.895) [-541.660] -- 0:00:15
739500 -- (-543.681) [-543.102] (-541.029) (-541.898) * (-540.944) [-543.070] (-544.239) (-541.083) -- 0:00:15
740000 -- [-541.935] (-543.780) (-542.237) (-542.765) * [-543.678] (-543.186) (-543.889) (-543.515) -- 0:00:15
Average standard deviation of split frequencies: 0.010071
740500 -- (-543.460) (-542.812) (-543.377) [-542.196] * (-543.481) (-545.195) [-541.797] (-544.341) -- 0:00:15
741000 -- (-542.736) (-541.696) (-543.896) [-542.733] * [-541.661] (-542.548) (-543.437) (-546.490) -- 0:00:15
741500 -- [-541.533] (-541.409) (-542.333) (-541.803) * (-541.084) [-540.483] (-540.495) (-541.856) -- 0:00:14
742000 -- (-546.956) (-540.389) [-544.279] (-541.622) * (-541.342) (-541.148) (-541.736) [-543.922] -- 0:00:14
742500 -- (-553.571) (-541.218) [-541.808] (-541.904) * (-543.085) [-540.730] (-541.384) (-548.871) -- 0:00:14
743000 -- [-543.077] (-541.204) (-541.581) (-542.144) * (-541.067) (-541.216) (-541.057) [-543.245] -- 0:00:14
743500 -- [-542.783] (-542.229) (-540.879) (-542.142) * (-548.817) (-541.620) (-541.407) [-542.126] -- 0:00:14
744000 -- (-542.613) (-541.693) (-541.134) [-543.000] * (-542.802) (-540.231) (-541.024) [-543.190] -- 0:00:14
744500 -- [-542.545] (-542.107) (-541.673) (-542.694) * [-542.533] (-540.212) (-545.131) (-549.384) -- 0:00:14
745000 -- [-544.390] (-541.961) (-540.860) (-547.093) * [-544.163] (-540.770) (-544.576) (-542.975) -- 0:00:14
Average standard deviation of split frequencies: 0.010408
745500 -- (-540.606) (-543.736) [-540.802] (-542.168) * (-546.955) [-543.018] (-543.128) (-546.295) -- 0:00:14
746000 -- (-541.276) [-543.353] (-541.364) (-543.224) * (-547.912) (-542.404) [-543.741] (-542.760) -- 0:00:14
746500 -- (-541.882) (-542.123) [-542.453] (-545.705) * (-545.687) [-542.718] (-541.687) (-542.385) -- 0:00:14
747000 -- [-541.090] (-541.528) (-542.523) (-545.962) * [-541.399] (-543.161) (-540.765) (-541.403) -- 0:00:14
747500 -- (-542.373) (-540.702) [-541.668] (-545.237) * (-542.631) (-540.931) [-542.402] (-540.497) -- 0:00:14
748000 -- (-542.828) (-542.103) (-542.123) [-542.201] * (-542.792) (-541.871) (-543.698) [-544.805] -- 0:00:14
748500 -- (-544.836) (-544.536) [-543.676] (-542.489) * (-543.554) (-545.733) (-540.354) [-544.923] -- 0:00:14
749000 -- (-543.852) (-542.889) (-542.996) [-542.085] * (-542.508) (-543.789) (-542.957) [-540.899] -- 0:00:14
749500 -- (-541.604) [-540.909] (-540.515) (-543.787) * (-542.384) (-545.399) [-541.283] (-545.834) -- 0:00:14
750000 -- (-546.201) [-541.752] (-540.651) (-545.865) * (-543.782) (-545.091) (-544.367) [-542.848] -- 0:00:14
Average standard deviation of split frequencies: 0.009851
750500 -- (-545.768) (-544.203) (-540.871) [-540.785] * (-543.769) (-542.742) (-541.512) [-541.807] -- 0:00:14
751000 -- (-544.296) (-542.458) [-544.860] (-542.212) * [-546.245] (-543.352) (-541.827) (-543.679) -- 0:00:14
751500 -- (-547.215) [-542.542] (-544.410) (-541.707) * (-544.691) (-543.435) (-542.135) [-544.462] -- 0:00:14
752000 -- (-544.700) (-542.538) (-544.693) [-541.652] * (-544.366) (-544.957) (-540.841) [-544.109] -- 0:00:14
752500 -- (-544.098) (-541.600) (-540.649) [-543.200] * [-540.931] (-540.615) (-542.160) (-543.822) -- 0:00:14
753000 -- (-542.823) [-541.236] (-544.004) (-540.796) * (-542.572) (-542.494) (-541.375) [-543.160] -- 0:00:14
753500 -- (-547.816) [-542.340] (-543.350) (-543.227) * (-541.114) (-543.546) [-542.448] (-543.668) -- 0:00:14
754000 -- (-542.300) [-541.913] (-541.110) (-542.354) * (-542.970) (-542.262) [-546.135] (-542.574) -- 0:00:14
754500 -- [-541.686] (-542.383) (-540.688) (-542.497) * (-542.618) [-542.282] (-544.473) (-542.391) -- 0:00:14
755000 -- (-543.852) [-542.160] (-541.278) (-541.502) * [-544.044] (-541.959) (-545.623) (-542.679) -- 0:00:14
Average standard deviation of split frequencies: 0.009665
755500 -- (-547.717) [-542.891] (-542.522) (-541.519) * [-541.209] (-540.288) (-545.437) (-541.046) -- 0:00:14
756000 -- (-541.741) (-543.514) [-543.466] (-542.705) * [-546.812] (-541.494) (-545.021) (-542.058) -- 0:00:14
756500 -- (-541.234) (-542.198) (-544.050) [-541.458] * (-540.500) [-540.602] (-542.336) (-543.467) -- 0:00:14
757000 -- (-540.702) [-541.408] (-548.688) (-544.114) * (-543.666) (-543.367) [-542.826] (-540.425) -- 0:00:14
757500 -- (-541.854) [-543.363] (-546.596) (-545.097) * (-542.225) (-543.440) [-540.360] (-543.230) -- 0:00:14
758000 -- (-541.516) (-541.927) (-541.509) [-546.300] * (-540.996) (-544.252) (-546.568) [-541.185] -- 0:00:14
758500 -- (-540.929) [-543.946] (-545.208) (-547.752) * (-543.266) (-547.407) (-541.445) [-542.466] -- 0:00:14
759000 -- (-544.043) [-542.609] (-545.399) (-540.951) * (-541.076) (-543.308) [-542.726] (-543.203) -- 0:00:13
759500 -- (-545.328) (-542.672) [-544.273] (-542.340) * [-541.971] (-541.948) (-545.761) (-546.543) -- 0:00:13
760000 -- (-546.096) (-542.326) [-542.243] (-542.076) * (-543.615) [-540.635] (-543.558) (-545.308) -- 0:00:13
Average standard deviation of split frequencies: 0.009838
760500 -- [-544.695] (-541.634) (-542.211) (-541.158) * [-548.429] (-542.205) (-547.013) (-542.242) -- 0:00:13
761000 -- [-543.131] (-544.146) (-542.595) (-548.127) * (-542.110) [-543.662] (-544.876) (-541.559) -- 0:00:13
761500 -- [-542.269] (-543.128) (-542.369) (-543.524) * (-541.805) (-543.385) [-543.294] (-543.234) -- 0:00:13
762000 -- (-541.045) (-543.740) (-543.000) [-540.969] * (-545.736) (-543.264) (-550.318) [-540.598] -- 0:00:13
762500 -- (-540.660) (-541.793) (-543.921) [-542.785] * (-544.207) (-546.646) (-544.450) [-544.288] -- 0:00:13
763000 -- (-542.300) [-542.117] (-542.509) (-542.688) * (-540.828) (-544.983) [-546.132] (-542.411) -- 0:00:13
763500 -- (-544.602) [-542.253] (-541.378) (-541.956) * (-547.644) [-542.625] (-540.693) (-542.035) -- 0:00:13
764000 -- (-543.041) [-543.837] (-541.400) (-540.922) * (-543.324) [-542.159] (-541.709) (-543.773) -- 0:00:13
764500 -- [-543.727] (-543.581) (-544.080) (-541.092) * (-548.441) (-541.467) [-541.336] (-541.455) -- 0:00:13
765000 -- (-540.543) (-546.786) (-542.897) [-543.924] * (-544.435) [-541.338] (-541.031) (-544.830) -- 0:00:13
Average standard deviation of split frequencies: 0.009693
765500 -- [-543.776] (-542.435) (-541.789) (-541.268) * (-541.859) [-544.201] (-541.080) (-547.954) -- 0:00:13
766000 -- [-547.334] (-543.626) (-542.050) (-542.517) * [-540.674] (-543.197) (-541.653) (-544.482) -- 0:00:13
766500 -- (-540.835) (-546.116) (-542.046) [-542.119] * (-542.450) [-541.367] (-540.989) (-542.346) -- 0:00:13
767000 -- (-540.894) [-543.727] (-541.367) (-542.161) * (-542.565) (-541.681) (-545.857) [-542.623] -- 0:00:13
767500 -- (-540.959) (-540.891) [-541.457] (-546.589) * [-541.087] (-542.648) (-546.454) (-545.775) -- 0:00:13
768000 -- (-541.799) [-543.012] (-543.924) (-543.989) * (-548.511) [-541.192] (-544.100) (-541.108) -- 0:00:13
768500 -- (-542.795) (-543.797) (-544.259) [-541.944] * (-543.940) (-540.379) [-543.525] (-540.658) -- 0:00:13
769000 -- (-544.540) [-543.845] (-541.745) (-544.726) * (-543.531) (-540.734) (-546.068) [-544.634] -- 0:00:13
769500 -- (-540.522) (-544.158) [-541.138] (-544.852) * [-543.448] (-541.046) (-543.958) (-544.477) -- 0:00:13
770000 -- [-543.308] (-543.269) (-542.813) (-545.915) * [-541.735] (-542.818) (-546.638) (-544.479) -- 0:00:13
Average standard deviation of split frequencies: 0.009443
770500 -- (-541.357) [-545.739] (-543.202) (-540.927) * (-540.625) [-542.314] (-543.019) (-544.017) -- 0:00:13
771000 -- [-542.126] (-545.456) (-542.983) (-545.089) * (-542.827) (-541.039) [-541.512] (-543.070) -- 0:00:13
771500 -- [-542.820] (-543.024) (-543.790) (-542.580) * [-543.510] (-542.644) (-541.811) (-547.021) -- 0:00:13
772000 -- (-545.338) (-542.199) (-546.277) [-541.622] * [-541.294] (-544.878) (-543.480) (-542.760) -- 0:00:13
772500 -- (-541.321) (-547.080) [-547.823] (-542.791) * (-542.286) [-542.918] (-542.269) (-541.647) -- 0:00:13
773000 -- (-547.343) [-546.776] (-543.075) (-543.071) * [-543.669] (-542.587) (-541.517) (-542.571) -- 0:00:13
773500 -- (-543.043) (-543.186) (-541.336) [-545.630] * (-541.018) (-541.956) [-540.649] (-542.538) -- 0:00:13
774000 -- (-544.292) (-541.680) [-541.450] (-545.575) * [-542.573] (-542.506) (-541.199) (-545.160) -- 0:00:13
774500 -- (-547.544) [-540.674] (-547.715) (-541.445) * [-542.555] (-541.945) (-542.569) (-544.700) -- 0:00:13
775000 -- (-544.314) (-543.750) (-541.306) [-543.157] * [-543.281] (-541.247) (-546.066) (-543.291) -- 0:00:13
Average standard deviation of split frequencies: 0.009226
775500 -- [-541.590] (-542.945) (-540.868) (-544.017) * (-541.823) (-541.393) (-543.611) [-542.261] -- 0:00:13
776000 -- (-540.948) [-541.594] (-541.033) (-545.399) * (-540.660) (-544.030) [-541.910] (-545.022) -- 0:00:12
776500 -- (-543.203) (-540.947) (-541.486) [-542.224] * (-542.226) (-540.454) [-547.807] (-542.880) -- 0:00:12
777000 -- [-541.003] (-542.200) (-544.017) (-540.921) * (-541.700) (-542.352) (-542.831) [-544.454] -- 0:00:12
777500 -- [-545.095] (-541.527) (-543.479) (-543.509) * [-541.756] (-541.745) (-542.615) (-551.391) -- 0:00:12
778000 -- [-540.964] (-540.526) (-542.798) (-542.690) * (-542.074) [-541.260] (-542.455) (-542.420) -- 0:00:12
778500 -- [-542.602] (-541.241) (-542.463) (-546.712) * (-541.927) (-545.024) [-541.326] (-542.209) -- 0:00:12
779000 -- [-542.909] (-541.753) (-542.727) (-554.923) * [-542.072] (-550.391) (-543.349) (-543.708) -- 0:00:12
779500 -- (-545.711) [-540.359] (-544.651) (-543.433) * (-541.998) (-542.773) (-543.644) [-541.473] -- 0:00:12
780000 -- [-541.582] (-540.359) (-541.119) (-543.582) * (-541.772) (-543.495) [-541.045] (-540.463) -- 0:00:12
Average standard deviation of split frequencies: 0.009548
780500 -- (-548.364) (-541.472) [-542.007] (-542.513) * [-544.218] (-545.994) (-541.753) (-544.723) -- 0:00:12
781000 -- (-543.588) (-542.478) [-541.793] (-546.095) * (-544.105) (-540.747) (-543.075) [-541.665] -- 0:00:12
781500 -- (-541.672) (-542.659) [-543.352] (-542.424) * [-542.611] (-541.956) (-541.996) (-541.181) -- 0:00:12
782000 -- (-542.157) (-540.819) (-542.289) [-543.212] * (-541.431) [-543.620] (-541.364) (-541.058) -- 0:00:12
782500 -- (-541.659) (-540.789) (-542.330) [-542.161] * (-542.873) [-541.037] (-544.771) (-542.894) -- 0:00:12
783000 -- (-543.000) (-542.004) [-540.607] (-549.006) * (-543.009) [-546.874] (-544.307) (-541.747) -- 0:00:12
783500 -- (-541.103) [-543.130] (-542.801) (-548.143) * (-542.776) (-545.642) (-541.679) [-541.509] -- 0:00:12
784000 -- (-541.450) (-542.526) [-542.902] (-543.864) * [-542.089] (-541.045) (-542.814) (-540.928) -- 0:00:12
784500 -- (-540.455) (-545.208) (-542.908) [-541.047] * [-541.206] (-543.121) (-541.327) (-545.962) -- 0:00:12
785000 -- [-540.309] (-541.117) (-545.303) (-544.003) * [-541.947] (-542.443) (-547.390) (-541.576) -- 0:00:12
Average standard deviation of split frequencies: 0.009746
785500 -- (-542.602) (-542.956) [-543.380] (-544.058) * (-542.374) [-542.553] (-550.037) (-541.909) -- 0:00:12
786000 -- (-541.343) (-541.536) [-541.609] (-544.409) * [-542.851] (-541.647) (-548.587) (-542.845) -- 0:00:12
786500 -- (-542.916) (-542.577) (-546.104) [-543.938] * [-540.798] (-543.550) (-541.869) (-541.453) -- 0:00:12
787000 -- (-542.905) [-542.953] (-543.771) (-542.743) * (-541.200) (-547.522) [-541.793] (-543.577) -- 0:00:12
787500 -- (-541.323) (-543.597) (-544.353) [-541.187] * (-541.151) [-548.038] (-540.996) (-542.795) -- 0:00:12
788000 -- (-544.586) (-541.474) [-541.719] (-544.040) * (-540.924) [-542.427] (-542.137) (-543.224) -- 0:00:12
788500 -- (-540.259) (-544.720) (-542.321) [-542.082] * (-541.184) (-540.988) (-540.650) [-540.376] -- 0:00:12
789000 -- (-541.958) (-543.314) [-541.279] (-541.819) * (-543.121) (-541.152) [-540.732] (-542.790) -- 0:00:12
789500 -- (-541.546) (-540.365) (-541.670) [-542.614] * (-543.102) (-544.186) [-541.766] (-542.379) -- 0:00:12
790000 -- (-542.109) (-540.638) (-540.667) [-542.607] * (-544.527) [-543.846] (-542.455) (-541.871) -- 0:00:12
Average standard deviation of split frequencies: 0.010024
790500 -- (-543.321) (-541.512) [-541.256] (-543.672) * [-540.895] (-544.184) (-540.807) (-545.111) -- 0:00:12
791000 -- (-542.983) (-542.457) [-542.080] (-543.073) * (-542.030) [-543.652] (-546.350) (-543.163) -- 0:00:12
791500 -- (-542.596) (-541.498) (-542.584) [-541.783] * (-542.009) (-544.713) (-543.175) [-541.991] -- 0:00:12
792000 -- (-546.719) (-542.405) [-541.539] (-541.648) * [-542.542] (-542.192) (-543.173) (-543.975) -- 0:00:12
792500 -- [-543.445] (-546.984) (-541.760) (-544.263) * [-543.938] (-544.586) (-544.331) (-548.862) -- 0:00:12
793000 -- (-540.205) (-543.199) (-540.968) [-543.461] * (-541.165) [-544.087] (-541.434) (-544.920) -- 0:00:12
793500 -- (-541.970) (-543.852) [-544.347] (-542.800) * [-541.339] (-544.852) (-542.202) (-542.065) -- 0:00:11
794000 -- [-541.261] (-545.548) (-542.305) (-543.747) * (-543.288) (-543.079) (-541.500) [-543.807] -- 0:00:11
794500 -- [-542.374] (-542.073) (-540.464) (-543.228) * (-541.750) (-542.716) [-542.159] (-543.009) -- 0:00:11
795000 -- (-542.223) [-544.011] (-545.028) (-544.712) * (-543.458) (-542.609) [-541.891] (-543.080) -- 0:00:11
Average standard deviation of split frequencies: 0.010401
795500 -- (-541.546) (-543.057) (-541.501) [-541.643] * (-543.441) (-542.532) (-541.560) [-544.664] -- 0:00:11
796000 -- [-541.191] (-543.128) (-543.208) (-541.895) * (-542.235) [-540.977] (-542.019) (-541.994) -- 0:00:11
796500 -- (-540.346) (-547.808) (-543.076) [-542.998] * (-546.948) (-542.977) [-541.207] (-541.037) -- 0:00:11
797000 -- (-542.938) [-547.502] (-544.299) (-541.753) * [-541.011] (-541.773) (-542.658) (-541.455) -- 0:00:11
797500 -- (-544.201) [-544.073] (-540.876) (-543.687) * (-541.438) (-542.121) (-540.588) [-542.846] -- 0:00:11
798000 -- (-542.637) (-542.212) (-542.327) [-542.792] * (-545.575) [-541.595] (-543.937) (-543.192) -- 0:00:11
798500 -- (-543.761) [-540.760] (-541.808) (-546.327) * (-542.533) (-540.731) (-546.161) [-542.182] -- 0:00:11
799000 -- (-542.145) (-546.448) (-540.903) [-545.795] * (-542.234) (-543.385) [-543.075] (-543.991) -- 0:00:11
799500 -- (-548.242) (-546.571) [-540.986] (-545.184) * (-547.040) [-541.896] (-543.331) (-542.712) -- 0:00:11
800000 -- [-543.560] (-545.443) (-541.749) (-540.666) * (-544.584) [-542.366] (-548.765) (-543.356) -- 0:00:11
Average standard deviation of split frequencies: 0.010708
800500 -- (-542.800) [-542.401] (-541.037) (-542.499) * [-542.366] (-542.896) (-543.344) (-542.915) -- 0:00:11
801000 -- (-542.822) (-544.083) (-541.850) [-544.882] * (-546.536) [-544.792] (-544.344) (-544.951) -- 0:00:11
801500 -- (-544.681) (-542.676) (-546.094) [-544.509] * (-542.143) (-543.807) [-544.342] (-541.076) -- 0:00:11
802000 -- [-543.300] (-541.133) (-545.606) (-543.713) * (-542.151) (-541.846) [-543.092] (-543.356) -- 0:00:11
802500 -- (-543.855) [-543.863] (-544.579) (-541.604) * (-541.246) [-541.240] (-541.321) (-541.910) -- 0:00:11
803000 -- [-541.644] (-541.394) (-543.096) (-544.373) * (-541.446) (-544.941) (-542.714) [-541.849] -- 0:00:11
803500 -- (-542.460) [-543.262] (-541.288) (-541.036) * (-542.020) (-542.679) (-542.079) [-544.116] -- 0:00:11
804000 -- (-543.553) (-545.023) (-542.221) [-542.400] * [-540.920] (-542.719) (-542.000) (-541.017) -- 0:00:11
804500 -- (-543.685) (-546.068) [-544.856] (-540.779) * (-548.448) (-541.549) (-543.042) [-542.991] -- 0:00:11
805000 -- (-546.386) (-540.847) (-548.328) [-542.070] * (-546.162) (-541.860) (-542.513) [-544.913] -- 0:00:11
Average standard deviation of split frequencies: 0.010637
805500 -- (-542.260) [-543.782] (-545.128) (-543.170) * [-542.881] (-543.339) (-542.785) (-541.377) -- 0:00:11
806000 -- (-541.476) [-547.785] (-544.627) (-549.115) * [-545.520] (-548.423) (-543.656) (-544.379) -- 0:00:11
806500 -- (-542.705) (-545.066) (-541.910) [-542.685] * (-545.974) [-541.115] (-547.248) (-542.738) -- 0:00:11
807000 -- (-540.577) (-547.886) [-543.120] (-542.409) * (-546.673) (-541.738) (-545.315) [-541.737] -- 0:00:11
807500 -- (-540.838) (-541.729) (-540.646) [-540.840] * (-546.318) [-541.493] (-547.173) (-541.555) -- 0:00:11
808000 -- (-541.805) (-541.892) (-543.370) [-545.880] * (-544.630) [-540.279] (-544.906) (-541.170) -- 0:00:11
808500 -- (-546.464) (-541.524) (-543.214) [-542.374] * (-543.179) [-540.398] (-544.367) (-540.621) -- 0:00:11
809000 -- (-544.555) (-543.364) (-545.585) [-544.275] * (-542.490) [-542.303] (-541.667) (-541.220) -- 0:00:11
809500 -- (-545.538) (-541.242) [-541.668] (-548.001) * (-542.381) (-540.582) (-541.704) [-543.197] -- 0:00:11
810000 -- (-543.627) [-541.551] (-548.940) (-544.566) * (-547.103) (-541.114) (-540.761) [-543.119] -- 0:00:11
Average standard deviation of split frequencies: 0.010721
810500 -- (-546.519) [-541.843] (-542.372) (-542.735) * [-548.888] (-541.252) (-544.864) (-542.012) -- 0:00:10
811000 -- [-548.526] (-542.205) (-546.310) (-541.439) * [-546.076] (-545.776) (-540.713) (-547.301) -- 0:00:10
811500 -- (-545.292) [-541.477] (-543.103) (-543.647) * [-541.316] (-544.557) (-542.741) (-542.118) -- 0:00:10
812000 -- (-540.290) [-542.429] (-545.221) (-543.086) * (-544.371) [-543.199] (-543.603) (-546.570) -- 0:00:10
812500 -- [-544.851] (-541.745) (-542.373) (-543.185) * [-542.356] (-542.398) (-545.478) (-544.776) -- 0:00:10
813000 -- [-545.717] (-542.535) (-547.858) (-542.556) * (-542.813) [-542.672] (-547.837) (-541.015) -- 0:00:10
813500 -- (-541.978) (-544.790) (-545.831) [-541.849] * [-542.778] (-544.882) (-540.720) (-540.430) -- 0:00:10
814000 -- (-541.587) (-544.002) [-544.172] (-540.757) * (-544.514) (-542.299) (-541.797) [-540.630] -- 0:00:10
814500 -- [-541.297] (-543.854) (-543.225) (-545.312) * [-544.359] (-543.877) (-542.011) (-540.513) -- 0:00:10
815000 -- [-542.412] (-543.309) (-546.288) (-543.100) * (-545.907) (-541.117) (-540.257) [-541.155] -- 0:00:10
Average standard deviation of split frequencies: 0.010507
815500 -- (-541.698) (-541.431) [-543.104] (-540.649) * (-541.021) [-542.741] (-542.437) (-541.700) -- 0:00:10
816000 -- [-541.288] (-544.749) (-541.019) (-542.650) * (-541.390) (-540.808) (-543.043) [-544.326] -- 0:00:10
816500 -- (-541.790) (-540.860) [-541.671] (-543.070) * [-541.943] (-544.152) (-542.736) (-542.591) -- 0:00:10
817000 -- (-542.709) [-541.525] (-541.425) (-542.954) * (-542.725) (-542.763) (-541.175) [-543.518] -- 0:00:10
817500 -- (-543.256) [-541.068] (-545.561) (-542.803) * (-543.470) [-543.023] (-543.470) (-543.733) -- 0:00:10
818000 -- [-545.256] (-542.657) (-542.645) (-541.654) * (-541.368) [-541.108] (-542.855) (-544.743) -- 0:00:10
818500 -- (-543.622) [-544.694] (-546.733) (-542.605) * (-541.413) [-543.255] (-545.123) (-541.402) -- 0:00:10
819000 -- (-543.897) [-542.211] (-540.637) (-545.784) * (-541.281) (-545.369) [-542.938] (-540.862) -- 0:00:10
819500 -- (-541.731) [-541.967] (-541.278) (-541.331) * (-544.829) [-543.378] (-543.953) (-545.279) -- 0:00:10
820000 -- (-543.809) (-541.506) [-540.812] (-541.530) * (-545.284) (-544.376) [-542.728] (-541.830) -- 0:00:10
Average standard deviation of split frequencies: 0.010663
820500 -- [-541.983] (-543.558) (-542.421) (-541.884) * (-542.307) (-541.886) [-547.589] (-542.348) -- 0:00:10
821000 -- [-543.970] (-543.109) (-544.552) (-542.978) * (-543.209) [-542.788] (-546.021) (-542.011) -- 0:00:10
821500 -- (-545.276) (-543.339) (-547.496) [-542.532] * (-540.580) (-542.907) (-541.405) [-545.121] -- 0:00:10
822000 -- [-545.246] (-540.544) (-547.208) (-541.440) * (-543.454) (-542.385) [-543.201] (-544.441) -- 0:00:10
822500 -- (-543.819) (-541.373) (-543.018) [-541.796] * [-542.125] (-543.786) (-541.462) (-547.156) -- 0:00:10
823000 -- (-544.174) (-541.210) [-540.984] (-542.777) * [-541.036] (-541.223) (-542.415) (-543.463) -- 0:00:10
823500 -- [-541.997] (-542.004) (-541.442) (-542.310) * (-543.420) (-540.978) [-544.265] (-543.058) -- 0:00:10
824000 -- (-541.875) (-542.166) [-541.479] (-540.732) * (-544.607) [-545.718] (-540.642) (-544.958) -- 0:00:10
824500 -- (-546.609) (-541.409) (-542.584) [-541.768] * [-543.988] (-543.356) (-544.062) (-543.285) -- 0:00:10
825000 -- (-546.443) (-541.629) [-543.507] (-542.344) * (-541.376) (-545.439) (-543.175) [-540.290] -- 0:00:10
Average standard deviation of split frequencies: 0.010665
825500 -- [-542.206] (-541.242) (-541.388) (-542.416) * (-542.119) [-546.961] (-542.516) (-540.290) -- 0:00:10
826000 -- [-540.743] (-542.179) (-541.428) (-542.482) * (-544.453) (-547.089) (-541.515) [-543.471] -- 0:00:10
826500 -- (-542.096) (-540.835) (-543.430) [-543.280] * [-542.521] (-546.962) (-544.321) (-540.873) -- 0:00:10
827000 -- [-540.767] (-540.889) (-543.053) (-541.318) * (-541.561) [-542.692] (-541.881) (-541.944) -- 0:00:10
827500 -- (-544.052) (-544.474) (-541.896) [-541.424] * (-543.961) (-541.279) (-542.332) [-540.722] -- 0:00:10
828000 -- [-544.602] (-541.675) (-541.357) (-542.356) * (-542.237) (-545.100) [-546.438] (-541.584) -- 0:00:09
828500 -- (-544.653) [-542.676] (-543.324) (-543.025) * (-540.916) (-545.298) (-547.670) [-541.200] -- 0:00:09
829000 -- (-544.666) [-541.951] (-542.056) (-541.208) * (-546.381) [-541.367] (-545.399) (-542.896) -- 0:00:09
829500 -- (-540.215) (-541.009) (-542.847) [-544.109] * (-545.748) [-541.213] (-541.715) (-542.880) -- 0:00:09
830000 -- (-542.113) [-542.117] (-544.461) (-543.316) * (-543.293) (-541.387) (-542.228) [-542.166] -- 0:00:09
Average standard deviation of split frequencies: 0.010144
830500 -- (-542.548) (-541.130) (-543.933) [-542.351] * (-544.300) (-543.448) [-544.967] (-543.904) -- 0:00:09
831000 -- (-545.935) (-541.177) [-541.807] (-541.693) * [-541.951] (-543.097) (-545.999) (-544.842) -- 0:00:09
831500 -- [-546.685] (-541.913) (-542.045) (-541.135) * (-549.770) (-545.845) (-545.336) [-543.710] -- 0:00:09
832000 -- (-544.022) [-542.112] (-541.472) (-542.903) * (-544.366) [-545.052] (-541.331) (-544.375) -- 0:00:09
832500 -- (-543.441) (-547.567) [-546.136] (-542.764) * (-544.167) (-543.919) (-540.929) [-541.788] -- 0:00:09
833000 -- [-546.628] (-544.749) (-548.978) (-542.259) * (-540.514) (-541.617) [-542.699] (-541.706) -- 0:00:09
833500 -- (-543.792) [-542.423] (-543.120) (-544.852) * [-544.076] (-541.567) (-547.535) (-542.538) -- 0:00:09
834000 -- [-542.112] (-541.463) (-542.464) (-544.794) * (-541.307) (-540.980) (-541.560) [-542.352] -- 0:00:09
834500 -- [-543.044] (-544.901) (-540.858) (-542.839) * [-541.465] (-543.087) (-541.571) (-545.961) -- 0:00:09
835000 -- (-542.254) (-544.743) (-543.184) [-542.377] * (-542.930) (-543.687) [-543.033] (-545.163) -- 0:00:09
Average standard deviation of split frequencies: 0.009974
835500 -- (-542.388) (-542.219) (-541.768) [-541.302] * (-540.587) (-542.853) [-541.103] (-541.892) -- 0:00:09
836000 -- (-545.194) (-543.304) (-542.933) [-542.809] * (-540.522) [-541.271] (-543.540) (-542.023) -- 0:00:09
836500 -- (-541.940) (-544.002) [-543.901] (-541.675) * [-545.206] (-544.466) (-546.193) (-542.153) -- 0:00:09
837000 -- (-543.563) (-542.208) [-541.813] (-544.278) * [-541.336] (-545.777) (-544.078) (-542.704) -- 0:00:09
837500 -- (-543.549) (-542.252) (-541.959) [-541.991] * [-541.699] (-540.454) (-544.435) (-544.145) -- 0:00:09
838000 -- (-542.617) (-542.129) [-541.030] (-544.220) * (-542.184) (-542.456) [-548.774] (-544.584) -- 0:00:09
838500 -- (-544.471) (-542.443) (-541.374) [-543.901] * (-546.684) (-542.062) [-543.706] (-543.816) -- 0:00:09
839000 -- (-546.264) [-542.254] (-541.290) (-542.479) * [-543.036] (-545.409) (-541.906) (-544.298) -- 0:00:09
839500 -- (-542.195) (-543.046) [-541.767] (-543.571) * [-540.797] (-542.355) (-540.925) (-543.763) -- 0:00:09
840000 -- (-542.171) (-541.512) [-545.075] (-542.957) * (-541.199) (-543.406) [-541.520] (-543.537) -- 0:00:09
Average standard deviation of split frequencies: 0.009568
840500 -- (-541.555) [-541.768] (-545.719) (-544.330) * (-541.584) (-542.037) (-541.834) [-543.869] -- 0:00:09
841000 -- (-543.437) (-543.068) [-542.206] (-541.346) * (-541.129) (-541.476) [-542.624] (-542.304) -- 0:00:09
841500 -- (-541.412) (-543.086) [-542.439] (-540.505) * (-543.228) (-541.217) [-545.446] (-541.703) -- 0:00:09
842000 -- (-541.003) [-541.768] (-541.485) (-540.988) * (-543.253) (-541.918) [-542.787] (-542.881) -- 0:00:09
842500 -- (-543.078) [-541.784] (-541.608) (-541.903) * [-541.398] (-541.839) (-542.591) (-541.182) -- 0:00:09
843000 -- (-542.489) (-542.710) [-540.930] (-548.561) * [-542.032] (-543.605) (-541.749) (-541.464) -- 0:00:09
843500 -- (-542.908) [-542.079] (-540.515) (-546.018) * (-542.994) (-541.030) (-548.222) [-541.239] -- 0:00:09
844000 -- (-542.630) (-544.869) (-540.896) [-541.953] * (-543.432) (-540.755) [-544.167] (-541.240) -- 0:00:09
844500 -- (-542.092) (-543.812) [-546.041] (-544.805) * [-542.428] (-540.742) (-545.797) (-542.077) -- 0:00:09
845000 -- (-544.579) (-544.101) (-542.307) [-542.456] * (-545.936) (-540.745) [-542.608] (-543.156) -- 0:00:08
Average standard deviation of split frequencies: 0.010030
845500 -- [-544.889] (-547.496) (-542.833) (-541.832) * [-542.954] (-541.603) (-544.434) (-543.504) -- 0:00:08
846000 -- (-542.792) (-543.790) (-544.116) [-540.945] * (-547.543) [-542.301] (-544.763) (-544.654) -- 0:00:08
846500 -- (-545.711) (-543.392) [-545.058] (-543.168) * (-540.837) [-541.926] (-542.618) (-543.547) -- 0:00:08
847000 -- (-540.690) (-543.553) [-543.963] (-540.915) * (-543.320) [-542.336] (-541.988) (-543.095) -- 0:00:08
847500 -- (-540.339) [-541.424] (-544.203) (-541.502) * (-543.280) [-545.013] (-545.617) (-542.166) -- 0:00:08
848000 -- (-540.425) [-541.527] (-541.426) (-540.996) * [-544.447] (-542.475) (-544.644) (-544.683) -- 0:00:08
848500 -- (-542.080) (-541.501) [-546.084] (-541.524) * [-545.740] (-543.353) (-544.993) (-547.034) -- 0:00:08
849000 -- (-543.253) [-541.718] (-542.183) (-545.716) * (-541.515) [-545.344] (-543.998) (-544.113) -- 0:00:08
849500 -- (-541.256) (-543.905) (-542.482) [-541.942] * [-542.594] (-543.934) (-545.758) (-542.564) -- 0:00:08
850000 -- (-544.153) [-541.943] (-542.252) (-541.253) * [-541.600] (-546.798) (-542.420) (-545.479) -- 0:00:08
Average standard deviation of split frequencies: 0.010079
850500 -- (-543.586) [-543.525] (-544.703) (-552.288) * [-540.833] (-543.017) (-540.392) (-541.621) -- 0:00:08
851000 -- (-546.385) [-544.853] (-542.398) (-542.516) * (-541.587) [-545.354] (-541.188) (-543.358) -- 0:00:08
851500 -- (-545.348) (-541.942) [-545.776] (-541.208) * (-545.375) (-542.443) [-541.083] (-542.461) -- 0:00:08
852000 -- (-544.591) [-542.982] (-543.483) (-545.968) * (-541.078) (-542.913) (-542.075) [-543.578] -- 0:00:08
852500 -- (-547.440) [-541.639] (-541.897) (-543.296) * [-540.998] (-548.048) (-543.219) (-544.815) -- 0:00:08
853000 -- (-542.931) [-542.532] (-541.872) (-543.839) * [-541.571] (-543.302) (-544.227) (-542.764) -- 0:00:08
853500 -- (-544.119) [-542.849] (-542.375) (-543.706) * (-543.055) (-541.878) (-543.014) [-542.928] -- 0:00:08
854000 -- (-543.888) (-546.050) [-543.579] (-541.177) * (-542.352) (-542.838) (-542.946) [-541.216] -- 0:00:08
854500 -- (-542.456) (-541.859) (-544.508) [-545.263] * (-544.951) [-542.066] (-544.811) (-545.174) -- 0:00:08
855000 -- [-542.922] (-541.521) (-542.481) (-541.624) * (-543.390) (-541.071) [-543.067] (-543.720) -- 0:00:08
Average standard deviation of split frequencies: 0.010154
855500 -- (-543.910) (-541.595) [-543.455] (-545.492) * (-540.711) (-547.428) [-544.091] (-542.912) -- 0:00:08
856000 -- [-542.429] (-541.986) (-541.273) (-546.063) * (-542.360) (-547.650) (-541.053) [-545.772] -- 0:00:08
856500 -- (-541.666) [-541.267] (-541.723) (-543.246) * (-544.479) (-542.542) (-542.476) [-541.367] -- 0:00:08
857000 -- (-540.958) (-542.909) (-541.303) [-542.299] * [-542.374] (-545.156) (-542.450) (-540.765) -- 0:00:08
857500 -- (-540.942) (-546.069) [-545.612] (-543.398) * (-545.672) (-543.783) (-541.198) [-540.233] -- 0:00:08
858000 -- (-541.894) (-542.207) [-542.715] (-545.095) * (-541.106) (-543.314) [-541.681] (-542.059) -- 0:00:08
858500 -- [-543.784] (-541.654) (-543.641) (-541.259) * (-540.709) (-542.179) [-541.265] (-543.675) -- 0:00:08
859000 -- (-542.172) [-541.583] (-543.118) (-542.729) * [-540.629] (-541.653) (-544.528) (-545.456) -- 0:00:08
859500 -- (-541.865) (-541.835) [-543.104] (-541.943) * (-555.352) (-541.503) [-541.975] (-546.451) -- 0:00:08
860000 -- (-542.441) [-543.898] (-542.382) (-540.520) * (-542.075) (-540.417) (-541.163) [-541.763] -- 0:00:08
Average standard deviation of split frequencies: 0.010030
860500 -- (-542.632) [-541.965] (-542.598) (-540.534) * (-544.881) (-542.320) (-541.838) [-543.423] -- 0:00:08
861000 -- (-542.263) (-543.282) (-541.917) [-540.543] * [-542.080] (-541.448) (-544.738) (-542.207) -- 0:00:08
861500 -- (-543.591) (-541.771) [-542.696] (-544.197) * (-545.066) [-543.753] (-542.491) (-541.999) -- 0:00:08
862000 -- (-544.872) (-541.175) [-543.902] (-543.582) * (-543.110) (-540.868) (-542.337) [-543.547] -- 0:00:08
862500 -- (-541.593) (-541.900) [-541.360] (-545.748) * (-546.054) [-540.432] (-541.756) (-549.474) -- 0:00:07
863000 -- [-542.964] (-542.818) (-544.047) (-544.423) * (-542.047) (-540.915) [-540.599] (-543.274) -- 0:00:07
863500 -- (-545.682) (-546.885) [-547.393] (-542.342) * (-543.242) (-544.249) [-543.483] (-543.235) -- 0:00:07
864000 -- (-543.099) (-542.586) (-548.372) [-541.315] * (-544.416) (-547.262) [-545.321] (-541.600) -- 0:00:07
864500 -- [-540.872] (-542.748) (-544.833) (-541.862) * (-544.385) [-543.799] (-543.308) (-542.646) -- 0:00:07
865000 -- [-543.628] (-543.161) (-540.778) (-541.854) * (-541.789) (-543.085) (-542.994) [-544.613] -- 0:00:07
Average standard deviation of split frequencies: 0.009798
865500 -- [-544.293] (-545.150) (-540.779) (-541.701) * (-546.675) (-541.577) (-545.084) [-542.970] -- 0:00:07
866000 -- (-541.996) (-541.881) (-544.095) [-541.559] * (-543.907) (-542.995) [-547.297] (-544.045) -- 0:00:07
866500 -- (-542.474) [-541.517] (-542.077) (-544.083) * (-543.076) (-541.733) (-545.323) [-540.361] -- 0:00:07
867000 -- (-543.871) [-543.691] (-540.965) (-545.345) * (-541.786) (-542.586) (-540.473) [-541.947] -- 0:00:07
867500 -- (-542.923) (-545.151) [-540.762] (-542.577) * (-541.910) [-541.623] (-542.469) (-543.940) -- 0:00:07
868000 -- (-542.633) (-544.733) [-543.656] (-544.615) * (-544.305) (-542.406) [-543.332] (-546.566) -- 0:00:07
868500 -- (-542.377) (-541.797) [-541.868] (-544.215) * [-543.788] (-547.089) (-542.784) (-542.259) -- 0:00:07
869000 -- (-544.413) (-544.804) [-542.337] (-542.463) * (-542.859) (-544.341) [-542.180] (-542.968) -- 0:00:07
869500 -- (-546.782) (-544.038) [-540.816] (-542.221) * (-541.008) [-542.068] (-542.586) (-542.686) -- 0:00:07
870000 -- [-542.047] (-540.582) (-543.140) (-542.313) * (-545.399) (-544.839) [-543.558] (-549.925) -- 0:00:07
Average standard deviation of split frequencies: 0.010152
870500 -- (-544.193) [-542.843] (-542.432) (-543.905) * (-545.903) (-542.852) (-542.254) [-541.956] -- 0:00:07
871000 -- (-543.678) [-541.071] (-545.179) (-540.765) * (-540.808) (-540.844) (-541.998) [-542.411] -- 0:00:07
871500 -- (-543.890) (-542.390) (-541.289) [-540.939] * (-540.886) (-542.001) (-542.010) [-542.996] -- 0:00:07
872000 -- (-541.758) (-543.015) [-541.606] (-543.446) * (-545.979) (-541.278) [-544.766] (-540.796) -- 0:00:07
872500 -- (-542.075) (-541.926) (-541.968) [-543.950] * [-544.473] (-540.809) (-545.262) (-542.547) -- 0:00:07
873000 -- (-542.812) [-541.387] (-541.580) (-546.323) * [-544.751] (-545.252) (-543.979) (-542.914) -- 0:00:07
873500 -- (-543.130) [-542.268] (-543.523) (-547.223) * (-543.990) (-543.788) [-543.258] (-540.381) -- 0:00:07
874000 -- (-543.330) (-541.561) [-543.898] (-546.236) * (-543.277) [-541.141] (-542.243) (-542.473) -- 0:00:07
874500 -- (-543.886) (-541.231) (-544.151) [-542.545] * (-543.514) (-541.654) (-543.927) [-542.724] -- 0:00:07
875000 -- [-541.034] (-543.432) (-541.781) (-548.112) * (-541.696) [-542.850] (-544.469) (-541.299) -- 0:00:07
Average standard deviation of split frequencies: 0.009855
875500 -- [-541.539] (-541.522) (-543.679) (-541.698) * (-542.107) [-543.355] (-543.889) (-542.088) -- 0:00:07
876000 -- [-540.623] (-543.633) (-540.581) (-548.399) * [-542.342] (-545.570) (-546.099) (-541.132) -- 0:00:07
876500 -- (-542.488) [-540.736] (-540.897) (-542.396) * [-543.045] (-542.733) (-541.718) (-541.043) -- 0:00:07
877000 -- (-543.642) (-543.930) [-541.244] (-542.273) * (-545.514) (-545.697) [-540.829] (-543.274) -- 0:00:07
877500 -- [-542.864] (-543.909) (-541.212) (-542.477) * (-541.572) [-541.093] (-542.159) (-540.741) -- 0:00:07
878000 -- (-542.006) (-542.053) [-542.589] (-554.471) * (-547.168) (-540.930) (-544.057) [-543.375] -- 0:00:07
878500 -- (-543.786) [-544.554] (-546.506) (-543.806) * (-545.265) (-542.483) (-540.924) [-541.958] -- 0:00:07
879000 -- (-542.426) (-549.086) (-542.358) [-542.335] * [-542.558] (-544.106) (-541.784) (-540.987) -- 0:00:07
879500 -- (-542.441) [-540.836] (-541.229) (-542.124) * [-540.534] (-540.830) (-542.410) (-541.018) -- 0:00:06
880000 -- (-543.120) (-543.802) [-542.284] (-541.973) * (-541.394) [-543.189] (-541.864) (-545.612) -- 0:00:06
Average standard deviation of split frequencies: 0.010037
880500 -- (-542.477) (-545.363) (-544.312) [-543.066] * (-541.731) (-543.865) [-542.403] (-544.521) -- 0:00:06
881000 -- (-542.015) [-542.576] (-543.468) (-543.871) * [-541.941] (-541.754) (-543.567) (-550.398) -- 0:00:06
881500 -- [-542.406] (-544.189) (-544.733) (-543.310) * (-542.327) (-541.805) [-543.582] (-544.505) -- 0:00:06
882000 -- (-540.795) [-542.100] (-544.917) (-542.719) * (-542.534) [-544.791] (-544.325) (-543.848) -- 0:00:06
882500 -- (-543.009) (-542.774) (-541.512) [-541.804] * (-546.559) (-542.523) (-541.233) [-543.545] -- 0:00:06
883000 -- (-541.173) (-541.103) [-541.556] (-543.215) * [-542.034] (-541.247) (-546.412) (-541.977) -- 0:00:06
883500 -- (-542.940) [-542.130] (-540.490) (-541.690) * [-542.620] (-544.041) (-543.277) (-544.206) -- 0:00:06
884000 -- [-542.200] (-540.824) (-542.969) (-550.460) * (-543.272) [-541.625] (-542.639) (-542.276) -- 0:00:06
884500 -- (-544.499) (-541.338) [-544.090] (-547.779) * [-541.397] (-544.649) (-543.012) (-542.048) -- 0:00:06
885000 -- [-545.585] (-541.282) (-541.994) (-543.647) * (-540.484) (-541.365) [-540.454] (-542.433) -- 0:00:06
Average standard deviation of split frequencies: 0.010342
885500 -- (-544.008) [-542.283] (-540.985) (-542.173) * (-541.405) [-541.882] (-542.507) (-542.841) -- 0:00:06
886000 -- [-541.007] (-543.617) (-541.197) (-544.479) * (-544.184) [-541.064] (-545.884) (-546.319) -- 0:00:06
886500 -- (-544.118) (-543.596) [-543.554] (-547.255) * (-543.912) [-543.531] (-541.489) (-544.735) -- 0:00:06
887000 -- (-542.390) [-541.724] (-540.974) (-547.153) * (-543.582) [-545.013] (-547.668) (-542.922) -- 0:00:06
887500 -- (-542.092) (-542.068) [-541.117] (-544.144) * [-541.345] (-542.685) (-544.661) (-545.322) -- 0:00:06
888000 -- (-542.584) [-540.873] (-541.598) (-542.839) * [-542.206] (-541.013) (-542.231) (-544.014) -- 0:00:06
888500 -- (-545.077) [-540.873] (-541.114) (-542.829) * (-541.072) [-540.982] (-540.484) (-541.262) -- 0:00:06
889000 -- [-545.473] (-543.271) (-542.873) (-542.211) * [-541.397] (-542.784) (-540.612) (-543.752) -- 0:00:06
889500 -- (-545.333) (-542.567) (-540.553) [-542.727] * (-544.224) (-543.413) [-544.596] (-545.195) -- 0:00:06
890000 -- (-542.727) (-543.112) [-541.195] (-540.623) * (-547.242) [-547.278] (-541.949) (-545.988) -- 0:00:06
Average standard deviation of split frequencies: 0.009792
890500 -- (-541.520) (-542.715) [-542.230] (-542.621) * (-542.849) (-541.123) (-540.423) [-541.614] -- 0:00:06
891000 -- (-541.623) (-541.811) [-542.140] (-541.709) * (-541.273) (-542.737) [-541.574] (-542.326) -- 0:00:06
891500 -- (-543.658) (-540.729) [-542.392] (-542.811) * (-544.717) [-544.536] (-541.396) (-541.767) -- 0:00:06
892000 -- (-542.231) (-541.284) [-541.802] (-542.599) * (-544.102) [-545.318] (-547.998) (-542.189) -- 0:00:06
892500 -- [-541.346] (-544.204) (-542.890) (-541.341) * (-541.853) [-542.414] (-546.798) (-544.615) -- 0:00:06
893000 -- [-541.384] (-541.749) (-544.531) (-543.205) * (-545.299) (-540.905) [-543.392] (-545.221) -- 0:00:06
893500 -- (-543.932) (-541.945) (-541.884) [-541.281] * (-544.432) [-541.097] (-543.740) (-542.645) -- 0:00:06
894000 -- (-544.155) (-545.972) (-543.101) [-540.602] * (-543.282) [-542.917] (-540.746) (-546.586) -- 0:00:06
894500 -- (-542.225) [-541.958] (-543.349) (-541.723) * (-543.547) [-541.619] (-542.104) (-541.202) -- 0:00:06
895000 -- (-543.506) (-542.124) (-542.014) [-540.294] * (-542.302) [-541.782] (-543.077) (-542.669) -- 0:00:06
Average standard deviation of split frequencies: 0.009635
895500 -- (-542.115) [-540.528] (-546.157) (-541.728) * [-541.699] (-543.825) (-542.634) (-543.709) -- 0:00:06
896000 -- (-544.929) (-541.407) [-543.278] (-541.032) * (-541.968) (-543.457) [-541.970] (-545.420) -- 0:00:06
896500 -- (-543.520) (-542.074) (-546.075) [-543.186] * (-541.488) (-541.533) [-541.280] (-543.274) -- 0:00:06
897000 -- (-541.293) [-542.565] (-540.986) (-545.584) * (-541.800) (-542.087) [-541.098] (-548.365) -- 0:00:05
897500 -- [-543.976] (-541.016) (-542.884) (-545.935) * [-542.252] (-541.289) (-546.089) (-541.955) -- 0:00:05
898000 -- [-541.375] (-541.699) (-540.992) (-545.867) * (-541.991) (-540.956) [-543.986] (-542.549) -- 0:00:05
898500 -- [-540.288] (-545.687) (-546.486) (-549.071) * (-543.673) (-541.599) (-542.548) [-541.657] -- 0:00:05
899000 -- (-542.009) [-541.926] (-541.244) (-546.508) * (-546.436) (-546.164) [-545.053] (-540.690) -- 0:00:05
899500 -- [-543.791] (-542.140) (-541.085) (-544.415) * (-543.282) (-549.407) (-544.991) [-540.794] -- 0:00:05
900000 -- [-541.694] (-540.800) (-541.521) (-544.303) * [-542.353] (-543.230) (-542.755) (-542.933) -- 0:00:05
Average standard deviation of split frequencies: 0.009650
900500 -- (-545.608) (-540.367) [-542.433] (-549.349) * (-547.306) [-545.597] (-542.235) (-543.300) -- 0:00:05
901000 -- (-541.210) [-545.155] (-542.192) (-546.530) * (-543.239) (-543.772) [-542.055] (-542.272) -- 0:00:05
901500 -- (-543.193) (-540.833) [-544.438] (-542.713) * (-541.432) (-542.679) [-540.529] (-540.669) -- 0:00:05
902000 -- [-542.803] (-541.351) (-542.489) (-541.687) * (-541.070) [-541.081] (-542.781) (-541.613) -- 0:00:05
902500 -- (-542.448) (-545.332) (-542.641) [-541.158] * [-540.655] (-551.987) (-541.923) (-542.745) -- 0:00:05
903000 -- (-543.013) (-541.967) (-544.137) [-543.669] * [-541.064] (-540.845) (-545.741) (-543.260) -- 0:00:05
903500 -- (-543.527) (-540.665) (-542.834) [-544.458] * (-542.812) (-541.177) [-544.159] (-541.690) -- 0:00:05
904000 -- (-541.218) (-542.939) [-541.476] (-544.652) * [-541.416] (-541.391) (-540.719) (-540.592) -- 0:00:05
904500 -- [-541.991] (-540.816) (-541.570) (-543.175) * [-542.725] (-541.598) (-544.193) (-542.590) -- 0:00:05
905000 -- [-541.920] (-540.778) (-541.670) (-541.067) * [-543.602] (-541.261) (-544.740) (-543.079) -- 0:00:05
Average standard deviation of split frequencies: 0.009528
905500 -- (-542.364) [-540.988] (-540.922) (-541.038) * (-541.692) [-541.204] (-543.924) (-545.024) -- 0:00:05
906000 -- (-545.358) (-541.676) (-543.628) [-542.334] * (-550.591) (-540.477) [-545.658] (-543.264) -- 0:00:05
906500 -- (-545.027) (-543.059) (-545.628) [-543.130] * (-545.799) (-540.910) [-542.703] (-542.223) -- 0:00:05
907000 -- (-545.840) (-542.452) [-547.945] (-544.607) * (-542.953) (-542.124) [-543.033] (-547.256) -- 0:00:05
907500 -- (-542.368) (-545.623) [-547.131] (-545.412) * [-541.002] (-542.122) (-543.451) (-545.410) -- 0:00:05
908000 -- [-542.521] (-544.135) (-544.014) (-544.300) * (-543.283) (-543.064) [-541.656] (-544.612) -- 0:00:05
908500 -- [-542.218] (-543.256) (-543.769) (-543.931) * (-543.042) (-542.487) [-541.093] (-540.530) -- 0:00:05
909000 -- (-544.411) (-542.564) (-541.189) [-544.792] * (-543.333) [-542.129] (-540.408) (-542.311) -- 0:00:05
909500 -- [-542.904] (-541.900) (-541.847) (-541.682) * (-543.105) (-544.001) (-540.631) [-544.109] -- 0:00:05
910000 -- (-540.779) (-541.037) (-542.246) [-541.285] * (-545.793) [-543.357] (-541.751) (-543.569) -- 0:00:05
Average standard deviation of split frequencies: 0.009447
910500 -- (-541.575) [-542.065] (-542.678) (-542.346) * (-540.708) (-546.819) (-544.929) [-543.457] -- 0:00:05
911000 -- (-541.390) (-544.772) [-542.269] (-541.505) * [-541.446] (-548.967) (-544.040) (-542.121) -- 0:00:05
911500 -- [-542.043] (-541.716) (-543.520) (-541.536) * (-545.531) (-548.597) [-541.689] (-547.839) -- 0:00:05
912000 -- (-544.915) [-541.730] (-541.786) (-541.333) * [-542.473] (-543.929) (-543.544) (-542.567) -- 0:00:05
912500 -- (-542.449) [-541.497] (-542.632) (-543.099) * (-544.179) [-541.701] (-542.753) (-542.783) -- 0:00:05
913000 -- (-542.000) (-542.013) (-547.002) [-541.368] * (-543.377) (-544.204) [-541.960] (-543.172) -- 0:00:05
913500 -- [-540.974] (-542.855) (-543.076) (-541.723) * [-545.488] (-541.799) (-543.767) (-542.058) -- 0:00:05
914000 -- (-541.283) (-541.572) (-544.669) [-541.663] * (-541.819) (-544.416) [-540.284] (-544.919) -- 0:00:04
914500 -- (-545.118) [-541.904] (-545.270) (-540.625) * (-543.741) (-540.375) (-546.886) [-541.696] -- 0:00:04
915000 -- (-547.085) (-540.997) (-542.722) [-542.641] * (-543.530) [-541.202] (-541.579) (-541.295) -- 0:00:04
Average standard deviation of split frequencies: 0.009875
915500 -- (-541.455) [-541.528] (-541.739) (-543.306) * [-542.655] (-541.646) (-546.158) (-541.932) -- 0:00:04
916000 -- [-542.499] (-541.826) (-543.371) (-549.044) * (-543.880) [-541.313] (-548.800) (-541.515) -- 0:00:04
916500 -- (-542.500) (-540.679) [-541.727] (-542.345) * [-541.806] (-542.366) (-545.118) (-542.434) -- 0:00:04
917000 -- (-543.915) (-542.905) (-542.232) [-540.437] * (-542.133) (-541.572) [-546.806] (-544.906) -- 0:00:04
917500 -- (-543.525) (-543.057) (-541.804) [-541.905] * [-543.451] (-544.160) (-540.827) (-541.360) -- 0:00:04
918000 -- (-542.178) (-542.511) (-542.417) [-540.518] * (-545.315) (-544.141) (-542.847) [-541.944] -- 0:00:04
918500 -- (-541.927) (-543.039) [-542.727] (-545.861) * [-543.737] (-544.410) (-543.987) (-543.499) -- 0:00:04
919000 -- (-540.459) (-542.516) (-541.122) [-541.710] * (-547.275) (-542.447) [-544.042] (-541.424) -- 0:00:04
919500 -- (-542.509) (-540.707) [-541.337] (-543.831) * (-542.590) (-542.129) (-545.986) [-541.066] -- 0:00:04
920000 -- (-545.166) (-541.148) [-544.346] (-541.360) * (-541.754) (-541.398) (-541.261) [-542.441] -- 0:00:04
Average standard deviation of split frequencies: 0.009824
920500 -- (-540.785) [-542.219] (-544.545) (-545.667) * [-542.767] (-541.149) (-542.303) (-543.151) -- 0:00:04
921000 -- [-544.483] (-542.211) (-543.825) (-542.738) * (-540.926) [-540.810] (-542.570) (-543.634) -- 0:00:04
921500 -- (-543.480) (-540.393) [-541.044] (-543.639) * (-547.380) (-546.944) [-540.606] (-542.562) -- 0:00:04
922000 -- (-543.301) (-541.440) [-540.993] (-542.835) * [-547.819] (-546.044) (-542.119) (-542.138) -- 0:00:04
922500 -- (-543.436) [-542.095] (-544.575) (-545.444) * (-540.494) (-544.169) [-541.573] (-541.374) -- 0:00:04
923000 -- (-547.743) [-542.310] (-540.573) (-545.046) * [-541.808] (-540.455) (-543.977) (-545.928) -- 0:00:04
923500 -- (-552.134) (-543.434) [-541.919] (-543.518) * (-541.770) (-546.804) (-540.765) [-544.816] -- 0:00:04
924000 -- [-547.487] (-543.859) (-541.943) (-541.740) * (-542.893) (-544.454) (-546.118) [-541.700] -- 0:00:04
924500 -- (-544.100) (-542.463) (-544.704) [-544.618] * (-542.353) (-543.436) [-541.192] (-541.674) -- 0:00:04
925000 -- (-543.435) (-543.759) (-542.320) [-540.985] * (-542.274) [-544.057] (-541.779) (-544.488) -- 0:00:04
Average standard deviation of split frequencies: 0.009641
925500 -- (-541.768) [-543.778] (-541.403) (-542.207) * [-543.132] (-543.031) (-542.184) (-540.873) -- 0:00:04
926000 -- [-541.168] (-540.981) (-541.969) (-542.022) * (-542.697) [-541.987] (-544.567) (-541.142) -- 0:00:04
926500 -- [-543.585] (-540.938) (-543.454) (-541.570) * (-542.248) (-541.918) (-543.496) [-541.895] -- 0:00:04
927000 -- (-545.540) [-542.119] (-543.816) (-544.637) * [-543.834] (-543.735) (-541.529) (-541.291) -- 0:00:04
927500 -- (-544.141) (-540.966) [-542.313] (-541.726) * (-542.336) (-545.512) (-540.944) [-543.581] -- 0:00:04
928000 -- (-542.952) [-540.345] (-545.157) (-543.063) * (-542.425) (-542.089) [-542.497] (-542.778) -- 0:00:04
928500 -- (-543.306) [-540.696] (-541.848) (-541.189) * [-540.851] (-541.281) (-540.684) (-540.948) -- 0:00:04
929000 -- (-541.470) [-541.680] (-546.355) (-541.902) * [-540.351] (-541.881) (-542.085) (-541.935) -- 0:00:04
929500 -- (-545.244) [-541.882] (-543.542) (-541.439) * (-541.278) [-542.653] (-544.736) (-543.033) -- 0:00:04
930000 -- (-542.766) [-540.581] (-547.297) (-541.015) * (-543.819) (-545.586) (-540.438) [-540.927] -- 0:00:04
Average standard deviation of split frequencies: 0.009592
930500 -- (-547.587) (-542.251) (-543.368) [-541.642] * (-542.800) (-543.812) (-545.580) [-543.431] -- 0:00:04
931000 -- (-545.018) (-542.410) (-542.472) [-541.492] * (-541.155) [-544.758] (-542.977) (-540.701) -- 0:00:04
931500 -- (-546.813) (-543.381) (-545.204) [-542.283] * [-542.324] (-545.711) (-542.200) (-544.406) -- 0:00:03
932000 -- (-548.480) (-543.355) (-544.112) [-543.200] * (-542.265) (-543.827) (-543.440) [-540.591] -- 0:00:03
932500 -- (-547.078) [-542.233] (-544.829) (-543.202) * [-543.700] (-540.836) (-542.164) (-542.551) -- 0:00:03
933000 -- (-543.864) (-542.540) (-542.275) [-542.637] * (-541.500) (-544.326) [-541.888] (-544.536) -- 0:00:03
933500 -- (-542.274) (-541.095) (-544.221) [-543.761] * (-546.238) [-540.908] (-541.725) (-548.042) -- 0:00:03
934000 -- [-544.760] (-540.766) (-546.387) (-543.577) * (-541.461) (-540.847) [-540.796] (-543.765) -- 0:00:03
934500 -- (-540.923) [-541.282] (-541.882) (-544.561) * [-541.161] (-542.129) (-542.774) (-541.661) -- 0:00:03
935000 -- (-544.085) (-541.372) (-545.632) [-544.270] * [-541.210] (-541.688) (-543.394) (-541.726) -- 0:00:03
Average standard deviation of split frequencies: 0.008877
935500 -- (-540.820) (-541.363) (-545.385) [-542.410] * (-541.035) [-543.354] (-541.471) (-542.234) -- 0:00:03
936000 -- (-540.633) (-541.886) (-542.291) [-541.068] * (-540.826) (-541.099) (-541.149) [-541.994] -- 0:00:03
936500 -- (-541.670) [-541.641] (-542.397) (-542.576) * [-541.040] (-543.820) (-542.776) (-541.917) -- 0:00:03
937000 -- (-541.498) (-546.165) (-544.661) [-542.946] * (-541.691) (-547.139) [-548.860] (-543.637) -- 0:00:03
937500 -- (-541.310) (-542.236) (-541.660) [-541.417] * (-541.738) (-546.033) (-542.801) [-546.279] -- 0:00:03
938000 -- (-541.229) [-543.082] (-541.637) (-543.145) * (-543.214) [-545.767] (-541.983) (-542.739) -- 0:00:03
938500 -- (-541.953) (-547.537) [-541.653] (-544.369) * (-545.257) (-540.896) [-542.913] (-546.534) -- 0:00:03
939000 -- (-541.270) [-542.799] (-540.867) (-544.599) * (-544.729) [-541.362] (-543.345) (-548.254) -- 0:00:03
939500 -- [-540.576] (-541.656) (-544.460) (-542.078) * (-541.273) [-541.103] (-543.987) (-544.028) -- 0:00:03
940000 -- (-543.282) (-540.922) [-541.647] (-540.347) * (-543.148) (-540.707) (-541.927) [-540.988] -- 0:00:03
Average standard deviation of split frequencies: 0.008958
940500 -- (-542.275) [-541.886] (-541.456) (-545.636) * (-547.824) (-544.589) [-542.500] (-544.857) -- 0:00:03
941000 -- (-541.176) (-543.813) (-542.989) [-544.310] * (-545.189) (-543.657) [-542.348] (-542.595) -- 0:00:03
941500 -- (-541.622) (-543.051) [-542.300] (-543.795) * (-542.574) (-541.848) [-541.647] (-540.264) -- 0:00:03
942000 -- (-542.811) (-544.747) (-541.427) [-541.565] * [-541.508] (-541.661) (-541.559) (-541.029) -- 0:00:03
942500 -- (-541.509) (-544.824) (-541.750) [-541.954] * (-543.628) (-542.841) (-541.962) [-541.318] -- 0:00:03
943000 -- (-543.335) [-545.030] (-541.067) (-544.074) * [-540.627] (-543.902) (-541.916) (-547.878) -- 0:00:03
943500 -- (-541.821) (-543.611) [-540.941] (-543.069) * [-540.758] (-543.807) (-541.654) (-543.370) -- 0:00:03
944000 -- (-542.753) [-544.551] (-541.149) (-544.174) * (-542.382) (-541.672) (-541.787) [-541.937] -- 0:00:03
944500 -- [-547.225] (-542.610) (-542.946) (-541.503) * (-541.464) (-541.142) [-540.760] (-544.400) -- 0:00:03
945000 -- (-541.116) (-542.107) (-541.391) [-541.237] * (-540.785) (-543.684) (-542.195) [-540.959] -- 0:00:03
Average standard deviation of split frequencies: 0.008814
945500 -- (-548.031) (-540.589) (-542.009) [-541.497] * (-541.928) (-544.611) [-542.161] (-540.994) -- 0:00:03
946000 -- (-542.915) (-541.701) [-546.799] (-544.635) * (-544.124) (-541.124) (-545.334) [-541.172] -- 0:00:03
946500 -- (-543.602) (-543.961) [-542.095] (-544.998) * (-543.569) (-542.427) (-541.192) [-541.331] -- 0:00:03
947000 -- (-544.232) (-541.100) [-541.090] (-541.169) * (-541.908) [-542.205] (-544.006) (-542.232) -- 0:00:03
947500 -- (-544.574) [-541.263] (-542.596) (-543.092) * (-545.274) (-543.386) (-543.519) [-542.513] -- 0:00:03
948000 -- (-542.590) [-541.225] (-542.069) (-547.827) * (-543.852) (-544.982) [-541.073] (-541.657) -- 0:00:03
948500 -- (-540.896) [-541.553] (-541.395) (-545.983) * [-541.723] (-543.272) (-541.050) (-543.513) -- 0:00:02
949000 -- (-540.836) (-542.785) [-541.833] (-542.672) * [-544.152] (-542.348) (-547.924) (-540.805) -- 0:00:02
949500 -- (-541.784) [-542.506] (-541.466) (-549.570) * (-541.670) [-542.060] (-544.220) (-543.562) -- 0:00:02
950000 -- (-541.449) [-544.295] (-540.424) (-547.251) * [-542.711] (-544.803) (-541.914) (-543.725) -- 0:00:02
Average standard deviation of split frequencies: 0.008771
950500 -- (-543.149) [-543.902] (-541.543) (-543.297) * (-541.411) (-551.525) (-544.460) [-542.839] -- 0:00:02
951000 -- (-542.574) [-541.540] (-541.880) (-543.758) * [-542.109] (-544.631) (-542.143) (-543.208) -- 0:00:02
951500 -- [-541.350] (-545.083) (-545.614) (-542.782) * [-542.135] (-541.708) (-542.847) (-542.644) -- 0:00:02
952000 -- (-540.401) [-540.952] (-547.095) (-545.433) * (-544.219) [-545.670] (-543.044) (-547.001) -- 0:00:02
952500 -- (-541.833) [-541.292] (-547.710) (-546.935) * (-540.873) (-545.284) (-541.668) [-546.291] -- 0:00:02
953000 -- (-541.425) (-542.870) [-543.012] (-542.828) * (-541.134) (-543.855) (-542.245) [-540.637] -- 0:00:02
953500 -- [-541.970] (-542.840) (-543.404) (-542.761) * (-546.665) (-544.746) (-542.484) [-541.438] -- 0:00:02
954000 -- (-543.484) (-541.008) [-540.857] (-541.827) * (-543.222) (-541.189) (-542.234) [-541.671] -- 0:00:02
954500 -- (-541.811) (-541.516) (-541.025) [-542.528] * [-541.551] (-543.809) (-542.260) (-543.369) -- 0:00:02
955000 -- (-542.373) [-541.156] (-545.740) (-547.968) * (-540.985) (-543.490) [-540.742] (-546.258) -- 0:00:02
Average standard deviation of split frequencies: 0.008475
955500 -- (-540.821) (-541.727) (-541.282) [-542.196] * (-542.067) (-544.545) [-542.146] (-544.234) -- 0:00:02
956000 -- (-542.146) (-540.574) (-543.265) [-543.444] * (-544.778) (-541.645) (-543.527) [-542.165] -- 0:00:02
956500 -- [-542.774] (-541.184) (-546.237) (-542.233) * [-543.730] (-541.011) (-543.555) (-544.038) -- 0:00:02
957000 -- [-543.191] (-544.907) (-545.880) (-543.629) * [-540.572] (-543.846) (-543.165) (-542.823) -- 0:00:02
957500 -- (-543.146) [-542.079] (-544.356) (-542.467) * (-545.495) (-542.421) (-541.362) [-541.856] -- 0:00:02
958000 -- [-542.551] (-541.269) (-543.923) (-543.486) * (-544.347) (-544.707) [-541.869] (-543.250) -- 0:00:02
958500 -- (-544.215) [-544.310] (-544.971) (-542.065) * (-545.244) (-544.303) (-541.919) [-545.229] -- 0:00:02
959000 -- (-542.511) (-544.939) (-543.576) [-544.977] * (-544.282) [-542.950] (-543.259) (-547.302) -- 0:00:02
959500 -- (-547.104) [-544.156] (-544.055) (-545.161) * (-543.379) [-542.810] (-543.666) (-550.520) -- 0:00:02
960000 -- [-544.098] (-545.554) (-543.101) (-542.421) * (-542.175) (-541.435) [-542.171] (-544.910) -- 0:00:02
Average standard deviation of split frequencies: 0.008618
960500 -- (-545.436) (-542.031) [-543.383] (-543.687) * (-541.664) (-545.001) [-541.905] (-542.438) -- 0:00:02
961000 -- (-540.402) [-542.184] (-541.138) (-543.575) * (-541.906) (-544.344) (-546.570) [-542.599] -- 0:00:02
961500 -- [-545.313] (-541.514) (-540.591) (-541.131) * (-541.452) [-541.312] (-542.055) (-543.721) -- 0:00:02
962000 -- (-541.969) (-541.195) (-544.207) [-542.037] * (-542.562) (-543.095) (-541.119) [-542.842] -- 0:00:02
962500 -- [-543.615] (-541.675) (-546.807) (-542.292) * (-542.184) (-543.620) (-541.222) [-542.049] -- 0:00:02
963000 -- (-540.463) [-541.566] (-543.453) (-540.985) * [-540.982] (-542.860) (-544.247) (-545.743) -- 0:00:02
963500 -- (-542.657) (-541.444) (-544.689) [-541.262] * (-546.088) (-542.432) (-541.755) [-546.171] -- 0:00:02
964000 -- (-546.813) (-548.791) (-543.423) [-542.934] * (-547.866) (-542.879) [-546.993] (-542.626) -- 0:00:02
964500 -- (-543.633) [-540.869] (-542.933) (-541.823) * (-540.812) [-541.228] (-544.622) (-545.564) -- 0:00:02
965000 -- (-540.812) [-541.837] (-540.589) (-546.419) * (-544.290) (-546.957) (-544.778) [-545.808] -- 0:00:02
Average standard deviation of split frequencies: 0.007991
965500 -- [-540.839] (-541.736) (-543.038) (-541.844) * (-544.467) (-543.030) [-543.744] (-546.048) -- 0:00:02
966000 -- (-541.432) (-543.029) (-543.913) [-542.748] * (-543.131) (-541.479) (-546.488) [-543.629] -- 0:00:01
966500 -- (-541.152) (-542.594) [-542.073] (-541.786) * (-545.300) [-542.149] (-546.531) (-545.002) -- 0:00:01
967000 -- (-547.790) (-543.904) [-541.216] (-541.980) * (-541.837) (-540.972) [-542.772] (-552.798) -- 0:00:01
967500 -- (-542.287) (-542.275) (-546.841) [-541.113] * (-540.740) [-544.418] (-542.849) (-542.365) -- 0:00:01
968000 -- (-543.624) [-541.171] (-543.958) (-542.133) * [-540.933] (-542.703) (-543.253) (-541.583) -- 0:00:01
968500 -- (-546.327) (-544.301) (-543.399) [-543.282] * [-541.345] (-543.218) (-542.644) (-544.073) -- 0:00:01
969000 -- [-541.430] (-544.054) (-541.202) (-542.405) * (-543.052) [-541.758] (-545.209) (-542.206) -- 0:00:01
969500 -- [-542.621] (-543.226) (-542.291) (-544.033) * (-541.909) (-541.369) (-543.360) [-544.052] -- 0:00:01
970000 -- (-542.125) [-543.050] (-542.934) (-542.828) * (-542.553) (-542.327) (-543.010) [-544.452] -- 0:00:01
Average standard deviation of split frequencies: 0.008226
970500 -- [-541.776] (-542.272) (-542.749) (-544.818) * (-541.236) (-545.601) [-541.998] (-545.677) -- 0:00:01
971000 -- (-542.967) (-543.458) (-540.585) [-543.507] * (-541.186) [-546.230] (-541.972) (-541.150) -- 0:00:01
971500 -- (-542.700) (-541.304) (-541.638) [-540.743] * (-547.158) (-541.726) [-543.163] (-542.121) -- 0:00:01
972000 -- [-540.640] (-541.152) (-541.837) (-541.241) * [-540.570] (-542.084) (-544.411) (-543.569) -- 0:00:01
972500 -- (-542.021) (-545.394) (-545.725) [-542.629] * (-542.117) (-545.609) (-541.547) [-544.858] -- 0:00:01
973000 -- [-543.362] (-544.411) (-542.185) (-541.963) * (-542.429) (-541.065) [-541.316] (-543.663) -- 0:00:01
973500 -- (-541.521) (-546.971) [-542.163] (-540.874) * (-543.815) (-542.125) (-541.100) [-541.876] -- 0:00:01
974000 -- (-541.075) [-544.160] (-543.739) (-540.884) * (-543.084) (-542.399) [-541.329] (-542.101) -- 0:00:01
974500 -- (-542.372) (-541.499) [-543.207] (-541.180) * (-541.610) (-544.705) (-542.612) [-543.345] -- 0:00:01
975000 -- [-542.130] (-541.227) (-541.869) (-543.185) * (-542.485) (-547.334) [-541.295] (-541.308) -- 0:00:01
Average standard deviation of split frequencies: 0.008452
975500 -- (-543.435) (-545.933) [-542.633] (-542.399) * [-543.133] (-544.101) (-540.510) (-540.792) -- 0:00:01
976000 -- [-541.991] (-543.873) (-541.035) (-542.973) * (-542.972) (-541.730) [-542.303] (-542.874) -- 0:00:01
976500 -- (-544.024) [-545.444] (-542.581) (-544.141) * (-540.419) (-544.639) (-542.026) [-544.501] -- 0:00:01
977000 -- (-541.356) [-542.018] (-540.870) (-544.088) * [-540.671] (-543.409) (-541.588) (-541.945) -- 0:00:01
977500 -- [-540.877] (-542.881) (-542.734) (-542.188) * [-542.734] (-543.254) (-544.711) (-541.450) -- 0:00:01
978000 -- (-541.817) (-544.498) [-543.113] (-542.988) * (-548.931) [-542.194] (-542.870) (-542.125) -- 0:00:01
978500 -- (-542.722) (-543.211) [-543.280] (-540.890) * [-543.962] (-545.113) (-543.241) (-546.655) -- 0:00:01
979000 -- (-543.041) (-544.783) (-544.763) [-541.441] * (-541.575) (-545.095) (-541.984) [-545.488] -- 0:00:01
979500 -- (-547.521) (-543.770) [-545.442] (-541.497) * (-542.897) (-546.375) (-540.359) [-543.890] -- 0:00:01
980000 -- [-542.145] (-544.679) (-546.626) (-541.181) * (-542.122) (-546.447) [-543.383] (-543.966) -- 0:00:01
Average standard deviation of split frequencies: 0.008653
980500 -- (-542.353) (-542.355) (-540.640) [-541.642] * (-542.848) [-544.198] (-540.312) (-548.716) -- 0:00:01
981000 -- (-542.669) [-542.127] (-543.276) (-542.001) * (-544.756) [-542.642] (-542.354) (-544.979) -- 0:00:01
981500 -- (-543.146) [-543.929] (-544.136) (-541.403) * [-544.967] (-542.742) (-541.399) (-543.306) -- 0:00:01
982000 -- [-542.463] (-542.816) (-544.430) (-544.336) * (-543.098) [-541.788] (-541.929) (-543.009) -- 0:00:01
982500 -- (-542.466) (-543.514) (-541.401) [-543.299] * (-542.041) [-542.205] (-544.290) (-545.263) -- 0:00:01
983000 -- [-541.396] (-542.452) (-544.902) (-541.456) * (-542.696) [-542.636] (-542.992) (-543.273) -- 0:00:00
983500 -- [-542.377] (-542.827) (-543.704) (-542.048) * (-542.907) (-541.280) (-541.799) [-545.770] -- 0:00:00
984000 -- [-541.771] (-541.636) (-544.037) (-541.695) * (-544.012) (-543.942) (-544.006) [-541.760] -- 0:00:00
984500 -- (-541.060) [-541.369] (-543.099) (-542.714) * (-542.664) (-540.494) [-541.178] (-540.913) -- 0:00:00
985000 -- (-545.563) (-540.226) [-545.982] (-543.713) * (-540.647) (-540.862) [-541.354] (-542.116) -- 0:00:00
Average standard deviation of split frequencies: 0.008486
985500 -- (-547.549) (-541.608) (-548.179) [-541.154] * [-541.119] (-540.252) (-541.373) (-545.039) -- 0:00:00
986000 -- (-546.498) [-545.065] (-541.969) (-541.189) * (-540.633) (-542.566) (-545.341) [-545.831] -- 0:00:00
986500 -- (-543.379) (-543.386) (-542.625) [-542.508] * [-540.977] (-544.005) (-542.586) (-542.936) -- 0:00:00
987000 -- (-542.344) [-548.342] (-544.120) (-541.685) * [-542.752] (-540.529) (-542.098) (-546.624) -- 0:00:00
987500 -- (-540.770) [-541.419] (-542.642) (-543.950) * [-540.592] (-540.717) (-542.353) (-544.427) -- 0:00:00
988000 -- (-541.791) [-542.995] (-542.070) (-541.865) * (-540.888) (-540.717) [-541.620] (-541.248) -- 0:00:00
988500 -- (-542.077) [-543.831] (-543.773) (-541.485) * (-541.580) (-540.944) [-543.135] (-544.469) -- 0:00:00
989000 -- [-545.490] (-544.240) (-545.626) (-543.130) * [-542.551] (-545.599) (-542.796) (-541.554) -- 0:00:00
989500 -- [-544.382] (-541.755) (-542.690) (-542.989) * [-545.619] (-543.224) (-550.989) (-541.114) -- 0:00:00
990000 -- [-541.751] (-540.877) (-543.908) (-541.695) * (-543.050) [-543.291] (-543.692) (-544.476) -- 0:00:00
Average standard deviation of split frequencies: 0.009200
990500 -- [-541.005] (-540.533) (-543.836) (-547.027) * (-541.444) (-544.288) (-541.049) [-541.635] -- 0:00:00
991000 -- (-541.709) (-541.931) [-541.174] (-541.318) * (-543.147) (-543.524) [-543.036] (-541.728) -- 0:00:00
991500 -- (-542.581) (-544.153) (-541.470) [-542.200] * (-545.604) (-542.981) (-541.983) [-540.753] -- 0:00:00
992000 -- (-543.189) [-541.296] (-541.792) (-541.456) * (-544.939) (-543.762) [-540.415] (-545.329) -- 0:00:00
992500 -- [-544.674] (-542.753) (-541.506) (-541.321) * (-545.357) (-542.627) [-540.894] (-541.153) -- 0:00:00
993000 -- (-550.510) (-542.975) [-543.323] (-541.210) * [-542.974] (-546.194) (-540.507) (-544.065) -- 0:00:00
993500 -- [-541.374] (-543.743) (-543.526) (-541.804) * (-545.690) [-543.907] (-544.279) (-541.681) -- 0:00:00
994000 -- (-546.110) (-542.620) (-541.671) [-545.124] * (-541.833) (-541.800) [-541.381] (-541.707) -- 0:00:00
994500 -- (-542.957) (-541.717) (-543.285) [-541.800] * [-540.565] (-543.589) (-543.189) (-542.989) -- 0:00:00
995000 -- (-544.238) (-542.652) [-541.897] (-546.558) * (-540.621) [-540.423] (-541.740) (-544.946) -- 0:00:00
Average standard deviation of split frequencies: 0.009308
995500 -- (-543.222) (-543.815) [-542.472] (-540.620) * [-540.848] (-544.119) (-541.422) (-548.447) -- 0:00:00
996000 -- (-540.478) (-547.679) (-544.423) [-541.702] * (-541.137) (-542.561) (-541.564) [-542.183] -- 0:00:00
996500 -- (-541.209) (-544.488) (-542.721) [-543.785] * [-541.828] (-542.904) (-544.793) (-540.995) -- 0:00:00
997000 -- [-543.791] (-541.282) (-543.963) (-541.394) * (-540.831) (-545.666) (-541.996) [-540.774] -- 0:00:00
997500 -- [-543.391] (-541.849) (-543.401) (-541.921) * (-541.900) (-544.075) (-546.761) [-541.896] -- 0:00:00
998000 -- (-547.023) (-543.707) [-540.681] (-542.110) * (-541.159) [-546.466] (-543.686) (-543.964) -- 0:00:00
998500 -- (-542.736) [-542.235] (-544.643) (-543.981) * [-541.320] (-546.957) (-546.237) (-543.344) -- 0:00:00
999000 -- (-544.573) (-543.270) [-543.303] (-541.717) * [-541.977] (-544.934) (-542.558) (-544.699) -- 0:00:00
999500 -- (-541.846) [-543.201] (-544.576) (-541.220) * [-540.582] (-543.546) (-542.251) (-541.363) -- 0:00:00
1000000 -- (-540.475) (-542.979) [-542.465] (-543.048) * (-543.695) (-541.785) (-553.334) [-544.923] -- 0:00:00
Average standard deviation of split frequencies: 0.009390
Analysis completed in 58 seconds
Analysis used 57.53 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -540.13
Likelihood of best state for "cold" chain of run 2 was -540.13
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
35.3 % ( 26 %) Dirichlet(Pi{all})
34.9 % ( 21 %) Slider(Pi{all})
78.6 % ( 58 %) Multiplier(Alpha{1,2})
77.7 % ( 50 %) Multiplier(Alpha{3})
24.5 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.4 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 33 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.9 % ( 34 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 81 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.3 % ( 29 %) Dirichlet(Pi{all})
35.5 % ( 22 %) Slider(Pi{all})
78.7 % ( 50 %) Multiplier(Alpha{1,2})
77.5 % ( 58 %) Multiplier(Alpha{3})
23.9 % ( 16 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 36 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167285 0.82 0.67
3 | 166464 166044 0.84
4 | 166722 166974 166511
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166365 0.82 0.66
3 | 166600 166286 0.84
4 | 166456 166910 167383
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -541.94
| 1 2 |
|1 1 2 1 2|
| 2 1 * 2 1 1 11 |
| 1 1 2 |
|2 21 1 11* 2 2 *21 1**1 2 2 1 12 2 212 |
| 2 2 2 2 1 2 1 12 22* 2 2 |
| 12 2 1 1 2 1 1 1 1 1 1 1|
| * 2 111 2 2 * 2 2 1 |
| 12 2 2 2 1 2 |
| 2 21 1 2 2 2 2 2 1 1 |
| 1 1 2 1 2 1 2 |
| 2 |
| 1 1 |
| 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -543.61
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -541.87 -545.02
2 -541.84 -545.38
--------------------------------------
TOTAL -541.85 -545.22
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896810 0.088020 0.379227 1.507977 0.863928 1388.14 1444.57 1.000
r(A<->C){all} 0.156734 0.017875 0.000032 0.430068 0.120072 292.04 292.41 1.003
r(A<->G){all} 0.180185 0.021600 0.000029 0.468870 0.144488 169.86 193.77 1.004
r(A<->T){all} 0.161807 0.019422 0.000417 0.442837 0.125010 298.52 318.07 1.004
r(C<->G){all} 0.163843 0.019492 0.000199 0.436465 0.127563 260.95 316.31 1.003
r(C<->T){all} 0.177576 0.020995 0.000094 0.470954 0.143543 130.39 251.48 1.001
r(G<->T){all} 0.159856 0.018422 0.000084 0.427011 0.124374 202.11 232.24 1.000
pi(A){all} 0.214807 0.000409 0.175602 0.255607 0.214393 1311.83 1406.42 1.000
pi(C){all} 0.327974 0.000538 0.283598 0.373742 0.327590 1406.60 1447.10 1.001
pi(G){all} 0.267121 0.000494 0.224425 0.308248 0.267482 1403.87 1406.95 1.001
pi(T){all} 0.190099 0.000370 0.153863 0.227602 0.189364 1315.41 1356.35 1.000
alpha{1,2} 0.424273 0.246133 0.000146 1.416917 0.242261 1048.46 1106.82 1.000
alpha{3} 0.461024 0.242524 0.000289 1.456086 0.299727 1388.55 1444.78 1.000
pinvar{all} 0.995782 0.000030 0.986773 0.999997 0.997441 1258.77 1337.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .*...*
9 -- ..**..
10 -- .***.*
11 -- ....**
12 -- ..*.*.
13 -- .**.**
14 -- ..****
15 -- .*..*.
16 -- .*.***
17 -- ...**.
18 -- ...*.*
19 -- .*.*..
20 -- .****.
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.018373 0.139241 0.165223 2
8 452 0.150566 0.009422 0.143904 0.157229 2
9 445 0.148235 0.008009 0.142572 0.153897 2
10 444 0.147901 0.015075 0.137242 0.158561 2
11 436 0.145237 0.016017 0.133911 0.156562 2
12 434 0.144570 0.011306 0.136576 0.152565 2
13 433 0.144237 0.008951 0.137908 0.150566 2
14 430 0.143238 0.008480 0.137242 0.149234 2
15 429 0.142905 0.002355 0.141239 0.144570 2
16 428 0.142572 0.016959 0.130580 0.154564 2
17 426 0.141905 0.000942 0.141239 0.142572 2
18 417 0.138907 0.002355 0.137242 0.140573 2
19 413 0.137575 0.008009 0.131912 0.143238 2
20 404 0.134577 0.005653 0.130580 0.138574 2
21 397 0.132245 0.008951 0.125916 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099449 0.009956 0.000011 0.303941 0.068786 1.000 2
length{all}[2] 0.101166 0.010098 0.000018 0.299562 0.071669 1.000 2
length{all}[3] 0.099528 0.009532 0.000012 0.296647 0.069290 1.000 2
length{all}[4] 0.098261 0.010372 0.000009 0.294371 0.066552 1.000 2
length{all}[5] 0.098542 0.009249 0.000065 0.294360 0.070574 1.000 2
length{all}[6] 0.098770 0.009606 0.000027 0.296190 0.068632 1.001 2
length{all}[7] 0.098542 0.010825 0.000044 0.330749 0.063363 1.001 2
length{all}[8] 0.097888 0.008964 0.000088 0.286259 0.070135 1.001 2
length{all}[9] 0.101305 0.011133 0.000001 0.333854 0.069028 0.998 2
length{all}[10] 0.099702 0.010105 0.000020 0.300346 0.071382 0.999 2
length{all}[11] 0.111980 0.012624 0.000003 0.333778 0.080599 0.998 2
length{all}[12] 0.101015 0.011218 0.000431 0.324923 0.065674 0.999 2
length{all}[13] 0.103725 0.009598 0.001270 0.280305 0.075517 0.998 2
length{all}[14] 0.100078 0.009700 0.000312 0.275663 0.075341 0.998 2
length{all}[15] 0.102316 0.010603 0.000162 0.340941 0.068363 1.002 2
length{all}[16] 0.104132 0.011191 0.000058 0.289376 0.069961 1.000 2
length{all}[17] 0.101366 0.009075 0.000411 0.294274 0.072529 0.998 2
length{all}[18] 0.104505 0.011569 0.000341 0.316927 0.070881 0.999 2
length{all}[19] 0.104987 0.010869 0.000224 0.318343 0.076109 0.999 2
length{all}[20] 0.098784 0.010405 0.000141 0.293638 0.069979 0.999 2
length{all}[21] 0.091079 0.007928 0.001038 0.285668 0.062924 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009390
Maximum standard deviation of split frequencies = 0.018373
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 396
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 132 / 132 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 132 / 132 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015174 0.092725 0.053844 0.040962 0.051136 0.098277 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -570.886096
Iterating by ming2
Initial: fx= 570.886096
x= 0.01517 0.09273 0.05384 0.04096 0.05114 0.09828 0.30000 1.30000
1 h-m-p 0.0000 0.0001 315.9031 ++ 559.219090 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0059 52.8687 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 288.6924 +++ 542.567810 m 0.0002 45 | 2/8
4 h-m-p 0.0013 0.0079 40.7821 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 259.0582 ++ 537.276191 m 0.0001 76 | 3/8
6 h-m-p 0.0006 0.0109 30.2394 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 224.4472 ++ 536.219000 m 0.0000 107 | 4/8
8 h-m-p 0.0002 0.0144 23.0506 ----------.. | 4/8
9 h-m-p 0.0000 0.0003 182.9076 +++ 526.039398 m 0.0003 138 | 5/8
10 h-m-p 0.0027 0.0232 14.7878 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 130.1375 ++ 525.304922 m 0.0000 170 | 6/8
12 h-m-p 0.2349 8.0000 0.0000 +++ 525.304922 m 8.0000 182 | 6/8
13 h-m-p 0.9933 8.0000 0.0000 ++ 525.304922 m 8.0000 195 | 6/8
14 h-m-p 0.0018 0.8996 0.6542 ------N 525.304922 0 0.0000 214 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 -C 525.304922 0 0.0010 228 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 C 525.304922 0 0.0160 241 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
18 h-m-p 0.0160 8.0000 0.0000 +++++ 525.304922 m 8.0000 281 | 6/8
19 h-m-p 0.0160 8.0000 1.4943 -------------.. | 6/8
20 h-m-p 0.0160 8.0000 0.0000 +++++ 525.304922 m 8.0000 319 | 6/8
21 h-m-p 0.0160 8.0000 0.0241 +++++ 525.304917 m 8.0000 335 | 6/8
22 h-m-p 0.1558 8.0000 1.2395 -------------Y 525.304917 0 0.0000 361 | 6/8
23 h-m-p 0.0160 8.0000 0.0000 +++++ 525.304917 m 8.0000 375 | 6/8
24 h-m-p 0.0040 2.0133 0.0869 +++++ 525.304916 m 2.0133 391 | 7/8
25 h-m-p 0.1051 8.0000 1.0909 -----------C 525.304916 0 0.0000 415 | 7/8
26 h-m-p 0.0446 8.0000 0.0000 --C 525.304916 0 0.0007 428 | 7/8
27 h-m-p 0.0464 8.0000 0.0000 ---------C 525.304916 0 0.0000 449
Out..
lnL = -525.304916
450 lfun, 450 eigenQcodon, 2700 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027279 0.053433 0.056087 0.013427 0.097212 0.043801 0.000100 0.629901 0.305312
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.507555
np = 9
lnL0 = -561.620511
Iterating by ming2
Initial: fx= 561.620511
x= 0.02728 0.05343 0.05609 0.01343 0.09721 0.04380 0.00011 0.62990 0.30531
1 h-m-p 0.0000 0.0000 296.1581 ++ 561.115632 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0004 166.1643 +++ 551.442039 m 0.0004 27 | 2/9
3 h-m-p 0.0001 0.0003 89.6818 ++ 544.452939 m 0.0003 39 | 3/9
4 h-m-p 0.0005 0.0023 59.3464 ++ 535.283707 m 0.0023 51 | 4/9
5 h-m-p 0.0000 0.0000 1087.6119 ++ 531.621739 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 1076.4191 ++ 530.883117 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0002 487.6657 ++ 525.304854 m 0.0002 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 525.304854 m 8.0000 99 | 7/9
9 h-m-p 0.0128 6.3937 0.1404 ----------Y 525.304854 0 0.0000 123 | 7/9
10 h-m-p 0.0160 8.0000 0.0030 +++++ 525.304849 m 8.0000 140 | 7/9
11 h-m-p 0.1083 4.1482 0.2212 ------------C 525.304849 0 0.0000 166 | 7/9
12 h-m-p 0.0160 8.0000 0.0002 ------Y 525.304849 0 0.0000 186 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 525.304849 m 8.0000 203 | 7/9
14 h-m-p 0.0018 0.9153 0.2699 ----------Y 525.304849 0 0.0000 227 | 7/9
15 h-m-p 0.0001 0.0326 2.5583 +++++ 525.304831 m 0.0326 244 | 8/9
16 h-m-p 0.2896 1.4479 0.0388 ++ 525.304808 m 1.4479 256 | 9/9
17 h-m-p 0.0160 8.0000 0.0000 Y 525.304808 0 0.0160 269
Out..
lnL = -525.304808
270 lfun, 810 eigenQcodon, 3240 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046487 0.033129 0.101097 0.016598 0.026826 0.057324 0.000100 1.309358 0.535639 0.220377 1.523618
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.462184
np = 11
lnL0 = -559.584771
Iterating by ming2
Initial: fx= 559.584771
x= 0.04649 0.03313 0.10110 0.01660 0.02683 0.05732 0.00011 1.30936 0.53564 0.22038 1.52362
1 h-m-p 0.0000 0.0000 282.6098 ++ 559.163715 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0010 120.8181 ++++ 547.135610 m 0.0010 32 | 2/11
3 h-m-p 0.0000 0.0002 132.9960 ++ 541.902252 m 0.0002 46 | 3/11
4 h-m-p 0.0002 0.0008 57.1324 ++ 539.263647 m 0.0008 60 | 4/11
5 h-m-p 0.0000 0.0001 370.9676 ++ 535.136587 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0000 2713.0557 ++ 534.405889 m 0.0000 88 | 6/11
7 h-m-p 0.0001 0.0012 65.2094 ++ 529.895110 m 0.0012 102 | 7/11
8 h-m-p 0.0027 0.0133 10.1177 ++ 525.304890 m 0.0133 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 525.304890 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 0.0162 +++++ 525.304887 m 8.0000 150 | 8/11
11 h-m-p 0.0721 8.0000 1.7942 --------------.. | 8/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 525.304887 m 8.0000 196 | 8/11
13 h-m-p 0.0002 0.1204 11.7024 +++++ 525.304845 m 0.1204 216 | 9/11
14 h-m-p 0.1514 8.0000 8.4521 -------------C 525.304845 0 0.0000 243 | 9/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 525.304845 m 8.0000 260 | 9/11
16 h-m-p 0.0160 8.0000 0.1838 -----------N 525.304845 0 0.0000 287 | 9/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 525.304845 m 8.0000 306 | 9/11
18 h-m-p 0.0160 8.0000 3.0248 +++++ 525.304808 m 8.0000 325 | 9/11
19 h-m-p 1.6000 8.0000 0.0000 N 525.304808 0 1.6000 339 | 9/11
20 h-m-p 0.0160 8.0000 0.0000 Y 525.304808 0 0.0160 355
Out..
lnL = -525.304808
356 lfun, 1424 eigenQcodon, 6408 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -525.334874 S = -525.305414 -0.011325
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:03
did 20 / 50 patterns 0:04
did 30 / 50 patterns 0:04
did 40 / 50 patterns 0:04
did 50 / 50 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074284 0.010638 0.106582 0.066254 0.019350 0.013718 0.000100 1.099850 1.734740
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.177190
np = 9
lnL0 = -561.461307
Iterating by ming2
Initial: fx= 561.461307
x= 0.07428 0.01064 0.10658 0.06625 0.01935 0.01372 0.00011 1.09985 1.73474
1 h-m-p 0.0000 0.0000 296.5059 ++ 561.047788 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0430 25.6683 +++++ 557.753196 m 0.0430 29 | 2/9
3 h-m-p 0.0002 0.0012 240.2654 +
QuantileBeta(0.15, 0.00500, 2.15797) = 1.223527e-160 2000 rounds
+ 552.240303 m 0.0012 41
QuantileBeta(0.15, 0.00500, 2.15797) = 1.223527e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15797) = 1.223527e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15797) = 1.223527e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15797) = 1.223527e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15797) = 1.223527e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15797) = 1.223527e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15797) = 1.223527e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15797) = 1.223526e-160 2000 rounds
| 3/9
4 h-m-p 0.0010 0.0051 88.2858 ++ 548.949012 m 0.0051 53 | 4/9
5 h-m-p 0.0001 0.0003 205.5001 ++ 545.020088 m 0.0003 65 | 5/9
6 h-m-p 0.0005 0.0025 53.6038 -----------.. | 5/9
7 h-m-p 0.0000 0.0001 205.7522 ++ 542.354479 m 0.0001 98 | 6/9
8 h-m-p 0.0035 0.1121 2.9648 ------------.. | 6/9
9 h-m-p 0.0000 0.0001 165.0709 ++ 538.784347 m 0.0001 132 | 7/9
10 h-m-p 0.0160 8.0000 0.9098 -------------.. | 7/9
11 h-m-p 0.0000 0.0010 111.2912 ++++ 525.304808 m 0.0010 171 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 N 525.304808 0 1.6000 183 | 8/9
13 h-m-p 0.0160 8.0000 0.0000 +Y 525.304808 0 0.0640 197
Out..
lnL = -525.304808
198 lfun, 2178 eigenQcodon, 11880 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.087536 0.041198 0.103766 0.023178 0.097562 0.026167 0.000100 0.900000 0.285992 1.367494 1.317808
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 20.394022
np = 11
lnL0 = -568.440296
Iterating by ming2
Initial: fx= 568.440296
x= 0.08754 0.04120 0.10377 0.02318 0.09756 0.02617 0.00011 0.90000 0.28599 1.36749 1.31781
1 h-m-p 0.0000 0.0000 251.5689 ++ 568.311195 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0008 156.9891 ++++ 553.277530 m 0.0008 32 | 2/11
3 h-m-p 0.0000 0.0000 221.3442 ++ 551.616287 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0013 114.7195 ++ 543.895540 m 0.0013 60 | 4/11
5 h-m-p 0.0000 0.0002 553.2359 ++ 536.310274 m 0.0002 74 | 5/11
6 h-m-p 0.0047 0.0234 11.0354 ++ 534.942188 m 0.0234 88 | 6/11
7 h-m-p 0.0001 0.0005 338.6155 ++ 532.165366 m 0.0005 102 | 7/11
8 h-m-p 0.0002 0.0008 511.2177 ++ 531.061925 m 0.0008 116 | 7/11
9 h-m-p 0.0838 0.7700 5.0823 ++ 525.304852 m 0.7700 130 | 8/11
10 h-m-p 1.6000 8.0000 0.0062 ++ 525.304851 m 8.0000 144 | 8/11
11 h-m-p 0.0060 0.5715 8.2949 ++++ 525.304815 m 0.5715 163 | 9/11
12 h-m-p 0.7833 3.9165 0.0520 ++ 525.304808 m 3.9165 177 | 10/11
13 h-m-p 1.6000 8.0000 0.0010 -C 525.304808 0 0.1000 194 | 10/11
14 h-m-p 0.5000 8.0000 0.0002 --N 525.304808 0 0.0078 211 | 10/11
15 h-m-p 1.6000 8.0000 0.0000 N 525.304808 0 1.6000 226
Out..
lnL = -525.304808
227 lfun, 2724 eigenQcodon, 14982 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -525.343786 S = -525.305413 -0.016957
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:10
did 20 / 50 patterns 0:11
did 30 / 50 patterns 0:11
did 40 / 50 patterns 0:11
did 50 / 50 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132
NC_011896_1_WP_010907502_1_68_MLBR_RS00340 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
NC_002677_1_NP_301177_1_49_ML0069 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
**************************************************
NC_011896_1_WP_010907502_1_68_MLBR_RS00340 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
NC_002677_1_NP_301177_1_49_ML0069 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360 GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR
**************************************************
NC_011896_1_WP_010907502_1_68_MLBR_RS00340 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
NC_002677_1_NP_301177_1_49_ML0069 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360 RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
********************************
>NC_011896_1_WP_010907502_1_68_MLBR_RS00340 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG >NC_002677_1_NP_301177_1_49_ML0069 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG >NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG >NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG >NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG >NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360 ATGAGCACGACATTCGCTGCCCGCCTAAACCGCCTGTTCGACACGGTGTA TCCACCCGGGCGCGGGCCGCACACCTCTGCCGAGGTAATCGCAGCGCTCA AGGCGGAGGGCATCACCATGTCGGCTCCTTACCTGTCACAGCTCCGCTCC GGTAATCGCACGAACCCTTCGTCAGCCACGATATCCGCCCTTGCCAACTT CTTCCGCATCAAACCGGCCTATTTCACCAACGACGAGTATTACGAAAAAC TCGATCAAGAATTGGCATGGCTGGCCACCATGCGTGATGAAGGCGTGCGC CGGATCGCGATGCGGACCATCGGGTTGTCTGCCCAAGCTCAGCAGGACAT CGTGGATCGAGTCGACGAACTACGGCGTGCGGAGCATCTTGACGTG
>NC_011896_1_WP_010907502_1_68_MLBR_RS00340 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV >NC_002677_1_NP_301177_1_49_ML0069 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV >NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV >NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV >NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV >NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360 MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS GNRTNPSSATISALANFFRIKPAYFTNDEYYEKLDQELAWLATMRDEGVR RIAMRTIGLSAQAQQDIVDRVDELRRAEHLDV
#NEXUS
[ID: 0027983882]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907502_1_68_MLBR_RS00340
NC_002677_1_NP_301177_1_49_ML0069
NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055
NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240
NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350
NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907502_1_68_MLBR_RS00340,
2 NC_002677_1_NP_301177_1_49_ML0069,
3 NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055,
4 NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240,
5 NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350,
6 NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06878645,2:0.07166931,3:0.06929029,4:0.06655248,5:0.070574,6:0.0686322);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06878645,2:0.07166931,3:0.06929029,4:0.06655248,5:0.070574,6:0.0686322);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -541.87 -545.02
2 -541.84 -545.38
--------------------------------------
TOTAL -541.85 -545.22
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0069/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896810 0.088020 0.379227 1.507977 0.863928 1388.14 1444.57 1.000
r(A<->C){all} 0.156734 0.017875 0.000032 0.430068 0.120072 292.04 292.41 1.003
r(A<->G){all} 0.180185 0.021600 0.000029 0.468870 0.144488 169.86 193.77 1.004
r(A<->T){all} 0.161807 0.019422 0.000417 0.442837 0.125010 298.52 318.07 1.004
r(C<->G){all} 0.163843 0.019492 0.000199 0.436465 0.127563 260.95 316.31 1.003
r(C<->T){all} 0.177576 0.020995 0.000094 0.470954 0.143543 130.39 251.48 1.001
r(G<->T){all} 0.159856 0.018422 0.000084 0.427011 0.124374 202.11 232.24 1.000
pi(A){all} 0.214807 0.000409 0.175602 0.255607 0.214393 1311.83 1406.42 1.000
pi(C){all} 0.327974 0.000538 0.283598 0.373742 0.327590 1406.60 1447.10 1.001
pi(G){all} 0.267121 0.000494 0.224425 0.308248 0.267482 1403.87 1406.95 1.001
pi(T){all} 0.190099 0.000370 0.153863 0.227602 0.189364 1315.41 1356.35 1.000
alpha{1,2} 0.424273 0.246133 0.000146 1.416917 0.242261 1048.46 1106.82 1.000
alpha{3} 0.461024 0.242524 0.000289 1.456086 0.299727 1388.55 1444.78 1.000
pinvar{all} 0.995782 0.000030 0.986773 0.999997 0.997441 1258.77 1337.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0069/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 132
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 7 7 7 7 7 7
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 2 2 2 2 2 2 | CAG 3 3 3 3 3 3 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 6 6 6 6 6 6 | ACC 5 5 5 5 5 5 | AAC 4 4 4 4 4 4 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 4 4 4 4 4 4 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 3 3 3 3 | Gly GGT 1 1 1 1 1 1
GTC 1 1 1 1 1 1 | GCC 8 8 8 8 8 8 | GAC 5 5 5 5 5 5 | GGC 2 2 2 2 2 2
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 4 4 4 4 4 4 | GGA 0 0 0 0 0 0
GTG 4 4 4 4 4 4 | GCG 4 4 4 4 4 4 | GAG 4 4 4 4 4 4 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907502_1_68_MLBR_RS00340
position 1: T:0.15909 C:0.27273 A:0.22727 G:0.34091
position 2: T:0.25758 C:0.31061 A:0.27273 G:0.15909
position 3: T:0.15152 C:0.40152 A:0.14394 G:0.30303
Average T:0.18939 C:0.32828 A:0.21465 G:0.26768
#2: NC_002677_1_NP_301177_1_49_ML0069
position 1: T:0.15909 C:0.27273 A:0.22727 G:0.34091
position 2: T:0.25758 C:0.31061 A:0.27273 G:0.15909
position 3: T:0.15152 C:0.40152 A:0.14394 G:0.30303
Average T:0.18939 C:0.32828 A:0.21465 G:0.26768
#3: NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055
position 1: T:0.15909 C:0.27273 A:0.22727 G:0.34091
position 2: T:0.25758 C:0.31061 A:0.27273 G:0.15909
position 3: T:0.15152 C:0.40152 A:0.14394 G:0.30303
Average T:0.18939 C:0.32828 A:0.21465 G:0.26768
#4: NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240
position 1: T:0.15909 C:0.27273 A:0.22727 G:0.34091
position 2: T:0.25758 C:0.31061 A:0.27273 G:0.15909
position 3: T:0.15152 C:0.40152 A:0.14394 G:0.30303
Average T:0.18939 C:0.32828 A:0.21465 G:0.26768
#5: NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350
position 1: T:0.15909 C:0.27273 A:0.22727 G:0.34091
position 2: T:0.25758 C:0.31061 A:0.27273 G:0.15909
position 3: T:0.15152 C:0.40152 A:0.14394 G:0.30303
Average T:0.18939 C:0.32828 A:0.21465 G:0.26768
#6: NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360
position 1: T:0.15909 C:0.27273 A:0.22727 G:0.34091
position 2: T:0.25758 C:0.31061 A:0.27273 G:0.15909
position 3: T:0.15152 C:0.40152 A:0.14394 G:0.30303
Average T:0.18939 C:0.32828 A:0.21465 G:0.26768
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 18 | Cys C TGT 0
TTC 30 | TCC 12 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 12
CTC 18 | CCC 6 | CAC 6 | CGC 42
CTA 12 | CCA 6 | Gln Q CAA 12 | CGA 6
CTG 18 | CCG 12 | CAG 18 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 36 | ACC 30 | AAC 24 | AGC 6
ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 24 | ACG 24 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 18 | Asp D GAT 18 | Gly G GGT 6
GTC 6 | GCC 48 | GAC 30 | GGC 12
GTA 6 | GCA 12 | Glu E GAA 24 | GGA 0
GTG 24 | GCG 24 | GAG 24 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15909 C:0.27273 A:0.22727 G:0.34091
position 2: T:0.25758 C:0.31061 A:0.27273 G:0.15909
position 3: T:0.15152 C:0.40152 A:0.14394 G:0.30303
Average T:0.18939 C:0.32828 A:0.21465 G:0.26768
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -525.304916 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.317808
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907502_1_68_MLBR_RS00340: 0.000004, NC_002677_1_NP_301177_1_49_ML0069: 0.000004, NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055: 0.000004, NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240: 0.000004, NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350: 0.000004, NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.31781
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 314.5 81.5 1.3178 0.0000 0.0000 0.0 0.0
7..2 0.000 314.5 81.5 1.3178 0.0000 0.0000 0.0 0.0
7..3 0.000 314.5 81.5 1.3178 0.0000 0.0000 0.0 0.0
7..4 0.000 314.5 81.5 1.3178 0.0000 0.0000 0.0 0.0
7..5 0.000 314.5 81.5 1.3178 0.0000 0.0000 0.0 0.0
7..6 0.000 314.5 81.5 1.3178 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -525.304808 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907502_1_68_MLBR_RS00340: 0.000004, NC_002677_1_NP_301177_1_49_ML0069: 0.000004, NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055: 0.000004, NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240: 0.000004, NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350: 0.000004, NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -525.304808 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907502_1_68_MLBR_RS00340: 0.000004, NC_002677_1_NP_301177_1_49_ML0069: 0.000004, NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055: 0.000004, NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240: 0.000004, NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350: 0.000004, NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907502_1_68_MLBR_RS00340)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -525.304808 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.787034
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907502_1_68_MLBR_RS00340: 0.000004, NC_002677_1_NP_301177_1_49_ML0069: 0.000004, NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055: 0.000004, NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240: 0.000004, NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350: 0.000004, NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.78703
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -525.304808 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.726123 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907502_1_68_MLBR_RS00340: 0.000004, NC_002677_1_NP_301177_1_49_ML0069: 0.000004, NZ_LVXE01000014_1_WP_010907502_1_510_A3216_RS06055: 0.000004, NZ_LYPH01000018_1_WP_010907502_1_687_A8144_RS03240: 0.000004, NZ_CP029543_1_WP_010907502_1_67_DIJ64_RS00350: 0.000004, NZ_AP014567_1_WP_010907502_1_69_JK2ML_RS00360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.72612
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 314.5 81.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907502_1_68_MLBR_RS00340)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:11
Model 1: NearlyNeutral -525.304808 Model 2: PositiveSelection -525.304808 Model 0: one-ratio -525.304916 Model 7: beta -525.304808 Model 8: beta&w>1 -525.304808 Model 0 vs 1 2.1600000013677345E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
